The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
119
|
sequence length |
326
|
structure length |
322
|
Chain Sequence |
AKNVVLDHDGNLDDFVAMVLLASNTEKVRLIGALCTDADCFVENGFNVTGKIMCLMHNNMNLPLFPIGKSAATAVNPFPKEWRCLAKNMDDMPILNIPENVELWDKIKAENEKYEGQQLLADLVMNSEEKVTICVTGPLSNVAWCIDKYGEKFTSKVEECVIMGGAVDVRGNVFLPSTDGTAEWNIYWDPASAKTVFGCPGLRRIMFSLDSTNTVPVRSPYVQRFGEQTNFLLSILVGTMWAMCTHCEGDGYYAWDALTAAYVVDQKVANVDPVPIDVVVDKQPNEGATVRTDAENYPLTFVARNPEAEFFLDMLLRSARAC
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Crystal structures of T. vivax nucleoside hydrolase in complex with new potent and specific inhibitors.
pubmed doi rcsb |
molecule tags |
Hydrolase
|
source organism |
Trypanosoma vivax
|
molecule keywords |
IAG-nucleoside hydrolase
|
total genus |
119
|
structure length |
322
|
sequence length |
326
|
chains with identical sequence |
B
|
ec nomenclature |
ec
3.2.2.1: Purine nucleosidase. |
pdb deposition date | 2008-09-30 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF01156 | IU_nuc_hydro | Inosine-uridine preferring nucleoside hydrolase |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | Alpha-Beta Complex | Inosine-uridine Nucleoside N-ribohydrolase; Chain A | Ribonucleoside hydrolase-like |
#chains in the Genus database with same CATH superfamily 4WR2 A; 4KL0 A; 1HOZ A; 1KIE A; 2MAS A; 2YHG A; 2FF2 A; 1YOE A; 3G5I A; 4I70 A; 3EPW A; 4I72 A; 3FZ0 A; 4P5F A; 3B9G A; 1KIC A; 1MAS A; 1Q8F A; 3T8J A; 3B9X A; 4I71 A; 1EZR A; 2FF1 A; 3MKN A; 4KPN A; 1HP0 A; 2C40 A; 4I75 A; 4I73 A; 3EPX A; 5TSQ A; 3T8I A; 1R4F A; 4I74 A; 3MKM A; 4KPO A; #chains in the Genus database with same CATH topology 4WR2 A; 4KL0 A; 1HOZ A; 1KIE A; 2MAS A; 2YHG A; 2FF2 A; 1YOE A; 3G5I A; 4I70 A; 3EPW A; 4I72 A; 3FZ0 A; 4P5F A; 3B9G A; 1KIC A; 1MAS A; 1Q8F A; 3T8J A; 3B9X A; 4I71 A; 1EZR A; 2FF1 A; 3MKN A; 4KPN A; 1HP0 A; 2C40 A; 4I75 A; 4I73 A; 3EPX A; 5TSQ A; 3T8I A; 1R4F A; 4I74 A; 3MKM A; 4KPO A; #chains in the Genus database with same CATH homology 4WR2 A; 4KL0 A; 1HOZ A; 1KIE A; 2MAS A; 2YHG A; 2FF2 A; 1YOE A; 3G5I A; 4I70 A; 3EPW A; 4I72 A; 3FZ0 A; 4P5F A; 3B9G A; 1KIC A; 1MAS A; 1Q8F A; 3T8J A; 3B9X A; 4I71 A; 1EZR A; 2FF1 A; 3MKN A; 4KPN A; 1HP0 A; 2C40 A; 4I75 A; 4I73 A; 3EPX A; 5TSQ A; 3T8I A; 1R4F A; 4I74 A; 3MKM A; 4KPO A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...