The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
133
|
sequence length |
422
|
structure length |
422
|
Chain Sequence |
IKLDLPINFGPAFEGESIRKGDMYVEMGGNRTPAFELVRTVSESEITDGKIEVIGPDIDQIPEGSKLPLGILVDIYGRKMQADFEGVLERRIHDFINYGEGLWHTGQRNINWLRVSKDAVAKGFRFKNYGEILVAKMKEEFPAIVDRVQVTIFTDEAKVKEYMEVAREKYKERDDRMRGLTDETVDTFYSCVLCQSFAPNHVCIVTPERVGLCGAVSWLDAKASYEINHAGPNQPIPKEGEIDPIKGIWKSVNDYLYTASNRNLEQVCLYTLMENPMTSCGCFEAIMAILPECNGIMITTRDHAGMTPSGMTFSTLAGMIGGGTQTPGFMGIGRTYIVSKKFISADGGIARIVWMPKSLKDFLHDEVVRRSVEEGLGEDFIDKIADETIGTTVDEILPYLEEKGHPALTMDPIMRSHTSRGH
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Transferase
|
source organism |
Moorella thermoacetica
|
publication title |
Novel domain arrangement in the crystal structure of a truncated acetyl-CoA synthase from Moorella thermoacetica
pubmed doi rcsb |
molecule keywords |
Carbon monoxide dehydrogenase/acetyl-CoA synthase subunit al
|
total genus |
133
|
structure length |
422
|
sequence length |
422
|
chains with identical sequence |
B, C, D, E, F
|
ec nomenclature |
ec
2.3.1.169: CO-methylating acetyl-CoA synthase. |
pdb deposition date | 2009-03-06 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF03598 | CdhC | CO dehydrogenase/acetyl-CoA synthase complex beta subunit |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | Bifunctional carbon monoxide dehydrogenase/acetyl-coa synthase(codh/acs), Chain M, domain 3 | Bifunctional carbon monoxide dehydrogenase/acetyl-coa synthase(codh/acs), Chain M, domain 3 | ||
Alpha Beta | 3-Layer(aba) Sandwich | Ribonuclease HI; Chain A | Carbon monoxide dehydrogenase alpha subunit. Chain D, domain 4 | ||
Alpha Beta | 3-Layer(aba) Sandwich | Bifunctional carbon monoxide dehydrogenase/acetyl-coa synthase(codh/acs), Chain M, domain 5 | Bifunctional carbon monoxide dehydrogenase/acetyl-coa synthase(codh/acs), Chain M, domain 5 |
#chains in the Genus database with same CATH superfamily 1OAO C; 3S2X A; 2Z8Y M; 3I04 M; 3GIT A; 3I01 M; 5H6W A; 1MJG M; 1RU3 A; #chains in the Genus database with same CATH topology 1OAO C; 1QHK A; 3S2X A; 2Z8Y M; 3I04 M; 3GIT A; 3DOA A; 3I01 M; 5H3X A; 1MJG M; 3BL4 A; 5H6W A; 1RU3 A; 3PMQ A; 3BSU A; #chains in the Genus database with same CATH homology 1OAO C; 3S2X A; 2Z8Y M; 3I04 M; 3GIT A; 3I01 M; 5H6W A; 1MJG M; 1RU3 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...