3RIIA

Crystal structure of the catalytic domain of uchl5, a proteasome-associated human deubiquitinating enzyme, reveals an unproductive form of the enzyme
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
Knots found
sequence length
222
structure length
212
Chain Sequence
GEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSRLDTIFFAKQVINNASATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin carboxyl-terminal hydrolase isozyme L5
publication title Crystal structure of the catalytic domain of UCHL5, a proteasome-associated human deubiquitinating enzyme, reveals an unproductive form of the enzyme.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 68
structure length 212
sequence length 222
chains with identical sequence B
other databases KnotProt 2.0: K -52 -31 -31
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01088 Peptidase_C12 Ubiquitin carboxyl-terminal hydrolase, family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.532.10 Alpha Beta 3-Layer(aba) Sandwich Ubiquitin C-terminal Hydrolase UCH-l3 Peptidase C12, ubiquitin carboxyl-terminal hydrolase 3riiA00
4I6NA 4UELA 3TB3A 1XD3A 2LENA 3RIIA 3IRTA 1CMXA 1UCHA 3IFWA 3A7SA 3KW5A 4IG7A 3IHRA 2ETLA 4DM9A 4UEMA 3RISA 4JKJA 3KVFA
chains in the Genus database with same CATH superfamily
4I6NA 4UELA 3TB3A 1XD3A 2LENA 3RIIA 3IRTA 1CMXA 1UCHA 3IFWA 3A7SA 3KW5A 4IG7A 3IHRA 2ETLA 4DM9A 4UEMA 3RISA 4JKJA 3KVFA
chains in the Genus database with same CATH topology
4I6NA 4UELA 3TB3A 1XD3A 2LENA 3RIIA 3IRTA 1CMXA 1UCHA 3IFWA 3A7SA 3KW5A 4IG7A 3IHRA 2ETLA 4DM9A 4UEMA 3RISA 4JKJA 3KVFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I6N A;  4UEL A;  3TB3 A;  1XD3 A;  2LEN A;  3RII A;  3IRT A;  1CMX A;  1UCH A;  3IFW A;  3A7S A;  3KW5 A;  4IG7 A;  3IHR A;  2ETL A;  4DM9 A;  4UEM A;  3RIS A;  4JKJ A;  3KVF A; 
#chains in the Genus database with same CATH topology
 4I6N A;  4UEL A;  3TB3 A;  1XD3 A;  2LEN A;  3RII A;  3IRT A;  1CMX A;  1UCH A;  3IFW A;  3A7S A;  3KW5 A;  4IG7 A;  3IHR A;  2ETL A;  4DM9 A;  4UEM A;  3RIS A;  4JKJ A;  3KVF A; 
#chains in the Genus database with same CATH homology
 4I6N A;  4UEL A;  3TB3 A;  1XD3 A;  2LEN A;  3RII A;  3IRT A;  1CMX A;  1UCH A;  3IFW A;  3A7S A;  3KW5 A;  4IG7 A;  3IHR A;  2ETL A;  4DM9 A;  4UEM A;  3RIS A;  4JKJ A;  3KVF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...