The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
64
|
Knots found |
|
sequence length |
229
|
structure length |
219
|
Chain Sequence |
PLGSMAEGNWCLIESDPGIFTEMIHGFGCTGLQVEELVVLDESIEHLKPIHGFIFLFRWLKKEMRKEVDDSPQTCTDVYFSQQVIQNACASQALINLLLNCDHPDVDLGPTLKEFKDFTYDLDSASRGLCLTNSEKIRAVHNSFGQKLDEEDVFHFVTYVPVNDGVYELDGLRAAPLRLGTVASDGDWTEVAIKAIKEKIKNYGESEVRFNLMAVISDQ
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Stabilization of an Unusual Salt Bridge in Ubiquitin by the Extra C-Terminal Domain of the Proteasome-Associated Deubiquitinase UCH37 as a Mechanism of Its Exo Specificity.
pubmed doi rcsb |
| molecule keywords |
Ubiquitin carboxyl-hydrolase
|
| molecule tags |
Hydrolase/signaling protein
|
| source organism |
Trichinella spiralis
|
| total genus |
64
|
| structure length |
219
|
| sequence length |
229
|
| chains with identical sequence |
C
|
| other databases |
|
| ec nomenclature | |
| pdb deposition date | 2012-11-29 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 3-Layer(aba) Sandwich | Ubiquitin C-terminal Hydrolase UCH-l3 | Peptidase C12, ubiquitin carboxyl-terminal hydrolase |
#chains in the Genus database with same CATH superfamily 3KVF A; 4I6N A; 2LEN A; 3IFW A; 3TB3 A; 4UEL A; 1XD3 A; 3IHR A; 1UCH A; 4UEM A; 3KW5 A; 4IG7 A; 4DM9 A; 2ETL A; 4JKJ A; 3A7S A; 3RII A; 3IRT A; 3RIS A; 1CMX A; #chains in the Genus database with same CATH topology 3KVF A; 4I6N A; 2LEN A; 3IFW A; 3TB3 A; 4UEL A; 1XD3 A; 3IHR A; 1UCH A; 4UEM A; 3KW5 A; 4IG7 A; 4DM9 A; 2ETL A; 4JKJ A; 3A7S A; 3RII A; 3IRT A; 3RIS A; 1CMX A; #chains in the Genus database with same CATH homology 3KVF A; 4I6N A; 2LEN A; 3IFW A; 3TB3 A; 4UEL A; 1XD3 A; 3IHR A; 1UCH A; 4UEM A; 3KW5 A; 4IG7 A; 4DM9 A; 2ETL A; 4JKJ A; 3A7S A; 3RII A; 3IRT A; 3RIS A; 1CMX A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...