The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
1
|
sequence length |
83
|
structure length |
79
|
Chain Sequence |
FDEDYFGSDVTVQSSNTTDEIIRDASGAVIEEQITTKKMQRKNILGKNEKMIKTFVITTDSDGNESIVEEDVLMKTLSD
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Protein fibril
|
molecule keywords |
Fibroin heavy chain
|
publication title |
N-Terminal Domain of Bombyx mori Fibroin Mediates the Assembly of Silk in Response to pH Decrease.
pubmed doi rcsb |
source organism |
Bombyx mori
|
total genus |
1
|
structure length |
79
|
sequence length |
83
|
chains with identical sequence |
B
|
ec nomenclature | |
pdb deposition date | 2011-10-20 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | Pantoate--beta-alanine Ligase; Chain: A,domain 2 | Pantoate--beta-alanine Ligase; Chain: A,domain 2 |
#chains in the Genus database with same CATH superfamily 3UA0 A; #chains in the Genus database with same CATH topology 1MOP A; 4MUK A; 4G5F A; 2A54 A; 3IUE A; 2A88 A; 3CI0 I; 1N2G A; 3IOB A; 3COZ A; 4DDH A; 3COW A; 3CI0 K; 5HG0 A; 3COV A; 2A7X A; 3IMC A; 3N8H A; 4MUG A; 2RET A; 1IHO A; 3IOD A; 4MUL A; 3CFA L; 3LE8 A; 2A84 A; 3IUB A; 1UFV A; 2OGF A; 4MUN A; 2GW4 A; 3UY4 A; 3IVG A; 4IXJ A; 3AG5 A; 4MUH A; 4G5Y A; 3Q12 A; 3CFH L; 1N2H A; 2A56 A; 2EJC A; 3COY A; 4EFK A; 4MUE A; 1N2I A; 3CFF L; 2A50 A; 4BHR A; 4DDM A; 4MUJ A; 2X3F A; 4MUF A; 1N2O A; 3LF4 A; 5EXC A; 2G2S A; 4EF6 A; 3MXT A; 3UA0 A; 2I52 A; 1N2J A; 3HL6 A; 2A86 A; 3QTT A; 2A53 A; 2GR7 A; 4MQ6 A; 2IEC A; 3IOC A; 3Q10 A; 3MUE A; 3CFI A; 3IVX A; 3AG6 A; 2A52 A; 3IOE A; 4MUI A; 2G5Z A; 2LME A; 5KWV A; 3UK2 A; 4DDK A; 1V8F A; 3IMG A; 4FZJ A; 4DE5 A; 2G3D A; 3IME A; 3ISJ A; 1N2B A; 2GR8 A; 5BW0 B; 3INN A; 2G16 A; 5G2F A; 1N2E A; 3EMO A; 3IVC A; #chains in the Genus database with same CATH homology 1MOP A; 4MUK A; 4G5F A; 2A54 A; 3IUE A; 2A88 A; 1N2G A; 3IOB A; 3COZ A; 4DDH A; 3COW A; 5HG0 A; 3COV A; 2A7X A; 3IMC A; 3N8H A; 4MUG A; 1IHO A; 3IOD A; 4MUL A; 3CFA L; 3LE8 A; 2A84 A; 3IUB A; 1UFV A; 4MUN A; 2GW4 A; 3UY4 A; 3IVG A; 4IXJ A; 3AG5 A; 4MUH A; 4G5Y A; 3Q12 A; 3CFH L; 1N2H A; 2A56 A; 2EJC A; 3COY A; 4EFK A; 4MUE A; 1N2I A; 3CFF L; 2A50 A; 4BHR A; 4DDM A; 4MUJ A; 2X3F A; 4MUF A; 1N2O A; 3LF4 A; 5EXC A; 2G2S A; 4EF6 A; 3MXT A; 3UA0 A; 1N2J A; 3HL6 A; 2A86 A; 3QTT A; 2A53 A; 4MQ6 A; 3IOC A; 3Q10 A; 3MUE A; 3IVX A; 3AG6 A; 2A52 A; 3IOE A; 4MUI A; 2G5Z A; 5KWV A; 3UK2 A; 4DDK A; 1V8F A; 3IMG A; 4FZJ A; 4DE5 A; 2G3D A; 3IME A; 3ISJ A; 1N2B A; 3INN A; 2G16 A; 5G2F A; 1N2E A; 3IVC A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...