The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
41
|
sequence length |
106
|
structure length |
106
|
Chain Sequence |
PGCLPAYDALAGQFIEASSREARQAILKQGQDGLSGVKETDKKWASQYLKIMGKILDQGEDFPASELARISKLIENKMSEGKKEELQRSLNILTAFRKKGAEKEEL
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Thioredoxin fold as homodimerization module in the putative chaperone ERp29: NMR structures of the domains and experimental model of the 51 kDa dimer.
pubmed doi rcsb |
| molecule tags |
Chaperone
|
| source organism |
Rattus norvegicus
|
| molecule keywords |
ENDOPLASMIC RETICULUM PROTEIN ERP29
|
| total genus |
41
|
| structure length |
106
|
| sequence length |
106
|
| ec nomenclature | |
| pdb deposition date | 2000-11-10 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF07749 | ERp29 | Endoplasmic reticulum protein ERp29, C-terminal domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Up-down Bundle | Endoplasmic reticulum protein erp29 | Endoplasmic reticulum resident protein 29, C-terminal domain |
#chains in the Genus database with same CATH superfamily 2C1Y A; 1OVN A; 2C0G A; 2QC7 A; 2C0E A; 1G7D A; 2C0F A; 2M66 A; #chains in the Genus database with same CATH topology 2C1Y A; 1OVN A; 2C0G A; 2QC7 A; 2C0E A; 1G7D A; 2C0F A; 2M66 A; #chains in the Genus database with same CATH homology 2C1Y A; 1OVN A; 2C0G A; 2QC7 A; 2C0E A; 1G7D A; 2C0F A; 2M66 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
