2C0FA

Structure of wind y53f mutant
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
228
structure length
228
Chain Sequence
CTGCVDLDELSFEKTVERFPYSVVKFDIAFPYGEKHEAFTAFSKSAHKATKDLLIATVGVKDYGELENKALGDRYKVDDKNFPSIFLFKGNADEYVQLPSHVDVTLDNLKAFVSANTPLYIGRDGCIKEFNEVLKNYANIPDAEQLKLIEKLQAKQEQLTDPEQQQNARAYLIYMRKIHEVGYDFLEEETKRLLRLKAGKVTEAKKEELLRKLNILEVFRVHKVTKTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Elucidation of the Pdi-Related Chaperone Wind with the Help of Mutants.
pubmed doi rcsb
molecule keywords WINDBEUTEL PROTEIN
source organism Drosophila melanogaster
molecule tags Chaperone
total genus 70
structure length 228
sequence length 228
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07749 ERp29 Endoplasmic reticulum protein ERp29, C-terminal domain
A PF07912 ERp29_N ERp29, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1150.12 Mainly Alpha Up-down Bundle Endoplasmic reticulum protein erp29 Endoplasmic reticulum resident protein 29, C-terminal domain 2c0fA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2c0fA01
2OBIA 2JU5A 3A3TA 4I97A 3F3QA 2FY6A 2GSQA 4PQ1A 1BAYA 3F4SA 2X8GA 2R4VA 3BCKA 3GTUA 3SWLA 3TB2A 3FYGA 1ST9A 1ZGNA 3SBCA 2PPTA 1URMA 2C4JA 2PVOC 3LXZA 5CO3A 3KXOA 3ZIJA 1SJ6A 4X0XA 2LKUA 1O7UA 4HU7A 2R5GA 3TJKA 1IYHA 4CW9A 3CTFA 2M80A 2YJ7A 5HQPA 3BCIA 5JWRB 1MD4A 2J9HA 1NHOA 4D73A 1MTCA 2VCXA 1V57A 3F6DA 1BQ7A 3GNJA 2HNLA 3GFKA 1TDIA 5B6NA 3UBLA 2H0GA 2PBJA 3M9JA 1KBNA 2VLUA 3ZL5A 2IMIA 4ZL9A 2PGTA 1Q98A 2KOKA 4ZXGA 4PURA 4HDEA 2YV9A 5AN1A 4RUVA 3E3EA 5F0GA 2GSRA 2GZPA 3DYRA 4GLTA 1JFUA 3TKSE 5KN0A 3M1GA 1XBSA 2FWEA 4BWSA 3FHKA 5IMAA 1XWKA 2XBIA 1GTUA 4GSNA 5IMFA 4RQRA 1FOVA 1VF2A 4BL7A 3FR6A 4MF6A 2CQ9A 2YCDA 4OD7A 1Q4JA 2DJJA 1PKZA 2PUKC 1X5DA 3DRNA 2L5OA 5LCZA 3DMLA 4KA0A 1GSSA 4IKHA 3ZITA 2I3YA 5D9WA 1ZYEA 4WETA 4HS1A 4NV2A 1ACVA 4PX1A 4ZB8A 3WGXA 2WCIA 2H0HA 1PX7A 4QL9A 1Z6NA 1TTZA 1K0NA 5CP1A 1S3DA 12GSA 1BG5A 1Z6MA 2YZHA 5CAXA 2H66A 1PQNA 4RI7A 1GWCA 1JZWA 2VM1A 2C3NA 3ZMKA 4EC0A 2FA8A 4K0NA 6GSTA 5A4UA 1EEJA 1OVNA 5B7CA 1JLVA 2M66A 2VUPA 2VL9A 4K9ZA 3ZYWA 3BOAA 3M8NA 1OE7A 1M2DA 4YQMA 1X0RA 1XXUA 4L5LA 1OE8A 4ULXA 4ECBA 4F82A 1X9SB 2E2MA 3QFAC 4G9HA 5ELAA 2C0EA 1ZCPA 1SL1B 2DJKA 3KP8A 1WMJA 1E2YA 1TRUA 2YANA 3DGQA 5CRWA 5GAND 2MYGA 1TP9A 3H4KA 2GQMA 4N30A 2LQOA 1T1VA 4TR0A 5DCGA 4JR6A 2OE3A 2L5LA 2B6MA 2AB6A 2MBTA 3US3A 2HLSA 2LRTA 2VM2A 3TCOA 2L4CA 3ERGA 2IIYA 4E8EA 2B5XA 3HY2A 4EDZA 4GXZA 3TJBA 1YKCA 3CSJA 2LUSA 1ZYQB 4DEJA 3MSZA 3PH9A 4L8EA 1MDKA 1Z7RA 4OFNA 2DJ0A 2YWIA 2BJXA 3ZVJA 4ECJA 4MJAA 3R2QA 2AYTA 3LJRA 1T4YA 1GUMA 2FCHA 3ISOA 5E4WA 5IIZA 2R37A 2B7JA 4TRXA 1A2LA 1TI3A 3KMNA 2HE3A 1K3LA 4TOPA 1GTBA 5ABRA 1PL1A 3QAVA 5HFGA 5ECQB 4MPFA 4ML1A 3EU3A 1O8XA 3KM6A 4OFTA 3CRUA 4TXOB 3F8UA 1WRYA 3KTBA 4OO4A 5AGYA 5FWGA 1MDJA 1V98A 3L9VA 4G2EA 2VLTA 2B1KA 3DD3A 1SD8A 1T3BA 1ZZYA 5ECRB 1S3CA 5J5NA 2H76A 3ZFBA 4EVMA 2DMMA 3H93A 3GL5A 4HEA2 3TKSC 4JU5A 3VI5A 5JWOB 1T00A 4KH7A 4CHSA 3GH9A 4OFMA 4F2IA 3TKQA 2HT9A 3S9FA 1KEBA 2R2JA 2N5BA 2YJHA 2WULA 2M46A 1HQOA 3QFBC 2DBCA 3KCMA 3UIWA 1JZDA 3HJOA 5IMVA 3VURA 1CQGA 3VWUA 3O6TA 2MMZA 1J0FA 2XPDA 3HHVA 1PN9A 2P0GA 4FH8A 2G2QA 4NMUA 1M9AA 3DKSA 4L0UA 17GSA 2YWNA 4G10A 1M9BA 2G0FA 1EGRA 2C1YA 4V2LA 1QMVA 1TRSA 2VD1A 2OJLA 4O5RA 2CAIA 1XWAA 3HZ4A 1FB0A 5D93A 4TXOA 2O7KA 3A5WA 2GQLA 1HD2A 3ZVJD 4MP4A 5ID2B 3EURA 2HSHA 2N5AA 4K6XA 4MZBA 8GSSA 4PNFA 2H72A 4F0CA 2DJ2A 1O8WA 2IJYA 5FT3A 1A0RP 1J08A 6GSSA 2WJUA 3RPPA 3GKNA 1PL2A 1B9YC 3PINA 2H70A 4ACSA 2X8CA 3GSTA 3KGKA 2V6KA 1SL0B 4ZL7A 1RW1A 1K0DA 3WT1A 5ECOB 2KHPA 5ECNB 2AHEA 2ZNMA 1PGTA 2K8VA 1FVJA 4K7IA 3EMPA 2NTOA 4ILFA 2NPBA 5KN1A 1GL8A 3GUSA 3FRCA 1GH2A 3HZ8A 3L4NA 4OCFA 3ZIVA 1QUWA 4OMVA 1G6YA 4LMVA 1YJ6A 2YWOA 2LV3A 4KX4A 3UOMA 1YY7A 4Q5NA 5CNWA 6GSXA 5AIXA 1AW9A 3KIJA 2QSIA 1I5GA 2LSTA 3KTLA 3TRXA 1O85A 2HYXA 4PUFC 1GUKA 5G1LA 5H5QA 2CVBA 2OACA 2KLXA 1QGVA 3DWVA 1EEMA 5JCGA 3UARA 3UEMA 3VLNA 4I2TA 2X8HA 2HRFA 4KNDA 1PMTA 2FNOA 4ML6A 2VCWA 1FO5A 3GN3A 2ZUPA 2K6VA 1FG4A 1MD3A 3CRTA 2IMFA 5J9CA 4KGIA 2I9HA 2M72A 3HA9A 2V2GA 5IO2A 2QC7A 3APOA 6GSVA 3VPQA 4HI7A 1JZOA 4NPBA 1PD21 4BVXA 3C71A 2K18A 4JR4A 5HR3A 4IW9A 1XWGA 5INYA 4X43A 1O6JA 2FGXA 3HCZA 4F03A 1JZRA 3HKRA 1MEKA 4TN8A 4AJ6A 3QD9A 2KP2A 4NXIA 4Z7XA 1HNCA 2O8VB 4HJMA 3KEBA 1ML6A 2YN1A 1THOA 3VPTA 3F0IA 1TKDB 1H4OA 1ERWA 4K1FA 1A2MA 4ZBDA 3IK7A 4GCIA 2VLVA 1WJKA 14GSA 2C8UA 2B1LA 1GSFA 1TOFA 3FK8A 5J9BA 3I9V2 3L78A 1YEPA 1ERVA 4AJ7A 4QL7A 1EGOA 2B3SA 3IOSA 2CT6A 1XZOA 1EWXA 1AAZA 4WXTA 3GV1A 1SJIA 2DC5A 1GNEA 2L6DA 2DIZA 5IO0A 2AAWA 3LQ7A 1VF3A 2H1DA 4BPYA 3HVSA 1K0AA 5DQSA 4JEDA 2VCVA 2H6XA 3FW2A 3APSA 3KD0A 3QR6A 4MDCA 4N0ZA 2KUCA 3L9SA 2LNSA 1YEXA 2RM6A 3W8SA 3MWHA 4PXOA 1X9WB 2BTOT 1U87A 4V1Ap 2MMNA 5HR1A 2LRNA 3HVXA 2JSYA 1UA5A 2B5YA 2CX3A 1UN2A 2TIRA 1QFNA 1AC1A 4AJ8A 3GKKA 1U3AA 2CVKA 3KMOA 1TJDA 1A24A 3FKFA 3C1RA 2C0FA 1SD9A 5F06A 2LJAA 1C72A 3GMFA 1F2EA 3UVTA 2H6YA 3IR4A 1V2AA 4EL1A 3HVVA 4TW5A 2DSAA 3RHCA 1R5PA 3Q6OA 1S3AA 3FZ5A 4KSMA 2FWHA 4MMMA 5B8BA 1B9XC 1WPIA 1TK0B 4FYBA 1X5CA 3IE3A 1ERUA 1G7DA 1GNWA 1FHEA 4KCAA 1XW5A 5ECSA 2IL3A 2FHEA 3NOFA 1ABAA 1WIKA 2H1AA 3ZRDA 3EC3A 4MJCA 3RPNA 2F51A 2WFCA 3CTGA 3TJFA 4F9ZA 2XC2A 1SL2B 10GSA 4HZ2A 2VCQA 4WBRD 1DUGA 4PQIA 2H75A 2HZFA 4HOJA 3F3RA 1OC3A 1AQXA 4K8MA 1GSEA 3L0HA 2ZCTA 2R6KA 3IRAA 3D6IA 5ECHB 4FYUA 5E59A 1GRXA 1RQMA 3TJJA 1I9DA 2WRTA 3ERWA 5CYYA 4HQZA 3TGZA 3FZ4A 4XS1A 1PA3A 2FLSA 2WZ9A 1XPVA 1NM3A 1BYEA 1Z5YE 1WP0A 3CSHA 5ECMB 1TK5B 3GYKA 3NIVA 5IOWA 4KE3A 13GSA 5AISA 4IQAA 5IPHA 4JBBA 1M2AA 3GSSA 3FEUA 2RUEA 3CYNA 4KDUA 4J57E 2REMA 2LRCA 3KZQA 2N5FA 1NW2A 1OKTA 5IMZA 2JSZA 2ON7A 3WGEA 2P5QA 3UBKA 3QMXA 3WD6A 4KUNA 5GSTA 3ZTLA 3GL3A 5DQYA 4ECCA 2DJ3A 4KW6A 2LJRA 3GX0A 3LGCA 1HNAA 1GSUA 1U6TA 4K2DA 1YQ1A 2H30A 1M99A 4XIHA 5IQYA 3QPMA 2H6ZA 3F4TA 2YPMA 5C00A 2OBKA 3TRQA 2H73A 3UMAA 3HXSA 3ZFLA 2AJQB 2PVQA 2VCZA 3KJYA 2IFQB 3IV4A 2I4AA 4NV5A 2AUVA 4MJBA 4ZILA 5AIVA 2H0IA 5J41A 2HRNA 3ZLPA 4XCSA 1GSQA 5IOXA 3IHQA 4ZB6A 3TKSA 3LXTA 2VO4A 3GURA 4I6XA 2Z9SA 5D9XA 1DE1A 2K8SA 3EINA 2IPAA 3F4RA 1BEDA 3GKXA 2YWMA 4ZB9A 2GDRA 3IAM2 3WGDA 3KH7A 1T7PB 4N11A 5G1KA 2TRXA 4EE0A 1OC9B 2RM5A 2MMOA 1GLPA 3IPZA 1AXDA 1EV9A 2P5RA 2FD3A 3D5JA 4IHUA 5G30A 3WT2A 3CXGA 2A4VA 4G19A 3DEXA 1VRSD 4GRFA 4FO5A 3H79A 5EL8A 2JL4A 4IN0A 1M7TA 1JLWA 4HQSA 5GAPD 1BX9A 2GTUA 1B4QA 1N2AA 4ZL8A 1QK8A 3D21A 4XRDA 3E9JB 1AIUA 3KP9A 5G5EA 5IMCA 1M2BA 1TK8B 2E2GA 3EVIA 3C1SA 2YZUA 2BMXA 2LJKA 2H71A 2H01A 4EDYA 3IA1A 1YKAA 3CBUA 2FA4A 4MJEA 4GTUA 5A4WA 1EV4A 1SKRB 2PERA 2VL3A 5F07A 3ZREA 5DDLA 4QQ7A 3IXRA 2O85A 2GSSA 4MF5A 5HFIA 4J56E 1B8XA 2IFQA 3C8EA 2GSTA 1Y25A 4GSSA 1SJZA 2RLIA 2RIIA 3RBTA 3O76A 1SYXA 5EY6A 2XHFA 3ME7A 5D9VA 1OKDA 4KB3A 5D8IA 1WE0A 2H1GA 1USBA 3EU4A 1ZOFA 3J7Yk 2WGRA 3A2VA 3F63A 4DSQA 3G7IA 1TU7A 4IVFA 4JZQA 1OC9A 2MBSA 1K0BA 1K3OA 2PU9C 4HU9A 4JRRA 3HJMA 2VL2C 5J4UA 4HJ2A 3TOTA 4IP1A 1G0TA 5H5RA 1KTEA 4DVCA 3GA4A 1F37A 4O92A 3RDWA 1XVWA 4H86A 2HXKA 3DXBA 3LEFA 3Q74A 4TR3A 4POLA 1HNBA 4LL4B 4KCEA 1XIYA 1VF1A 4TKYA 4OO5A 3ED3A 4WBJA 2L59A 3WYWA 4I2UA 5KN3A 1E6BA 2X64A 2C3QA 1XOAA 2PWJA 5G5FA 4EKZA 2RUFA 1XWCA 3OR5A 3IC4A 2DLXA 3EE2A 2VOCA 2F8AA 2H74A 4GF0A 4XTSA 2LQQA 2HSYA 2JZTA 1XW9A 1YDKA 1ZL9A 2H1BA 3PR8A 19GSA 3TOUA 4I8BA 2GS3A 2KP1A 1J9BA 1U88A 3W6GA 3TKRA 2AV4A 4L5OA 1B4PA 3I69A 5ECPB 4OWYA 4XS6A 1SENA 1TI1A 5G31A 1PKWA 22GSA 2GT6A 3CMIA 3LWAA 4YAPA 4ISDA 1ERTA 5D9TA 2C80A 1GULA 5B8AA 4MH3A 1EP7A 1V9WA 4IQ1A 3K8NA 5EVOA 3JCML 3U5RE 3VFIA 4WR5A 3UJ1A 2C0DA 3IDVA 3FR3A 2H8LA 3DVXA 1NSWA 1PRXA 2DIYA 2O89A 5IMDA 2R3XA 1GLQA 5CREA 3P2AA 3HDCA 1A23A 2DJ1A 1F3BA 4PQHA 3EMXA 4YAVA 3P7XA 5IM9A 1DBYA 2ES7A 3UAPA 2LTKA 3AY8A 2V6OA 4DSSB 2LS5A 1Y6EA 1KNGA 5LNKe 3G9BA 1SK1A 4XRAA 3F9UA 6GSYA 1Z3EA 4TR4A 2F3MA 1B48A 1DE2A 2K9FA 4POMA 5D73A 3RAZA 1FAAA 2V41A 1MDIA 2A2SA 5CRHA 2CZ2A 5F05A 3G7JA 2CX4A 3GHAA 3TUEA 1WOUA 3C7MA 1YF0A 1LBKA 5JCUA 16GSA 2HZEB 5HR2A 1XWBA 2VCTA 2MMAA 4AF2A 4EUYA 4MK3A 1ILOA 3BJ5A 5G2ZA 4LA1A 3GIXA 3F6FA 1YF1A 5JWQB 1GTAA 2FWFA 1AQVA 2PMTA 4ZIJA 3HD5A 1FW1A 1A8YA 2VAFA 5LD0A 1SK0A 3KH9A 3M9KA 5HFKA 1V58A 4AGSA 1X9MB 1GSDA 3HJPA 3APQA 4PNGA 3VI7A 3ME8A 3QOUA 3IAS2 2GZZA 1SYRA 1H75A 2JZRA 4KAEA 2B7KA 4TXVA 3MAKA 2A2RA 2HI7A 3IK9A 5DBQA 1R7HA 3FZAA 1OAZA 4NWYA 1IYIA 2JACA 1SU9A 4GQCA 1XVQA 4DSSA 5ENUA 3P90A 3ZZXA 2E0QA 1O73A 1K3YA 3GKMA 3LYKA 5DVBA 1A8LA 5J3RA 4MCUA 2X99A 4V1Ag 4WF5A 3N5OA 1V40A 4IS0A 3L9UA 2JZSA 4IELA 5ECKB 1FVKA 4XHMA 2L4QA 2C3TA 4PGTA 4K7OA 1SKSB 4GWRA 3LORA 1K0CA 3I43A 2I81A 5C04A 2OKAA 2HZEA 4V2NA 4MF7A 5A5KA 3GRXA 5B6MA 3CSIA 5KEJA 4TVEA 4LLRA 2E7PA 4I5QA 5CRDA 1OC8A 1TRWA 5KN2A 2YOIA 5CRGA 1XW6A 2GGTA 3M0FA 1O81A 1GTIA 1WWJA 1A0FA 3G7YA 2ALBA 1R4WA 5D96A 1SKWB 3NZNA 4ID0A 1QXHA 3C73A 4PUAA 3TKPA 2EIQA 4HUAA 6GSUA 2CZ3A 2EIOA 2L57A 1K0MA 2LNTA 2GLRA 2NDOA 4WR4A 4YQUA 2OE1A 5EPFA 3UVHA 5DALB 3LYPA 4K0GA 4HZ4A 2CA8A 2J23A 2IWTA 5F8BA 4Q5RA 4EXJA 1NHYA 2FWGA 3ZMLA 1LU4A 1F3AA 4KDYA 1AQWA 3J7Yb 4MLYA 4TR1B 4ZBAA 3LSZA 1TRVA 2MZCA 3GX8A 1TW9A 1CQHA 2PN8A 4Q5FA 1R26A 2L6CA 1W4VA 20GSA 1THXA 2OE0A 1ZMAA 2WB9A 1EOGA 1A2JA 4RQXA 1UVZA 4IGJA 3BBYA 1N8JA 3LG6A 1HYUA 3N9JA 5JCWA 1VF4A 4JE1A 3M3MA 2GZYA 2ON5A 4YH2A 4V2MA 5DAKB 1M0UA 5GSSA 18GSA 2C0GA 3TJGA 5ECIB 2V32A 1RK4A 4GSTA 3V1WA 1ON4A 3QCPA 3HYPA 1BJXA 1Z9HA 3VWVA 2DMLA 1EZKA 2GQKA 4MPGA 4L0WA 2JADA 2CAQA 4POBA 2WDUA 4IBPA 5ELGA 4P3YB 1EP8A 1OYJA 4BVYA 1XCCA 1EOHA 2YNXA 2HFDA 3I6AA 4EF0A 4XS4B 2CV4A 1G6WA 4N0VA 5DALA 2QGVA 4NHZA 4IJ3A 3LFLA 3UL3A 4FIWA 3O3TA 4ZBBA 4N10A 2IMDA 1VGLA 4MZWA 5COHA 4DSRA 3D0ZA 3GH6A 3TDGA 3Q18A 2EIRA 4TR1A 2F9SA 5HR0A 1T4ZA 5IPGA 5DJLA 4MABA 1JHBA 4NAXA 1XOBA 1YZXA 2H19A 4J2FA 4BWQA 2CVDA 2IMEA 3IBHA 1F9MA 4FYCA 3BD2A 2OADA 3PGTA 3VWXA 2XPEA 3QDNA 4GQFA 3H8QA 1FB6A 4K7NA 3ERFA 1GUHA 2VD0A 2IN3A 3FR9A 2P31A 4WEYA 5FHIA 5ECLB 5DAKA 3RHBA 4OCEA 3D4MA 3DIEA 3H1NA 4ECIA 4RI6A 2B5EA 4NHWA 2I1UA 2LEGA 2GVPA 4MH2A 11GSA 3QAWA 1G7EA 2F8FA 2IMKA 3A2XA 5DCHA 2WS2A 1TU8A 4LL1B 3Q19A 2QKEA 3EYTA 1T8EB 4X1UA 1Z7PA 3VWWA 5L71A 3U6VA 4E8HA 2V1MA 7GSSA 3GTUB 2GT5A 6GSWA 1R5AA 5H5SA 4MZCA 4MA9A 4XS4A 4WF4A 4IP6A 1UC7A 3D22A 1F6MC 4O32A 1PX6A 1SK2A 2O87A 2EC4A 2YV7A 1DSBA 3FZ9A 4CDOA 1AUCA 3EWLA 2VIMA 1K0OA 1LJRA 4WKWA 3A2WA 2XBQA 3VK9A 2VL2A 2OA7A 3DVWA 3E0UA 3MDKA 1TXXA 1GSYA 4YQVA 4D73B 3W8JA 4IJIA 4Q5QA 2NVLA 2D2ZA 1GP1A 4O7HA 3QAGA 1XFLA 1G7OA 1X5EA 4EO3A 2FUG2 3FY7A 4F0BA 4POKA 4BA7A 5ID2A 1U3IA 3P8WA 2TRCP 2YP6A 2NBSA 5GZZB 1W89A 4KSOA 4LMWA 3MNGA 3TRPA 1QQ2A 9GSSA 4KDXA 5DJMA 3D4TA 1PSQA 5A4VA
chains in the Genus database with same CATH superfamily
2OBIA 2JU5A 3A3TA 4I97A 3F3QA 2FY6A 2GSQA 4PQ1A 1BAYA 3F4SA 4G0KA 2X8GA 2R4VA 3BCKA 3GTUA 3SWLA 3TB2A 3FYGA 1ST9A 1ZGNA 3SBCA 2PPTA 1URMA 2C4JA 2PVOC 3LXZA 5CO3A 3KXOA 3ZIJA 1SJ6A 4X0XA 2LKUA 1O7UA 4HU7A 2R5GA 3TJKA 1IYHA 4CW9A 3CTFA 2M80A 2YJ7A 5HQPA 3BCIA 5JWRB 1MD4A 2J9HA 1NHOA 4D73A 1MTCA 2VCXA 1V57A 3F6DA 1BQ7A 3GNJA 2HNLA 3GFKA 1TDIA 5B6NA 3UBLA 2H0GA 2PBJA 3M9JA 3MYDA 1KBNA 2VLUA 3ZL5A 2IMIA 4G0IA 4ZL9A 2PGTA 1Q98A 2KOKA 4ZXGA 4PURA 4HDEA 2YV9A 5AN1A 4RUVA 3E3EA 5F0GA 2GSRA 2GZPA 3DYRA 4GLTA 1JFUA 3TKSE 5KN0A 3M1GA 1XBSA 2FWEA 4BWSA 3FHKA 5IMAA 1XWKA 2XBIA 1GTUA 4GSNA 5IMFA 4RQRA 1FOVA 1VF2A 4BL7A 3FR6A 4MF6A 2CQ9A 2YCDA 4OD7A 1Q4JA 2DJJA 1PKZA 2PUKC 1X5DA 3DRNA 2L5OA 5LCZA 3DMLA 4KA0A 1GSSA 4IKHA 3ZITA 2I3YA 4K5RA 5D9WA 1ZYEA 4WETA 4HS1A 4NV2A 1ACVA 4PX1A 4ZB8A 3WGXA 2WCIA 2H0HA 1PX7A 4QL9A 1Z6NA 1TTZA 1K0NA 5CP1A 1S3DA 12GSA 1BG5A 1Z6MA 2YZHA 5CAXA 2H66A 1PQNA 4RI7A 1GWCA 1JZWA 2VM1A 2C3NA 3ZMKA 4EC0A 2FA8A 4K0NA 6GSTA 5A4UA 1EEJA 1OVNA 5B7CA 1JLVA 2M66A 2VUPA 2VL9A 4K9ZA 3ZYWA 3BOAA 3M8NA 1OE7A 1M2DA 4YQMA 1X0RA 1XXUA 4L5LA 1OE8A 4ULXA 4ECBA 4F82A 1X9SB 2E2MA 3QFAC 4G9HA 5ELAA 2C0EA 1ZCPA 1SL1B 2DJKA 3KP8A 1WMJA 1E2YA 1TRUA 2YANA 3DGQA 5CRWA 5GAND 2MYGA 1TP9A 3H4KA 2GQMA 4N30A 2LQOA 1T1VA 4TR0A 5DCGA 4JR6A 2OE3A 2L5LA 2B6MA 2AB6A 2MBTA 3US3A 2HLSA 2LRTA 2VM2A 3TCOA 4Z2TA 2L4CA 3ERGA 2IIYA 4E8EA 2B5XA 3HY2A 4EDZA 4GXZA 3TJBA 1YKCA 3CSJA 2LUSA 3EPTA 1ZYQB 4DEJA 3MSZA 3PH9A 4L8EA 1MDKA 1Z7RA 4OFNA 2DJ0A 2YWIA 2BJXA 3ZVJA 4ECJA 4MJAA 3R2QA 2AYTA 3LJRA 1T4YA 1GUMA 2FCHA 3ISOA 5E4WA 5IIZA 2R37A 2B7JA 4TRXA 1A2LA 1TI3A 3KMNA 2HE3A 1K3LA 4TOPA 1GTBA 5ABRA 1PL1A 3QAVA 5HFGA 5ECQB 4MPFA 4ML1A 3EU3A 1O8XA 3KM6A 4OFTA 3CRUA 4TXOB 3F8UA 1WRYA 3KTBA 4OO4A 5AGYA 5FWGA 1MDJA 1V98A 3L9VA 4G2EA 2VLTA 2HRKA 2B1KA 3DD3A 3PPUA 1SD8A 1T3BA 1ZZYA 5ECRB 1S3CA 5J5NA 2H76A 3ZFBA 4EVMA 2DMMA 3H93A 3GL5A 4HEA2 3TKSC 4JU5A 3VI5A 5JWOB 1T00A 4KH7A 4CHSA 3GH9A 1FOHA 4OFMA 4F2IA 3TKQA 2HT9A 3S9FA 1KEBA 2R2JA 2N5BA 2YJHA 2WULA 2M46A 1HQOA 3QFBC 2DBCA 3KCMA 3UIWA 1JZDA 3HJOA 5IMVA 3VURA 1CQGA 3VWUA 3O6TA 2MMZA 1J0FA 2XPDA 3HHVA 1PN9A 2P0GA 4FH8A 2G2QA 4NMUA 1M9AA 3DKSA 4L0UA 17GSA 4ICYA 2YWNA 4G10A 1M9BA 2G0FA 1EGRA 2C1YA 4V2LA 3HVNA 1QMVA 1TRSA 3FMWA 2VD1A 2QA1A 2OJLA 4O5RA 2CAIA 4PTSA 1XWAA 3HZ4A 1FB0A 5D93A 4TXOA 2O7KA 3A5WA 4Z2RA 2GQLA 1HD2A 4CY8A 3ZVJD 4MP4A 5ID2B 3EURA 2HSHA 2N5AA 4K6XA 4MZBA 8GSSA 4PNFA 2H72A 4F0CA 2DJ2A 1O8WA 2IJYA 5FT3A 1A0RP 1J08A 6GSSA 2WJUA 3RPPA 3GKNA 4KF9A 1PL2A 1B9YC 3PINA 2H70A 4ACSA 2X8CA 3GSTA 3KGKA 2V6KA 1SL0B 4ZL7A 1RW1A 4BVXB 1K0DA 3WT1A 5ECOB 2KHPA 5ECNB 2AHEA 2ZNMA 1PGTA 2K8VA 1FVJA 2HRAA 3EMPA 4K7IA 2NTOA 4ILFA 2NPBA 5KN1A 1GL8A 3GUSA 3FRCA 1GH2A 3HZ8A 3L4NA 4OCFA 3ZIVA 1QUWA 4OMVA 1G6YA 4LMVA 1YJ6A 2YWOA 3LW9A 2LV3A 4KX4A 3UOMA 1YY7A 4Q5NA 5CNWA 6GSXA 5AIXA 1AW9A 3KIJA 2QSIA 1I5GA 2LSTA 3KTLA 3TRXA 1O85A 2HYXA 4PUFC 1GUKA 5G1LA 5H5QA 2CVBA 2OACA 2KLXA 1QGVA 1ZYNA 3DWVA 1EEMA 5JCGA 3UARA 3UEMA 3VLNA 4I2TA 2X8HA 2HRFA 4KNDA 1PMTA 2FNOA 2R0GA 4ML6A 2VCWA 1FO5A 3GN3A 2ZUPA 2K6VA 1FG4A 1MD3A 3CRTA 2IMFA 5J9CA 4KGIA 2I9HA 2A4HA 2M72A 3HA9A 2V2GA 5IO2A 2QC7A 3APOA 6GSVA 3VPQA 4HI7A 1JZOA 4NPBA 1PD21 4BVXA 3C71A 2K18A 2DKHA 4JR4A 5HR3A 4IW9A 1XWGA 2X49A 5INYA 4X43A 1O6JA 2FGXA 3HCZA 4F03A 1JZRA 3HKRA 1MEKA 4TN8A 4AJ6A 3QD9A 2KP2A 4NXIA 4Z7XA 1HNCA 2O8VB 4HJMA 3KEBA 1ML6A 2YN1A 1THOA 3VPTA 3F0IA 1TKDB 1H4OA 1ERWA 4K1FA 1A2MA 4ZBDA 3IK7A 4GCIA 2VLVA 1WJKA 14GSA 2C8UA 2B1LA 1GSFA 1TOFA 3FK8A 5J9BA 3I9V2 3L78A 1YEPA 1ERVA 4AJ7A 4QL7A 1EGOA 2B3SA 3IOSA 2CT6A 1XZOA 1EWXA 1AAZA 4WXTA 3GV1A 1SJIA 2DC5A 1GNEA 2L6DA 2DIZA 5IO0A 2AAWA 3LQ7A 1VF3A 2H1DA 4BPYA 3HVSA 1K0AA 5DQSA 4JEDA 2VCVA 2H6XA 3FW2A 3APSA 3KD0A 3QR6A 4MDCA 4N0ZA 2KUCA 3L9SA 2LNSA 1YEXA 2RM6A 3W8SA 3MWHA 4PXOA 1X9WB 2BTOT 1U87A 4V1Ap 2MMNA 5HR1A 2LRNA 3HVXA 2JSYA 1UA5A 2B5YA 4CY6A 2CX3A 1UN2A 2TIRA 1QFNA 1AC1A 4AJ8A 3GKKA 1U3AA 4YKFA 2CVKA 3KMOA 1TJDA 1A24A 3FKFA 3C1RA 2C0FA 1SD9A 5F06A 2LJAA 1C72A 4USSA 4EIQA 3GMFA 1F2EA 3UVTA 2H6YA 3IR4A 1V2AA 4EL1A 3HVVA 4TW5A 2DSAA 3RHCA 1R5PA 3Q6OA 1S3AA 3FZ5A 4KSMA 2FWHA 4MMMA 5B8BA 1B9XC 1WPIA 1TK0B 4FYBA 1X5CA 3IE3A 1ERUA 1G7DA 1GNWA 1FHEA 4KCAA 1XW5A 5ECSA 2IL3A 2FHEA 3NOFA 1ABAA 1WIKA 2H1AA 3ZRDA 3EC3A 4MJCA 3RPNA 2F51A 2WFCA 3CTGA 3TJFA 4F9ZA 2XC2A 1SL2B 10GSA 4HZ2A 2VCQA 4WBRD 1DUGA 4PQIA 2H75A 4K2XA 2HZFA 4HOJA 3F3RA 1OC3A 1AQXA 4K8MA 1GSEA 4X4JA 3L0HA 2ZCTA 2R6KA 3IRAA 3D6IA 5ECHB 4FYUA 5E59A 1GRXA 1RQMA 3TJJA 1I9DA 2WRTA 3ERWA 5CYYA 4HQZA 3TGZA 3FZ4A 4XS1A 1PA3A 2FLSA 2WZ9A 1XPVA 1NM3A 1BYEA 1Z5YE 1WP0A 3CSHA 5ECMB 1XG8A 1TK5B 3GYKA 3NIVA 5IOWA 4KE3A 13GSA 5AISA 4IQAA 5IPHA 3IC8A 4JBBA 1M2AA 3GSSA 3FEUA 2RUEA 3CYNA 4KDUA 4J57E 2REMA 2LRCA 3KZQA 2N5FA 1NW2A 1OKTA 5IMZA 2JSZA 2ON7A 3WGEA 2P5QA 3UBKA 3QMXA 3WD6A 4YKGA 4KUNA 5GSTA 3ZTLA 3GL3A 5DQYA 4ECCA 4BIKA 2DJ3A 4KW6A 2LJRA 3GX0A 3LGCA 1HNAA 1GSUA 1U6TA 4K2DA 1YQ1A 2H30A 1M99A 4XIHA 5IQYA 3QPMA 2H6ZA 3F4TA 2YPMA 5C00A 2OBKA 3TRQA 2H73A 3UMAA 3HXSA 3ZFLA 2AJQB 2PVQA 2VCZA 3KJYA 2IFQB 3IV4A 2I4AA 4NV5A 2AUVA 4MJBA 4ZILA 5AIVA 2H0IA 5J41A 2HRNA 3ZLPA 4XCSA 1GSQA 5IOXA 3IHQA 4ZB6A 3TKSA 3LXTA 2VO4A 3GURA 4I6XA 2Z9SA 5D9XA 1DE1A 2K8SA 3EINA 2IPAA 3F4RA 2X4AA 1BEDA 1PFOA 3GKXA 2YWMA 4ZB9A 2GDRA 3IAM2 3WGDA 3KH7A 1T7PB 4N11A 5G1KA 2TRXA 4EE0A 1OC9B 2RM5A 2MMOA 1GLPA 3IPZA 1AXDA 1EV9A 2P5RA 2FD3A 3D5JA 4IHUA 5G30A 3WT2A 3CXGA 2A4VA 4G19A 5KOXA 3DEXA 1VRSD 4GRFA 4FO5A 3H79A 5EL8A 2JL4A 4IN0A 1M7TA 1JLWA 4HQSA 5GAPD 1BX9A 2GTUA 1B4QA 1N2AA 4ZL8A 1QK8A 3CQFA 3D21A 4XRDA 3E9JB 1AIUA 3KP9A 5G5EA 5IMCA 1M2BA 1TK8B 2E2GA 3EVIA 3C1SA 2YZUA 2BMXA 2LJKA 2H71A 2H01A 4EDYA 3IA1A 1YKAA 3CBUA 2FA4A 4MJEA 4GTUA 5A4WA 1EV4A 1SKRB 2PERA 2VL3A 5F07A 3ZREA 5DDLA 4QQ7A 3IXRA 2O85A 2GSSA 4MF5A 5HFIA 4J56E 1B8XA 2IFQA 1M3IA 3C8EA 2GSTA 1Y25A 4GSSA 1SJZA 2RLIA 2RIIA 3RBTA 3O76A 1SYXA 5EY6A 2XHFA 3ME7A 4Z2UA 5D9VA 1OKDA 4KB3A 5D8IA 1WE0A 2H1GA 1USBA 3EU4A 1ZOFA 3J7Yk 2WGRA 3A2VA 3F63A 4DSQA 3G7IA 1TU7A 4IVFA 4JZQA 1OC9A 2MBSA 1K0BA 1K3OA 2PU9C 4HU9A 4JRRA 3HJMA 2VL2C 5J4UA 4HJ2A 3TOTA 4IP1A 1G0TA 5H5RA 1KTEA 4DVCA 3GA4A 1F37A 4O92A 3RDWA 1XVWA 4H86A 2HXKA 3DXBA 3LEFA 3Q74A 4TR3A 4POLA 1HNBA 4LL4B 4KCEA 1XIYA 1VF1A 4TKYA 4OO5A 4A5PA 3ED3A 4WBJA 2L59A 3WYWA 4I2UA 5KN3A 1E6BA 2X64A 2C3QA 1XOAA 2PWJA 5G5FA 4EKZA 2RUFA 1XWCA 3OR5A 3IC4A 2DLXA 3EE2A 2VOCA 2F8AA 2H74A 4GF0A 4XTSA 2LQQA 2HSYA 2JZTA 1XW9A 1YDKA 1ZL9A 2H1BA 3PR8A 19GSA 3TOUA 4I8BA 2GS3A 2KP1A 2HSMA 1J9BA 1U88A 3W6GA 3TKRA 2AV4A 2UZ8A 4L5OA 1B4PA 3I69A 5ECPB 4OWYA 4XS6A 1SENA 1TI1A 5G31A 1PKWA 22GSA 2GT6A 3CMIA 3LWAA 4YAPA 4ISDA 1ERTA 5D9TA 2C80A 1GULA 5B8AA 4MH3A 1EP7A 1V9WA 4IQ1A 3K8NA 5EVOA 3JCML 3U5RE 3VFIA 4WR5A 3UJ1A 2C0DA 3IDVA 3FR3A 2H8LA 2DKIA 3DVXA 1NSWA 1PRXA 2DIYA 2O89A 5IMDA 2R3XA 1GLQA 5CREA 3P2AA 3HDCA 1A23A 2DJ1A 1F3BA 4PQHA 3EMXA 4YAVA 3P7XA 5IM9A 1DBYA 2ES7A 3UAPA 2LTKA 3AY8A 2V6OA 4DSSB 2LS5A 1Y6EA 1KNGA 5LNKe 3G9BA 1SK1A 4XRAA 3F9UA 6GSYA 1Z3EA 4TR4A 2F3MA 1B48A 1DE2A 2K9FA 4POMA 5D73A 3RAZA 1FAAA 2V41A 1MDIA 2A2SA 5CRHA 2CZ2A 5F05A 3G7JA 2CX4A 3GHAA 3TUEA 1WOUA 3C7MA 1YF0A 1LBKA 5JCUA 16GSA 2HZEB 5HR2A 1XWBA 2VCTA 2MMAA 4AF2A 4EUYA 4MK3A 1ILOA 3BJ5A 5G2ZA 2A2PA 4LA1A 1S3RA 3GIXA 3F6FA 1YF1A 5JWQB 1GTAA 2FWFA 1AQVA 2PMTA 4ZIJA 3HD5A 1FW1A 1A8YA 2VAFA 5LD0A 1SK0A 3KH9A 3M9KA 5HFKA 1V58A 4AGSA 1X9MB 1GSDA 3HJPA 3APQA 4PNGA 3VI7A 3ME8A 3QOUA 3IAS2 2GZZA 1SYRA 1H75A 2JZRA 4KAEA 2B7KA 4TXVA 3MAKA 2A2RA 2HI7A 3IK9A 5DBQA 1R7HA 4MNNA 3FZAA 1OAZA 4NWYA 1IYIA 2JACA 1SU9A 4GQCA 1XVQA 4DSSA 5ENUA 3P90A 3ZZXA 3MIXA 2E0QA 1O73A 4O5QA 1K3YA 3GKMA 3LYKA 5DVBA 1A8LA 5J3RA 4MCUA 2X99A 4V1Ag 4WF5A 3N5OA 1V40A 4IS0A 3L9UA 2JZSA 4IELA 5ECKB 1FVKA 4XHMA 2L4QA 2C3TA 4PGTA 4K7OA 1SKSB 4GWRA 3LORA 1K0CA 3I43A 2I81A 5C04A 2OKAA 2HZEA 2QA2A 4V2NA 4MF7A 4K5SA 5A5KA 3GRXA 5B6MA 3CSIA 5KEJA 4TVEA 4LLRA 2E7PA 4I5QA 5CRDA 1OC8A 1TRWA 5KN2A 4HSCX 2YOIA 5CRGA 1XW6A 2GGTA 3M0FA 1O81A 1GTIA 1WWJA 1A0FA 3G7YA 2ALBA 1R4WA 5D96A 1SKWB 3NZNA 4ID0A 1QXHA 3C73A 4PUAA 5BMUA 3TKPA 2EIQA 4HUAA 6GSUA 2CZ3A 2EIOA 2L57A 4BVYB 1K0MA 2LNTA 2GLRA 2NDOA 4WR4A 4YQUA 2OE1A 5EPFA 3UVHA 5DALB 3LYPA 4K0GA 4HZ4A 2CA8A 1ZYPA 2J23A 2IWTA 5F8BA 4Q5RA 4EXJA 1NHYA 2FWGA 3ZMLA 1LU4A 1F3AA 4KDYA 1AQWA 3J7Yb 4MLYA 4TR1B 4ZBAA 3LSZA 1TRVA 2MZCA 3GX8A 1TW9A 1CQHA 2PN8A 4Q5FA 1R26A 2L6CA 1W4VA 20GSA 1THXA 2OE0A 1ZMAA 2WB9A 1EOGA 1A2JA 4RQXA 1UVZA 4IGJA 3BBYA 1N8JA 3LG6A 1HYUA 3N9JA 5JCWA 4G0LA 1VF4A 4JE1A 3M3MA 2GZYA 2ON5A 4YH2A 4V2MA 1PN0A 5DAKB 1M0UA 4O5UA 5GSSA 18GSA 2C0GA 3TJGA 5ECIB 2V32A 1RK4A 4GSTA 3V1WA 1ON4A 3QCPA 3HYPA 1BJXA 1Z9HA 3VWVA 2DMLA 1EZKA 2GQKA 4MPGA 4L0WA 2JADA 2CAQA 2R0PA 4POBA 2WDUA 4IBPA 5ELGA 4P3YB 1EP8A 1OYJA 4BVYA 1XCCA 1EOHA 2YNXA 2HFDA 3I6AA 4EF0A 4XS4B 2CV4A 1G6WA 4N0VA 5DALA 2QGVA 4NHZA 4IJ3A 3LFLA 3UL3A 4FIWA 3O3TA 4ZBBA 4N10A 2IMDA 1VGLA 4MZWA 5COHA 4DSRA 3D0ZA 3GH6A 3TDGA 3Q18A 2EIRA 4TR1A 5BRTA 2F9SA 5HR0A 1T4ZA 5IPGA 5DJLA 4MABA 5KOWA 1JHBA 4NAXA 1XOBA 1YZXA 2H19A 4J2FA 4BWQA 2CVDA 2IMEA 3IBHA 1F9MA 4FYCA 3BD2A 2OADA 3PGTA 3VWXA 2XPEA 3QDNA 4GQFA 3H8QA 1FB6A 4K7NA 3ERFA 1GUHA 3A5IA 2VD0A 2IN3A 3FR9A 2P31A 4WEYA 5FHIA 5ECLB 5DAKA 3RHBA 4OCEA 3D4MA 2R0CA 3DIEA 3H1NA 4ECIA 4RI6A 2B5EA 4NHWA 2I1UA 2LEGA 2GVPA 4MH2A 11GSA 3QAWA 1G7EA 2F8FA 2IMKA 3A2XA 5DCHA 2WS2A 1TU8A 4LL1B 3Q19A 2QKEA 3EYTA 1T8EB 4X1UA 1Z7PA 3VWWA 5L71A 3U6VA 4E8HA 4EIPA 4FQUA 2V1MA 7GSSA 3GTUB 2GT5A 3IHGA 6GSWA 1R5AA 5H5SA 4MZCA 4MA9A 4XS4A 4WF4A 4IP6A 1UC7A 3R3EA 3D22A 1F6MC 4O32A 1PX6A 1SK2A 2O87A 2EC4A 2YV7A 1DSBA 3FZ9A 4CDOA 1AUCA 3EWLA 2VIMA 1K0OA 1LJRA 4WKWA 3A2WA 2XBQA 3VK9A 2VL2A 2OA7A 3DVWA 3E0UA 3MDKA 1TXXA 1GSYA 4YQVA 4D73B 3W8JA 4IJIA 4Q5QA 2NVLA 2D2ZA 1GP1A 4O7HA 3QAGA 1XFLA 1M3JA 1G7OA 1X5EA 4EO3A 2FUG2 3FY7A 4F0BA 4POKA 4BA7A 5ID2A 1U3IA 3P8WA 2TRCP 2YP6A 2NBSA 5GZZB 1W89A 4KSOA 4LMWA 3MNGA 3TRPA 1QQ2A 9GSSA 4KDXA 4BL7B 5DJMA 3D4TA 1PSQA 5A4VA
chains in the Genus database with same CATH topology
2OBIA 2JU5A 3A3TA 4I97A 3F3QA 2FY6A 2GSQA 4PQ1A 1BAYA 3F4SA 4G0KA 2X8GA 2R4VA 3BCKA 3GTUA 3SWLA 3TB2A 3FYGA 1ST9A 1ZGNA 3SBCA 2PPTA 1URMA 2C4JA 2PVOC 3LXZA 5CO3A 3KXOA 3ZIJA 1SJ6A 4X0XA 2LKUA 1O7UA 4HU7A 2R5GA 3TJKA 1IYHA 4CW9A 3CTFA 2M80A 2YJ7A 5HQPA 3BCIA 5JWRB 1MD4A 2J9HA 1NHOA 4D73A 1MTCA 2VCXA 1V57A 3F6DA 1BQ7A 3GNJA 2HNLA 3GFKA 1TDIA 5B6NA 3UBLA 2H0GA 2PBJA 3M9JA 3MYDA 1KBNA 2VLUA 3ZL5A 2IMIA 4G0IA 4ZL9A 2PGTA 1Q98A 2KOKA 4ZXGA 4PURA 4HDEA 2YV9A 5AN1A 4RUVA 3E3EA 5F0GA 2GSRA 2GZPA 3DYRA 4GLTA 1JFUA 3TKSE 5KN0A 3M1GA 1XBSA 2FWEA 4BWSA 3FHKA 5IMAA 1XWKA 2XBIA 1GTUA 4GSNA 5IMFA 4RQRA 1FOVA 1VF2A 4BL7A 3FR6A 4MF6A 2CQ9A 2YCDA 4OD7A 1Q4JA 2DJJA 1PKZA 2PUKC 1X5DA 3DRNA 2L5OA 5LCZA 3DMLA 4KA0A 1GSSA 4IKHA 3ZITA 2I3YA 4K5RA 5D9WA 1ZYEA 4WETA 4HS1A 4NV2A 1ACVA 4PX1A 4ZB8A 3WGXA 2WCIA 2H0HA 1PX7A 4QL9A 1Z6NA 1TTZA 1K0NA 5CP1A 1S3DA 12GSA 1BG5A 1Z6MA 2YZHA 5CAXA 2H66A 1PQNA 4RI7A 1GWCA 1JZWA 2VM1A 2C3NA 3ZMKA 4EC0A 2FA8A 4K0NA 6GSTA 5A4UA 1EEJA 1OVNA 5B7CA 1JLVA 2M66A 2VUPA 2VL9A 4K9ZA 3ZYWA 3BOAA 3M8NA 1OE7A 1M2DA 4YQMA 1X0RA 1XXUA 4L5LA 1OE8A 4ULXA 4ECBA 4F82A 1X9SB 2E2MA 3QFAC 4G9HA 5ELAA 2C0EA 1ZCPA 1SL1B 2DJKA 3KP8A 1WMJA 1E2YA 1TRUA 2YANA 3DGQA 5CRWA 5GAND 2MYGA 1TP9A 3H4KA 2GQMA 4N30A 2LQOA 1T1VA 4TR0A 5DCGA 4JR6A 2OE3A 2L5LA 2B6MA 2AB6A 2MBTA 3US3A 2HLSA 2LRTA 2VM2A 3TCOA 4Z2TA 2L4CA 3ERGA 2IIYA 4E8EA 2B5XA 3HY2A 4EDZA 4GXZA 3TJBA 1YKCA 3CSJA 2LUSA 3EPTA 1ZYQB 4DEJA 3MSZA 3PH9A 4L8EA 1MDKA 1Z7RA 4OFNA 2DJ0A 2YWIA 2BJXA 3ZVJA 4ECJA 4MJAA 3R2QA 2AYTA 3LJRA 1T4YA 1GUMA 2FCHA 3ISOA 5E4WA 5IIZA 2R37A 2B7JA 4TRXA 1A2LA 1TI3A 3KMNA 2HE3A 1K3LA 4TOPA 1GTBA 5ABRA 1PL1A 3QAVA 5HFGA 5ECQB 4MPFA 4ML1A 3EU3A 1O8XA 3KM6A 4OFTA 3CRUA 4TXOB 3F8UA 1WRYA 3KTBA 4OO4A 5AGYA 5FWGA 1MDJA 1V98A 3L9VA 4G2EA 2VLTA 2HRKA 2B1KA 3DD3A 3PPUA 1SD8A 1T3BA 1ZZYA 5ECRB 1S3CA 5J5NA 2H76A 3ZFBA 4EVMA 2DMMA 3H93A 3GL5A 4HEA2 3TKSC 4JU5A 3VI5A 5JWOB 1T00A 4KH7A 4CHSA 3GH9A 1FOHA 4OFMA 4F2IA 3TKQA 2HT9A 3S9FA 1KEBA 2R2JA 2N5BA 2YJHA 2WULA 2M46A 1HQOA 3QFBC 2DBCA 3KCMA 3UIWA 1JZDA 3HJOA 5IMVA 3VURA 1CQGA 3VWUA 3O6TA 2MMZA 1J0FA 2XPDA 3HHVA 1PN9A 2P0GA 4FH8A 2G2QA 4NMUA 1M9AA 3DKSA 4L0UA 17GSA 4ICYA 2YWNA 4G10A 1M9BA 2G0FA 1EGRA 2C1YA 4V2LA 1QMVA 1TRSA 3FMWA 2VD1A 2QA1A 2OJLA 4O5RA 2CAIA 4PTSA 1XWAA 3HZ4A 1FB0A 5D93A 4TXOA 2O7KA 3A5WA 4Z2RA 2GQLA 1HD2A 4CY8A 3ZVJD 4MP4A 5ID2B 3EURA 2HSHA 2N5AA 4K6XA 4MZBA 8GSSA 4PNFA 2H72A 4F0CA 2DJ2A 1O8WA 2IJYA 5FT3A 1A0RP 1J08A 6GSSA 2WJUA 3RPPA 3GKNA 4KF9A 1PL2A 1B9YC 3PINA 2H70A 4ACSA 2X8CA 3GSTA 3KGKA 2V6KA 1SL0B 4ZL7A 1RW1A 4BVXB 1K0DA 3WT1A 5ECOB 2KHPA 5ECNB 2AHEA 2ZNMA 1PGTA 2K8VA 1FVJA 2HRAA 3EMPA 4K7IA 2NTOA 4ILFA 2NPBA 5KN1A 1GL8A 3GUSA 3FRCA 1GH2A 3HZ8A 3L4NA 4OCFA 3ZIVA 1QUWA 4OMVA 1G6YA 4LMVA 1YJ6A 2YWOA 3LW9A 2LV3A 4KX4A 3UOMA 1YY7A 4Q5NA 5CNWA 6GSXA 5AIXA 1AW9A 3KIJA 2QSIA 1I5GA 2LSTA 3KTLA 3TRXA 1O85A 2HYXA 4PUFC 1GUKA 5G1LA 5H5QA 2CVBA 2OACA 2KLXA 1QGVA 1ZYNA 3DWVA 1EEMA 5JCGA 3UARA 3UEMA 3VLNA 4I2TA 2X8HA 2HRFA 4KNDA 1PMTA 2FNOA 2R0GA 4ML6A 2VCWA 1FO5A 3GN3A 2ZUPA 2K6VA 1FG4A 1MD3A 3CRTA 2IMFA 5J9CA 4KGIA 2I9HA 2A4HA 2M72A 3HA9A 2V2GA 5IO2A 2QC7A 3APOA 6GSVA 3VPQA 4HI7A 1JZOA 4NPBA 1PD21 4BVXA 3C71A 2K18A 2DKHA 4JR4A 5HR3A 4IW9A 1XWGA 2X49A 5INYA 4X43A 1O6JA 2FGXA 3HCZA 4F03A 1JZRA 3HKRA 1MEKA 4TN8A 4AJ6A 3QD9A 2KP2A 4NXIA 4Z7XA 1HNCA 2O8VB 4HJMA 3KEBA 1ML6A 2YN1A 1THOA 3VPTA 3F0IA 1TKDB 1H4OA 1ERWA 4K1FA 1A2MA 4ZBDA 3IK7A 4GCIA 2VLVA 1WJKA 14GSA 2C8UA 2B1LA 1GSFA 1TOFA 3FK8A 5J9BA 3I9V2 3L78A 1YEPA 1ERVA 4AJ7A 4QL7A 1EGOA 2B3SA 3IOSA 2CT6A 1XZOA 1EWXA 1AAZA 4WXTA 3GV1A 1SJIA 2DC5A 1GNEA 2L6DA 2DIZA 5IO0A 2AAWA 3LQ7A 1VF3A 2H1DA 4BPYA 3HVSA 1K0AA 5DQSA 4JEDA 2VCVA 2H6XA 3FW2A 3APSA 3KD0A 3QR6A 4MDCA 4N0ZA 2KUCA 3L9SA 2LNSA 1YEXA 2RM6A 3W8SA 3MWHA 4PXOA 1X9WB 2BTOT 1U87A 4V1Ap 2MMNA 5HR1A 2LRNA 3HVXA 2JSYA 1UA5A 2B5YA 4CY6A 2CX3A 1UN2A 2TIRA 1QFNA 1AC1A 4AJ8A 3GKKA 1U3AA 4YKFA 2CVKA 3KMOA 1TJDA 1A24A 3FKFA 3C1RA 2C0FA 1SD9A 5F06A 2LJAA 1C72A 4USSA 4EIQA 3GMFA 1F2EA 3UVTA 2H6YA 3IR4A 1V2AA 4EL1A 3HVVA 4TW5A 2DSAA 3RHCA 1R5PA 3Q6OA 1S3AA 3FZ5A 4KSMA 2FWHA 4MMMA 5B8BA 1B9XC 1WPIA 1TK0B 4FYBA 1X5CA 3IE3A 1ERUA 1G7DA 1GNWA 1FHEA 4KCAA 1XW5A 5ECSA 2IL3A 2FHEA 3NOFA 1ABAA 1WIKA 2H1AA 3ZRDA 3EC3A 4MJCA 3RPNA 2F51A 2WFCA 3CTGA 3TJFA 4F9ZA 2XC2A 1SL2B 10GSA 4HZ2A 2VCQA 4WBRD 1DUGA 4PQIA 2H75A 4K2XA 2HZFA 4HOJA 3F3RA 1OC3A 1AQXA 4K8MA 1GSEA 4X4JA 3L0HA 2ZCTA 2R6KA 3IRAA 3D6IA 5ECHB 4FYUA 5E59A 1GRXA 1RQMA 3TJJA 1I9DA 2WRTA 3ERWA 5CYYA 4HQZA 3TGZA 3FZ4A 4XS1A 1PA3A 2FLSA 2WZ9A 1XPVA 1NM3A 1BYEA 1Z5YE 1WP0A 3CSHA 5ECMB 1TK5B 3GYKA 3NIVA 5IOWA 4KE3A 13GSA 5AISA 4IQAA 5IPHA 3IC8A 4JBBA 1M2AA 3GSSA 3FEUA 2RUEA 3CYNA 4KDUA 4J57E 2REMA 2LRCA 3KZQA 2N5FA 1NW2A 1OKTA 5IMZA 2JSZA 2ON7A 3WGEA 2P5QA 3UBKA 3QMXA 3WD6A 4YKGA 4KUNA 5GSTA 3ZTLA 3GL3A 5DQYA 4ECCA 2DJ3A 4KW6A 2LJRA 3GX0A 3LGCA 1HNAA 1GSUA 1U6TA 4K2DA 1YQ1A 2H30A 1M99A 4XIHA 5IQYA 3QPMA 2H6ZA 3F4TA 2YPMA 5C00A 2OBKA 3TRQA 2H73A 3UMAA 3HXSA 3ZFLA 2AJQB 2PVQA 2VCZA 3KJYA 2IFQB 3IV4A 2I4AA 4NV5A 2AUVA 4MJBA 4ZILA 5AIVA 2H0IA 5J41A 2HRNA 3ZLPA 4XCSA 1GSQA 5IOXA 3IHQA 4ZB6A 3TKSA 3LXTA 2VO4A 3GURA 4I6XA 2Z9SA 5D9XA 1DE1A 2K8SA 3EINA 2IPAA 3F4RA 2X4AA 1BEDA 3GKXA 2YWMA 4ZB9A 2GDRA 3IAM2 3WGDA 3KH7A 1T7PB 4N11A 5G1KA 2TRXA 4EE0A 1OC9B 2RM5A 2MMOA 1GLPA 3IPZA 1AXDA 1EV9A 2P5RA 2FD3A 3D5JA 4IHUA 5G30A 3WT2A 3CXGA 2A4VA 4G19A 5KOXA 3DEXA 1VRSD 4GRFA 4FO5A 3H79A 5EL8A 2JL4A 4IN0A 1M7TA 1JLWA 4HQSA 5GAPD 1BX9A 2GTUA 1B4QA 1N2AA 4ZL8A 1QK8A 3D21A 4XRDA 3E9JB 1AIUA 3KP9A 5G5EA 5IMCA 1M2BA 1TK8B 2E2GA 3EVIA 3C1SA 2YZUA 2BMXA 2LJKA 2H71A 2H01A 4EDYA 3IA1A 1YKAA 3CBUA 2FA4A 4MJEA 4GTUA 5A4WA 1EV4A 1SKRB 2PERA 2VL3A 5F07A 3ZREA 5DDLA 4QQ7A 3IXRA 2O85A 2GSSA 4MF5A 5HFIA 4J56E 1B8XA 2IFQA 3C8EA 2GSTA 1Y25A 4GSSA 1SJZA 2RLIA 2RIIA 3RBTA 3O76A 1SYXA 5EY6A 2XHFA 3ME7A 4Z2UA 5D9VA 1OKDA 4KB3A 5D8IA 1WE0A 2H1GA 1USBA 3EU4A 1ZOFA 3J7Yk 2WGRA 3A2VA 3F63A 4DSQA 3G7IA 1TU7A 4IVFA 4JZQA 1OC9A 2MBSA 1K0BA 1K3OA 2PU9C 4HU9A 4JRRA 3HJMA 2VL2C 5J4UA 4HJ2A 3TOTA 4IP1A 1G0TA 5H5RA 1KTEA 4DVCA 3GA4A 1F37A 4O92A 3RDWA 1XVWA 4H86A 2HXKA 3DXBA 3LEFA 3Q74A 4TR3A 4POLA 1HNBA 4LL4B 4KCEA 1XIYA 1VF1A 4TKYA 4OO5A 4A5PA 3ED3A 4WBJA 2L59A 3WYWA 4I2UA 5KN3A 1E6BA 2X64A 2C3QA 1XOAA 2PWJA 5G5FA 4EKZA 2RUFA 1XWCA 3OR5A 3IC4A 2DLXA 3EE2A 2VOCA 2F8AA 2H74A 4GF0A 4XTSA 2LQQA 2HSYA 2JZTA 1XW9A 1YDKA 1ZL9A 2H1BA 3PR8A 19GSA 3TOUA 4I8BA 2GS3A 2KP1A 2HSMA 1J9BA 1U88A 3W6GA 3TKRA 2AV4A 2UZ8A 4L5OA 1B4PA 3I69A 5ECPB 4OWYA 4XS6A 1SENA 1TI1A 5G31A 1PKWA 22GSA 2GT6A 3CMIA 3LWAA 4YAPA 4ISDA 1ERTA 5D9TA 2C80A 1GULA 5B8AA 4MH3A 1EP7A 1V9WA 4IQ1A 3K8NA 5EVOA 3JCML 3U5RE 3VFIA 4WR5A 3UJ1A 2C0DA 3IDVA 3FR3A 2H8LA 2DKIA 3DVXA 1NSWA 1PRXA 2DIYA 2O89A 5IMDA 2R3XA 1GLQA 5CREA 3P2AA 3HDCA 1A23A 2DJ1A 1F3BA 4PQHA 3EMXA 4YAVA 3P7XA 5IM9A 1DBYA 2ES7A 3UAPA 2LTKA 3AY8A 2V6OA 4DSSB 2LS5A 1Y6EA 1KNGA 5LNKe 3G9BA 1SK1A 4XRAA 3F9UA 6GSYA 1Z3EA 4TR4A 2F3MA 1B48A 1DE2A 2K9FA 4POMA 5D73A 3RAZA 1FAAA 2V41A 1MDIA 2A2SA 5CRHA 2CZ2A 5F05A 3G7JA 2CX4A 3GHAA 3TUEA 1WOUA 3C7MA 1YF0A 1LBKA 5JCUA 16GSA 2HZEB 5HR2A 1XWBA 2VCTA 2MMAA 4AF2A 4EUYA 4MK3A 1ILOA 3BJ5A 5G2ZA 2A2PA 4LA1A 3GIXA 3F6FA 1YF1A 5JWQB 1GTAA 2FWFA 1AQVA 2PMTA 4ZIJA 3HD5A 1FW1A 1A8YA 2VAFA 5LD0A 1SK0A 3KH9A 3M9KA 5HFKA 1V58A 4AGSA 1X9MB 1GSDA 3HJPA 3APQA 4PNGA 3VI7A 3ME8A 3QOUA 3IAS2 2GZZA 1SYRA 1H75A 2JZRA 4KAEA 2B7KA 4TXVA 3MAKA 2A2RA 2HI7A 3IK9A 5DBQA 1R7HA 4MNNA 3FZAA 1OAZA 4NWYA 1IYIA 2JACA 1SU9A 4GQCA 1XVQA 4DSSA 5ENUA 3P90A 3ZZXA 3MIXA 2E0QA 1O73A 4O5QA 1K3YA 3GKMA 3LYKA 5DVBA 1A8LA 5J3RA 4MCUA 2X99A 4V1Ag 4WF5A 3N5OA 1V40A 4IS0A 3L9UA 2JZSA 4IELA 5ECKB 1FVKA 4XHMA 2L4QA 2C3TA 4PGTA 4K7OA 1SKSB 4GWRA 3LORA 1K0CA 3I43A 2I81A 5C04A 2OKAA 2HZEA 2QA2A 4V2NA 4MF7A 4K5SA 5A5KA 3GRXA 5B6MA 3CSIA 5KEJA 4TVEA 4LLRA 2E7PA 4I5QA 5CRDA 1OC8A 1TRWA 5KN2A 2YOIA 5CRGA 1XW6A 2GGTA 3M0FA 1O81A 1GTIA 1WWJA 1A0FA 3G7YA 2ALBA 1R4WA 5D96A 1SKWB 3NZNA 4ID0A 1QXHA 3C73A 4PUAA 5BMUA 3TKPA 2EIQA 4HUAA 6GSUA 2CZ3A 2EIOA 2L57A 4BVYB 1K0MA 2LNTA 2GLRA 2NDOA 4WR4A 4YQUA 2OE1A 5EPFA 3UVHA 5DALB 3LYPA 4K0GA 4HZ4A 2CA8A 1ZYPA 2J23A 2IWTA 5F8BA 4Q5RA 4EXJA 1NHYA 2FWGA 3ZMLA 1LU4A 1F3AA 4KDYA 1AQWA 3J7Yb 4MLYA 4TR1B 4ZBAA 3LSZA 1TRVA 2MZCA 3GX8A 1TW9A 1CQHA 2PN8A 4Q5FA 1R26A 2L6CA 1W4VA 20GSA 1THXA 2OE0A 1ZMAA 2WB9A 1EOGA 1A2JA 4RQXA 1UVZA 4IGJA 3BBYA 1N8JA 3LG6A 1HYUA 3N9JA 5JCWA 4G0LA 1VF4A 4JE1A 3M3MA 2GZYA 2ON5A 4YH2A 4V2MA 1PN0A 5DAKB 1M0UA 4O5UA 5GSSA 18GSA 2C0GA 3TJGA 5ECIB 2V32A 1RK4A 4GSTA 3V1WA 1ON4A 3QCPA 3HYPA 1BJXA 1Z9HA 3VWVA 2DMLA 1EZKA 2GQKA 4MPGA 4L0WA 2JADA 2CAQA 2R0PA 4POBA 2WDUA 4IBPA 5ELGA 4P3YB 1EP8A 1OYJA 4BVYA 1XCCA 1EOHA 2YNXA 2HFDA 3I6AA 4EF0A 4XS4B 2CV4A 1G6WA 4N0VA 5DALA 2QGVA 4NHZA 4IJ3A 3LFLA 3UL3A 4FIWA 3O3TA 4ZBBA 4N10A 2IMDA 1VGLA 4MZWA 5COHA 4DSRA 3D0ZA 3GH6A 3TDGA 3Q18A 2EIRA 4TR1A 5BRTA 2F9SA 5HR0A 1T4ZA 5IPGA 5DJLA 4MABA 5KOWA 1JHBA 4NAXA 1XOBA 1YZXA 2H19A 4J2FA 4BWQA 2CVDA 2IMEA 3IBHA 1F9MA 4FYCA 3BD2A 2OADA 3PGTA 3VWXA 2XPEA 3QDNA 4GQFA 3H8QA 1FB6A 4K7NA 3ERFA 1GUHA 3A5IA 2VD0A 2IN3A 3FR9A 2P31A 4WEYA 5FHIA 5ECLB 5DAKA 3RHBA 4OCEA 3D4MA 2R0CA 3DIEA 3H1NA 4ECIA 4RI6A 2B5EA 4NHWA 2I1UA 2LEGA 2GVPA 4MH2A 11GSA 3QAWA 1G7EA 2F8FA 2IMKA 3A2XA 5DCHA 2WS2A 1TU8A 4LL1B 3Q19A 2QKEA 3EYTA 1T8EB 4X1UA 1Z7PA 3VWWA 5L71A 3U6VA 4E8HA 4EIPA 4FQUA 2V1MA 7GSSA 3GTUB 2GT5A 3IHGA 6GSWA 1R5AA 5H5SA 4MZCA 4MA9A 4XS4A 4WF4A 4IP6A 1UC7A 3R3EA 3D22A 1F6MC 4O32A 1PX6A 1SK2A 2O87A 2EC4A 2YV7A 1DSBA 3FZ9A 4CDOA 1AUCA 3EWLA 2VIMA 1K0OA 1LJRA 4WKWA 3A2WA 2XBQA 3VK9A 2VL2A 2OA7A 3DVWA 3E0UA 3MDKA 1TXXA 1GSYA 4YQVA 4D73B 3W8JA 4IJIA 4Q5QA 2NVLA 2D2ZA 1GP1A 4O7HA 3QAGA 1XFLA 1G7OA 1X5EA 4EO3A 2FUG2 3FY7A 4F0BA 4POKA 4BA7A 5ID2A 1U3IA 3P8WA 2TRCP 2YP6A 2NBSA 5GZZB 1W89A 4KSOA 4LMWA 3MNGA 3TRPA 1QQ2A 9GSSA 4KDXA 4BL7B 5DJMA 3D4TA 1PSQA 5A4VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OBI A;  2JU5 A;  3A3T A;  4I97 A;  3F3Q A;  2FY6 A;  2GSQ A;  4PQ1 A;  1BAY A;  3F4S A;  2X8G A;  2R4V A;  3BCK A;  3GTU A;  3SWL A;  3TB2 A;  3FYG A;  1ST9 A;  1ZGN A;  3SBC A;  2PPT A;  1URM A;  2C4J A;  2PVO C;  3LXZ A;  5CO3 A;  3KXO A;  3ZIJ A;  1SJ6 A;  4X0X A;  2LKU A;  1O7U A;  4HU7 A;  2R5G A;  3TJK A;  1IYH A;  4CW9 A;  3CTF A;  2M80 A;  2YJ7 A;  5HQP A;  3BCI A;  5JWR B;  1MD4 A;  2J9H A;  1NHO A;  4D73 A;  1MTC A;  2VCX A;  1V57 A;  3F6D A;  1BQ7 A;  3GNJ A;  2HNL A;  3GFK A;  1TDI A;  5B6N A;  3UBL A;  2H0G A;  2PBJ A;  3M9J A;  1KBN A;  2VLU A;  3ZL5 A;  2IMI A;  4ZL9 A;  2PGT A;  1Q98 A;  2KOK A;  4ZXG A;  4PUR A;  4HDE A;  2YV9 A;  5AN1 A;  4RUV A;  3E3E A;  5F0G A;  2GSR A;  2GZP A;  3DYR A;  4GLT A;  1JFU A;  3TKS E;  5KN0 A;  3M1G A;  1XBS A;  2FWE A;  4BWS A;  3FHK A;  5IMA A;  1XWK A;  2XBI A;  1GTU A;  4GSN A;  5IMF A;  4RQR A;  1FOV A;  1VF2 A;  4BL7 A;  3FR6 A;  4MF6 A;  2CQ9 A;  2YCD A;  4OD7 A;  1Q4J A;  2DJJ A;  1PKZ A;  2PUK C;  1X5D A;  3DRN A;  2L5O A;  5LCZ A;  3DML A;  4KA0 A;  1GSS A;  4IKH A;  3ZIT A;  2I3Y A;  5D9W A;  1ZYE A;  4WET A;  4HS1 A;  4NV2 A;  1ACV A;  4PX1 A;  4ZB8 A;  3WGX A;  2WCI A;  2H0H A;  1PX7 A;  4QL9 A;  1Z6N A;  1TTZ A;  1K0N A;  5CP1 A;  1S3D A;  12GS A;  1BG5 A;  1Z6M A;  2YZH A;  5CAX A;  2H66 A;  1PQN A;  4RI7 A;  1GWC A;  1JZW A;  2VM1 A;  2C3N A;  3ZMK A;  4EC0 A;  2FA8 A;  4K0N A;  6GST A;  5A4U A;  1EEJ A;  1OVN A;  5B7C A;  1JLV A;  2M66 A;  2VUP A;  2VL9 A;  4K9Z A;  3ZYW A;  3BOA A;  3M8N A;  1OE7 A;  1M2D A;  4YQM A;  1X0R A;  1XXU A;  4L5L A;  1OE8 A;  4ULX A;  4ECB A;  4F82 A;  1X9S B;  2E2M A;  3QFA C;  4G9H A;  5ELA A;  2C0E A;  1ZCP A;  1SL1 B;  2DJK A;  3KP8 A;  1WMJ A;  1E2Y A;  1TRU A;  2YAN A;  3DGQ A;  5CRW A;  5GAN D;  2MYG A;  1TP9 A;  3H4K A;  2GQM A;  4N30 A;  2LQO A;  1T1V A;  4TR0 A;  5DCG A;  4JR6 A;  2OE3 A;  2L5L A;  2B6M A;  2AB6 A;  2MBT A;  3US3 A;  2HLS A;  2LRT A;  2VM2 A;  3TCO A;  2L4C A;  3ERG A;  2IIY A;  4E8E A;  2B5X A;  3HY2 A;  4EDZ A;  4GXZ A;  3TJB A;  1YKC A;  3CSJ A;  2LUS A;  1ZYQ B;  4DEJ A;  3MSZ A;  3PH9 A;  4L8E A;  1MDK A;  1Z7R A;  4OFN A;  2DJ0 A;  2YWI A;  2BJX A;  3ZVJ A;  4ECJ A;  4MJA A;  3R2Q A;  2AYT A;  3LJR A;  1T4Y A;  1GUM A;  2FCH A;  3ISO A;  5E4W A;  5IIZ A;  2R37 A;  2B7J A;  4TRX A;  1A2L A;  1TI3 A;  3KMN A;  2HE3 A;  1K3L A;  4TOP A;  1GTB A;  5ABR A;  1PL1 A;  3QAV A;  5HFG A;  5ECQ B;  4MPF A;  4ML1 A;  3EU3 A;  1O8X A;  3KM6 A;  4OFT A;  3CRU A;  4TXO B;  3F8U A;  1WRY A;  3KTB A;  4OO4 A;  5AGY A;  5FWG A;  1MDJ A;  1V98 A;  3L9V A;  4G2E A;  2VLT A;  2B1K A;  3DD3 A;  1SD8 A;  1T3B A;  1ZZY A;  5ECR B;  1S3C A;  5J5N A;  2H76 A;  3ZFB A;  4EVM A;  2DMM A;  3H93 A;  3GL5 A;  4HEA 2;  3TKS C;  4JU5 A;  3VI5 A;  5JWO B;  1T00 A;  4KH7 A;  4CHS A;  3GH9 A;  4OFM A;  4F2I A;  3TKQ A;  2HT9 A;  3S9F A;  1KEB A;  2R2J A;  2N5B A;  2YJH A;  2WUL A;  2M46 A;  1HQO A;  3QFB C;  2DBC A;  3KCM A;  3UIW A;  1JZD A;  3HJO A;  5IMV A;  3VUR A;  1CQG A;  3VWU A;  3O6T A;  2MMZ A;  1J0F A;  2XPD A;  3HHV A;  1PN9 A;  2P0G A;  4FH8 A;  2G2Q A;  4NMU A;  1M9A A;  3DKS A;  4L0U A;  17GS A;  2YWN A;  4G10 A;  1M9B A;  2G0F A;  1EGR A;  2C1Y A;  4V2L A;  1QMV A;  1TRS A;  2VD1 A;  2OJL A;  4O5R A;  2CAI A;  1XWA A;  3HZ4 A;  1FB0 A;  5D93 A;  4TXO A;  2O7K A;  3A5W A;  2GQL A;  1HD2 A;  3ZVJ D;  4MP4 A;  5ID2 B;  3EUR A;  2HSH A;  2N5A A;  4K6X A;  4MZB A;  8GSS A;  4PNF A;  2H72 A;  4F0C A;  2DJ2 A;  1O8W A;  2IJY A;  5FT3 A;  1A0R P;  1J08 A;  6GSS A;  2WJU A;  3RPP A;  3GKN A;  1PL2 A;  1B9Y C;  3PIN A;  2H70 A;  4ACS A;  2X8C A;  3GST A;  3KGK A;  2V6K A;  1SL0 B;  4ZL7 A;  1RW1 A;  1K0D A;  3WT1 A;  5ECO B;  2KHP A;  5ECN B;  2AHE A;  2ZNM A;  1PGT A;  2K8V A;  1FVJ A;  4K7I A;  3EMP A;  2NTO A;  4ILF A;  2NPB A;  5KN1 A;  1GL8 A;  3GUS A;  3FRC A;  1GH2 A;  3HZ8 A;  3L4N A;  4OCF A;  3ZIV A;  1QUW A;  4OMV A;  1G6Y A;  4LMV A;  1YJ6 A;  2YWO A;  2LV3 A;  4KX4 A;  3UOM A;  1YY7 A;  4Q5N A;  5CNW A;  6GSX A;  5AIX A;  1AW9 A;  3KIJ A;  2QSI A;  1I5G A;  2LST A;  3KTL A;  3TRX A;  1O85 A;  2HYX A;  4PUF C;  1GUK A;  5G1L A;  5H5Q A;  2CVB A;  2OAC A;  2KLX A;  1QGV A;  3DWV A;  1EEM A;  5JCG A;  3UAR A;  3UEM A;  3VLN A;  4I2T A;  2X8H A;  2HRF A;  4KND A;  1PMT A;  2FNO A;  4ML6 A;  2VCW A;  1FO5 A;  3GN3 A;  2ZUP A;  2K6V A;  1FG4 A;  1MD3 A;  3CRT A;  2IMF A;  5J9C A;  4KGI A;  2I9H A;  2M72 A;  3HA9 A;  2V2G A;  5IO2 A;  2QC7 A;  3APO A;  6GSV A;  3VPQ A;  4HI7 A;  1JZO A;  4NPB A;  1PD2 1;  4BVX A;  3C71 A;  2K18 A;  4JR4 A;  5HR3 A;  4IW9 A;  1XWG A;  5INY A;  4X43 A;  1O6J A;  2FGX A;  3HCZ A;  4F03 A;  1JZR A;  3HKR A;  1MEK A;  4TN8 A;  4AJ6 A;  3QD9 A;  2KP2 A;  4NXI A;  4Z7X A;  1HNC A;  2O8V B;  4HJM A;  3KEB A;  1ML6 A;  2YN1 A;  1THO A;  3VPT A;  3F0I A;  1TKD B;  1H4O A;  1ERW A;  4K1F A;  1A2M A;  4ZBD A;  3IK7 A;  4GCI A;  2VLV A;  1WJK A;  14GS A;  2C8U A;  2B1L A;  1GSF A;  1TOF A;  3FK8 A;  5J9B A;  3I9V 2;  3L78 A;  1YEP A;  1ERV A;  4AJ7 A;  4QL7 A;  1EGO A;  2B3S A;  3IOS A;  2CT6 A;  1XZO A;  1EWX A;  1AAZ A;  4WXT A;  3GV1 A;  1SJI A;  2DC5 A;  1GNE A;  2L6D A;  2DIZ A;  5IO0 A;  2AAW A;  3LQ7 A;  1VF3 A;  2H1D A;  4BPY A;  3HVS A;  1K0A A;  5DQS A;  4JED A;  2VCV A;  2H6X A;  3FW2 A;  3APS A;  3KD0 A;  3QR6 A;  4MDC A;  4N0Z A;  2KUC A;  3L9S A;  2LNS A;  1YEX A;  2RM6 A;  3W8S A;  3MWH A;  4PXO A;  1X9W B;  2BTO T;  1U87 A;  4V1A p;  2MMN A;  5HR1 A;  2LRN A;  3HVX A;  2JSY A;  1UA5 A;  2B5Y A;  2CX3 A;  1UN2 A;  2TIR A;  1QFN A;  1AC1 A;  4AJ8 A;  3GKK A;  1U3A A;  2CVK A;  3KMO A;  1TJD A;  1A24 A;  3FKF A;  3C1R A;  2C0F A;  1SD9 A;  5F06 A;  2LJA A;  1C72 A;  3GMF A;  1F2E A;  3UVT A;  2H6Y A;  3IR4 A;  1V2A A;  4EL1 A;  3HVV A;  4TW5 A;  2DSA A;  3RHC A;  1R5P A;  3Q6O A;  1S3A A;  3FZ5 A;  4KSM A;  2FWH A;  4MMM A;  5B8B A;  1B9X C;  1WPI A;  1TK0 B;  4FYB A;  1X5C A;  3IE3 A;  1ERU A;  1G7D A;  1GNW A;  1FHE A;  4KCA A;  1XW5 A;  5ECS A;  2IL3 A;  2FHE A;  3NOF A;  1ABA A;  1WIK A;  2H1A A;  3ZRD A;  3EC3 A;  4MJC A;  3RPN A;  2F51 A;  2WFC A;  3CTG A;  3TJF A;  4F9Z A;  2XC2 A;  1SL2 B;  10GS A;  4HZ2 A;  2VCQ A;  4WBR D;  1DUG A;  4PQI A;  2H75 A;  2HZF A;  4HOJ A;  3F3R A;  1OC3 A;  1AQX A;  4K8M A;  1GSE A;  3L0H A;  2ZCT A;  2R6K A;  3IRA A;  3D6I A;  5ECH B;  4FYU A;  5E59 A;  1GRX A;  1RQM A;  3TJJ A;  1I9D A;  2WRT A;  3ERW A;  5CYY A;  4HQZ A;  3TGZ A;  3FZ4 A;  4XS1 A;  1PA3 A;  2FLS A;  2WZ9 A;  1XPV A;  1NM3 A;  1BYE A;  1Z5Y E;  1WP0 A;  3CSH A;  5ECM B;  1TK5 B;  3GYK A;  3NIV A;  5IOW A;  4KE3 A;  13GS A;  5AIS A;  4IQA A;  5IPH A;  4JBB A;  1M2A A;  3GSS A;  3FEU A;  2RUE A;  3CYN A;  4KDU A;  4J57 E;  2REM A;  2LRC A;  3KZQ A;  2N5F A;  1NW2 A;  1OKT A;  5IMZ A;  2JSZ A;  2ON7 A;  3WGE A;  2P5Q A;  3UBK A;  3QMX A;  3WD6 A;  4KUN A;  5GST A;  3ZTL A;  3GL3 A;  5DQY A;  4ECC A;  2DJ3 A;  4KW6 A;  2LJR A;  3GX0 A;  3LGC A;  1HNA A;  1GSU A;  1U6T A;  4K2D A;  1YQ1 A;  2H30 A;  1M99 A;  4XIH A;  5IQY A;  3QPM A;  2H6Z A;  3F4T A;  2YPM A;  5C00 A;  2OBK A;  3TRQ A;  2H73 A;  3UMA A;  3HXS A;  3ZFL A;  2AJQ B;  2PVQ A;  2VCZ A;  3KJY A;  2IFQ B;  3IV4 A;  2I4A A;  4NV5 A;  2AUV A;  4MJB A;  4ZIL A;  5AIV A;  2H0I A;  5J41 A;  2HRN A;  3ZLP A;  4XCS A;  1GSQ A;  5IOX A;  3IHQ A;  4ZB6 A;  3TKS A;  3LXT A;  2VO4 A;  3GUR A;  4I6X A;  2Z9S A;  5D9X A;  1DE1 A;  2K8S A;  3EIN A;  2IPA A;  3F4R A;  1BED A;  3GKX A;  2YWM A;  4ZB9 A;  2GDR A;  3IAM 2;  3WGD A;  3KH7 A;  1T7P B;  4N11 A;  5G1K A;  2TRX A;  4EE0 A;  1OC9 B;  2RM5 A;  2MMO A;  1GLP A;  3IPZ A;  1AXD A;  1EV9 A;  2P5R A;  2FD3 A;  3D5J A;  4IHU A;  5G30 A;  3WT2 A;  3CXG A;  2A4V A;  4G19 A;  3DEX A;  1VRS D;  4GRF A;  4FO5 A;  3H79 A;  5EL8 A;  2JL4 A;  4IN0 A;  1M7T A;  1JLW A;  4HQS A;  5GAP D;  1BX9 A;  2GTU A;  1B4Q A;  1N2A A;  4ZL8 A;  1QK8 A;  3D21 A;  4XRD A;  3E9J B;  1AIU A;  3KP9 A;  5G5E A;  5IMC A;  1M2B A;  1TK8 B;  2E2G A;  3EVI A;  3C1S A;  2YZU A;  2BMX A;  2LJK A;  2H71 A;  2H01 A;  4EDY A;  3IA1 A;  1YKA A;  3CBU A;  2FA4 A;  4MJE A;  4GTU A;  5A4W A;  1EV4 A;  1SKR B;  2PER A;  2VL3 A;  5F07 A;  3ZRE A;  5DDL A;  4QQ7 A;  3IXR A;  2O85 A;  2GSS A;  4MF5 A;  5HFI A;  4J56 E;  1B8X A;  2IFQ A;  3C8E A;  2GST A;  1Y25 A;  4GSS A;  1SJZ A;  2RLI A;  2RII A;  3RBT A;  3O76 A;  1SYX A;  5EY6 A;  2XHF A;  3ME7 A;  5D9V A;  1OKD A;  4KB3 A;  5D8I A;  1WE0 A;  2H1G A;  1USB A;  3EU4 A;  1ZOF A;  3J7Y k;  2WGR A;  3A2V A;  3F63 A;  4DSQ A;  3G7I A;  1TU7 A;  4IVF A;  4JZQ A;  1OC9 A;  2MBS A;  1K0B A;  1K3O A;  2PU9 C;  4HU9 A;  4JRR A;  3HJM A;  2VL2 C;  5J4U A;  4HJ2 A;  3TOT A;  4IP1 A;  1G0T A;  5H5R A;  1KTE A;  4DVC A;  3GA4 A;  1F37 A;  4O92 A;  3RDW A;  1XVW A;  4H86 A;  2HXK A;  3DXB A;  3LEF A;  3Q74 A;  4TR3 A;  4POL A;  1HNB A;  4LL4 B;  4KCE A;  1XIY A;  1VF1 A;  4TKY A;  4OO5 A;  3ED3 A;  4WBJ A;  2L59 A;  3WYW A;  4I2U A;  5KN3 A;  1E6B A;  2X64 A;  2C3Q A;  1XOA A;  2PWJ A;  5G5F A;  4EKZ A;  2RUF A;  1XWC A;  3OR5 A;  3IC4 A;  2DLX A;  3EE2 A;  2VOC A;  2F8A A;  2H74 A;  4GF0 A;  4XTS A;  2LQQ A;  2HSY A;  2JZT A;  1XW9 A;  1YDK A;  1ZL9 A;  2H1B A;  3PR8 A;  19GS A;  3TOU A;  4I8B A;  2GS3 A;  2KP1 A;  1J9B A;  1U88 A;  3W6G A;  3TKR A;  2AV4 A;  4L5O A;  1B4P A;  3I69 A;  5ECP B;  4OWY A;  4XS6 A;  1SEN A;  1TI1 A;  5G31 A;  1PKW A;  22GS A;  2GT6 A;  3CMI A;  3LWA A;  4YAP A;  4ISD A;  1ERT A;  5D9T A;  2C80 A;  1GUL A;  5B8A A;  4MH3 A;  1EP7 A;  1V9W A;  4IQ1 A;  3K8N A;  5EVO A;  3JCM L;  3U5R E;  3VFI A;  4WR5 A;  3UJ1 A;  2C0D A;  3IDV A;  3FR3 A;  2H8L A;  3DVX A;  1NSW A;  1PRX A;  2DIY A;  2O89 A;  5IMD A;  2R3X A;  1GLQ A;  5CRE A;  3P2A A;  3HDC A;  1A23 A;  2DJ1 A;  1F3B A;  4PQH A;  3EMX A;  4YAV A;  3P7X A;  5IM9 A;  1DBY A;  2ES7 A;  3UAP A;  2LTK A;  3AY8 A;  2V6O A;  4DSS B;  2LS5 A;  1Y6E A;  1KNG A;  5LNK e;  3G9B A;  1SK1 A;  4XRA A;  3F9U A;  6GSY A;  1Z3E A;  4TR4 A;  2F3M A;  1B48 A;  1DE2 A;  2K9F A;  4POM A;  5D73 A;  3RAZ A;  1FAA A;  2V41 A;  1MDI A;  2A2S A;  5CRH A;  2CZ2 A;  5F05 A;  3G7J A;  2CX4 A;  3GHA A;  3TUE A;  1WOU A;  3C7M A;  1YF0 A;  1LBK A;  5JCU A;  16GS A;  2HZE B;  5HR2 A;  1XWB A;  2VCT A;  2MMA A;  4AF2 A;  4EUY A;  4MK3 A;  1ILO A;  3BJ5 A;  5G2Z A;  4LA1 A;  3GIX A;  3F6F A;  1YF1 A;  5JWQ B;  1GTA A;  2FWF A;  1AQV A;  2PMT A;  4ZIJ A;  3HD5 A;  1FW1 A;  1A8Y A;  2VAF A;  5LD0 A;  1SK0 A;  3KH9 A;  3M9K A;  5HFK A;  1V58 A;  4AGS A;  1X9M B;  1GSD A;  3HJP A;  3APQ A;  4PNG A;  3VI7 A;  3ME8 A;  3QOU A;  3IAS 2;  2GZZ A;  1SYR A;  1H75 A;  2JZR A;  4KAE A;  2B7K A;  4TXV A;  3MAK A;  2A2R A;  2HI7 A;  3IK9 A;  5DBQ A;  1R7H A;  3FZA A;  1OAZ A;  4NWY A;  1IYI A;  2JAC A;  1SU9 A;  4GQC A;  1XVQ A;  4DSS A;  5ENU A;  3P90 A;  3ZZX A;  2E0Q A;  1O73 A;  1K3Y A;  3GKM A;  3LYK A;  5DVB A;  1A8L A;  5J3R A;  4MCU A;  2X99 A;  4V1A g;  4WF5 A;  3N5O A;  1V40 A;  4IS0 A;  3L9U A;  2JZS A;  4IEL A;  5ECK B;  1FVK A;  4XHM A;  2L4Q A;  2C3T A;  4PGT A;  4K7O A;  1SKS B;  4GWR A;  3LOR A;  1K0C A;  3I43 A;  2I81 A;  5C04 A;  2OKA A;  2HZE A;  4V2N A;  4MF7 A;  5A5K A;  3GRX A;  5B6M A;  3CSI A;  5KEJ A;  4TVE A;  4LLR A;  2E7P A;  4I5Q A;  5CRD A;  1OC8 A;  1TRW A;  5KN2 A;  2YOI A;  5CRG A;  1XW6 A;  2GGT A;  3M0F A;  1O81 A;  1GTI A;  1WWJ A;  1A0F A;  3G7Y A;  2ALB A;  1R4W A;  5D96 A;  1SKW B;  3NZN A;  4ID0 A;  1QXH A;  3C73 A;  4PUA A;  3TKP A;  2EIQ A;  4HUA A;  6GSU A;  2CZ3 A;  2EIO A;  2L57 A;  1K0M A;  2LNT A;  2GLR A;  2NDO A;  4WR4 A;  4YQU A;  2OE1 A;  5EPF A;  3UVH A;  5DAL B;  3LYP A;  4K0G A;  4HZ4 A;  2CA8 A;  2J23 A;  2IWT A;  5F8B A;  4Q5R A;  4EXJ A;  1NHY A;  2FWG A;  3ZML A;  1LU4 A;  1F3A A;  4KDY A;  1AQW A;  3J7Y b;  4MLY A;  4TR1 B;  4ZBA A;  3LSZ A;  1TRV A;  2MZC A;  3GX8 A;  1TW9 A;  1CQH A;  2PN8 A;  4Q5F A;  1R26 A;  2L6C A;  1W4V A;  20GS A;  1THX A;  2OE0 A;  1ZMA A;  2WB9 A;  1EOG A;  1A2J A;  4RQX A;  1UVZ A;  4IGJ A;  3BBY A;  1N8J A;  3LG6 A;  1HYU A;  3N9J A;  5JCW A;  1VF4 A;  4JE1 A;  3M3M A;  2GZY A;  2ON5 A;  4YH2 A;  4V2M A;  5DAK B;  1M0U A;  5GSS A;  18GS A;  2C0G A;  3TJG A;  5ECI B;  2V32 A;  1RK4 A;  4GST A;  3V1W A;  1ON4 A;  3QCP A;  3HYP A;  1BJX A;  1Z9H A;  3VWV A;  2DML A;  1EZK A;  2GQK A;  4MPG A;  4L0W A;  2JAD A;  2CAQ A;  4POB A;  2WDU A;  4IBP A;  5ELG A;  4P3Y B;  1EP8 A;  1OYJ A;  4BVY A;  1XCC A;  1EOH A;  2YNX A;  2HFD A;  3I6A A;  4EF0 A;  4XS4 B;  2CV4 A;  1G6W A;  4N0V A;  5DAL A;  2QGV A;  4NHZ A;  4IJ3 A;  3LFL A;  3UL3 A;  4FIW A;  3O3T A;  4ZBB A;  4N10 A;  2IMD A;  1VGL A;  4MZW A;  5COH A;  4DSR A;  3D0Z A;  3GH6 A;  3TDG A;  3Q18 A;  2EIR A;  4TR1 A;  2F9S A;  5HR0 A;  1T4Z A;  5IPG A;  5DJL A;  4MAB A;  1JHB A;  4NAX A;  1XOB A;  1YZX A;  2H19 A;  4J2F A;  4BWQ A;  2CVD A;  2IME A;  3IBH A;  1F9M A;  4FYC A;  3BD2 A;  2OAD A;  3PGT A;  3VWX A;  2XPE A;  3QDN A;  4GQF A;  3H8Q A;  1FB6 A;  4K7N A;  3ERF A;  1GUH A;  2VD0 A;  2IN3 A;  3FR9 A;  2P31 A;  4WEY A;  5FHI A;  5ECL B;  5DAK A;  3RHB A;  4OCE A;  3D4M A;  3DIE A;  3H1N A;  4ECI A;  4RI6 A;  2B5E A;  4NHW A;  2I1U A;  2LEG A;  2GVP A;  4MH2 A;  11GS A;  3QAW A;  1G7E A;  2F8F A;  2IMK A;  3A2X A;  5DCH A;  2WS2 A;  1TU8 A;  4LL1 B;  3Q19 A;  2QKE A;  3EYT A;  1T8E B;  4X1U A;  1Z7P A;  3VWW A;  5L71 A;  3U6V A;  4E8H A;  2V1M A;  7GSS A;  3GTU B;  2GT5 A;  6GSW A;  1R5A A;  5H5S A;  4MZC A;  4MA9 A;  4XS4 A;  4WF4 A;  4IP6 A;  1UC7 A;  3D22 A;  1F6M C;  4O32 A;  1PX6 A;  1SK2 A;  2O87 A;  2EC4 A;  2YV7 A;  1DSB A;  3FZ9 A;  4CDO A;  1AUC A;  3EWL A;  2VIM A;  1K0O A;  1LJR A;  4WKW A;  3A2W A;  2XBQ A;  3VK9 A;  2VL2 A;  2OA7 A;  3DVW A;  3E0U A;  3MDK A;  1TXX A;  1GSY A;  4YQV A;  4D73 B;  3W8J A;  4IJI A;  4Q5Q A;  2NVL A;  2D2Z A;  1GP1 A;  4O7H A;  3QAG A;  1XFL A;  1G7O A;  1X5E A;  4EO3 A;  2FUG 2;  3FY7 A;  4F0B A;  4POK A;  4BA7 A;  5ID2 A;  1U3I A;  3P8W A;  2TRC P;  2YP6 A;  2NBS A;  5GZZ B;  1W89 A;  4KSO A;  4LMW A;  3MNG A;  3TRP A;  1QQ2 A;  9GSS A;  4KDX A;  5DJM A;  3D4T A;  1PSQ A;  5A4V A; 
#chains in the Genus database with same CATH topology
 2OBI A;  2JU5 A;  3A3T A;  4I97 A;  3F3Q A;  2FY6 A;  2GSQ A;  4PQ1 A;  1BAY A;  3F4S A;  4G0K A;  2X8G A;  2R4V A;  3BCK A;  3GTU A;  3SWL A;  3TB2 A;  3FYG A;  1ST9 A;  1ZGN A;  3SBC A;  2PPT A;  1URM A;  2C4J A;  2PVO C;  3LXZ A;  5CO3 A;  3KXO A;  3ZIJ A;  1SJ6 A;  4X0X A;  2LKU A;  1O7U A;  4HU7 A;  2R5G A;  3TJK A;  1IYH A;  4CW9 A;  3CTF A;  2M80 A;  2YJ7 A;  5HQP A;  3BCI A;  5JWR B;  1MD4 A;  2J9H A;  1NHO A;  4D73 A;  1MTC A;  2VCX A;  1V57 A;  3F6D A;  1BQ7 A;  3GNJ A;  2HNL A;  3GFK A;  1TDI A;  5B6N A;  3UBL A;  2H0G A;  2PBJ A;  3M9J A;  3MYD A;  1KBN A;  2VLU A;  3ZL5 A;  2IMI A;  4G0I A;  4ZL9 A;  2PGT A;  1Q98 A;  2KOK A;  4ZXG A;  4PUR A;  4HDE A;  2YV9 A;  5AN1 A;  4RUV A;  3E3E A;  5F0G A;  2GSR A;  2GZP A;  3DYR A;  4GLT A;  1JFU A;  3TKS E;  5KN0 A;  3M1G A;  1XBS A;  2FWE A;  4BWS A;  3FHK A;  5IMA A;  1XWK A;  2XBI A;  1GTU A;  4GSN A;  5IMF A;  4RQR A;  1FOV A;  1VF2 A;  4BL7 A;  3FR6 A;  4MF6 A;  2CQ9 A;  2YCD A;  4OD7 A;  1Q4J A;  2DJJ A;  1PKZ A;  2PUK C;  1X5D A;  3DRN A;  2L5O A;  5LCZ A;  3DML A;  4KA0 A;  1GSS A;  4IKH A;  3ZIT A;  2I3Y A;  4K5R A;  5D9W A;  1ZYE A;  4WET A;  4HS1 A;  4NV2 A;  1ACV A;  4PX1 A;  4ZB8 A;  3WGX A;  2WCI A;  2H0H A;  1PX7 A;  4QL9 A;  1Z6N A;  1TTZ A;  1K0N A;  5CP1 A;  1S3D A;  12GS A;  1BG5 A;  1Z6M A;  2YZH A;  5CAX A;  2H66 A;  1PQN A;  4RI7 A;  1GWC A;  1JZW A;  2VM1 A;  2C3N A;  3ZMK A;  4EC0 A;  2FA8 A;  4K0N A;  6GST A;  5A4U A;  1EEJ A;  1OVN A;  5B7C A;  1JLV A;  2M66 A;  2VUP A;  2VL9 A;  4K9Z A;  3ZYW A;  3BOA A;  3M8N A;  1OE7 A;  1M2D A;  4YQM A;  1X0R A;  1XXU A;  4L5L A;  1OE8 A;  4ULX A;  4ECB A;  4F82 A;  1X9S B;  2E2M A;  3QFA C;  4G9H A;  5ELA A;  2C0E A;  1ZCP A;  1SL1 B;  2DJK A;  3KP8 A;  1WMJ A;  1E2Y A;  1TRU A;  2YAN A;  3DGQ A;  5CRW A;  5GAN D;  2MYG A;  1TP9 A;  3H4K A;  2GQM A;  4N30 A;  2LQO A;  1T1V A;  4TR0 A;  5DCG A;  4JR6 A;  2OE3 A;  2L5L A;  2B6M A;  2AB6 A;  2MBT A;  3US3 A;  2HLS A;  2LRT A;  2VM2 A;  3TCO A;  4Z2T A;  2L4C A;  3ERG A;  2IIY A;  4E8E A;  2B5X A;  3HY2 A;  4EDZ A;  4GXZ A;  3TJB A;  1YKC A;  3CSJ A;  2LUS A;  3EPT A;  1ZYQ B;  4DEJ A;  3MSZ A;  3PH9 A;  4L8E A;  1MDK A;  1Z7R A;  4OFN A;  2DJ0 A;  2YWI A;  2BJX A;  3ZVJ A;  4ECJ A;  4MJA A;  3R2Q A;  2AYT A;  3LJR A;  1T4Y A;  1GUM A;  2FCH A;  3ISO A;  5E4W A;  5IIZ A;  2R37 A;  2B7J A;  4TRX A;  1A2L A;  1TI3 A;  3KMN A;  2HE3 A;  1K3L A;  4TOP A;  1GTB A;  5ABR A;  1PL1 A;  3QAV A;  5HFG A;  5ECQ B;  4MPF A;  4ML1 A;  3EU3 A;  1O8X A;  3KM6 A;  4OFT A;  3CRU A;  4TXO B;  3F8U A;  1WRY A;  3KTB A;  4OO4 A;  5AGY A;  5FWG A;  1MDJ A;  1V98 A;  3L9V A;  4G2E A;  2VLT A;  2HRK A;  2B1K A;  3DD3 A;  3PPU A;  1SD8 A;  1T3B A;  1ZZY A;  5ECR B;  1S3C A;  5J5N A;  2H76 A;  3ZFB A;  4EVM A;  2DMM A;  3H93 A;  3GL5 A;  4HEA 2;  3TKS C;  4JU5 A;  3VI5 A;  5JWO B;  1T00 A;  4KH7 A;  4CHS A;  3GH9 A;  1FOH A;  4OFM A;  4F2I A;  3TKQ A;  2HT9 A;  3S9F A;  1KEB A;  2R2J A;  2N5B A;  2YJH A;  2WUL A;  2M46 A;  1HQO A;  3QFB C;  2DBC A;  3KCM A;  3UIW A;  1JZD A;  3HJO A;  5IMV A;  3VUR A;  1CQG A;  3VWU A;  3O6T A;  2MMZ A;  1J0F A;  2XPD A;  3HHV A;  1PN9 A;  2P0G A;  4FH8 A;  2G2Q A;  4NMU A;  1M9A A;  3DKS A;  4L0U A;  17GS A;  4ICY A;  2YWN A;  4G10 A;  1M9B A;  2G0F A;  1EGR A;  2C1Y A;  4V2L A;  3HVN A;  1QMV A;  1TRS A;  3FMW A;  2VD1 A;  2QA1 A;  2OJL A;  4O5R A;  2CAI A;  4PTS A;  1XWA A;  3HZ4 A;  1FB0 A;  5D93 A;  4TXO A;  2O7K A;  3A5W A;  4Z2R A;  2GQL A;  1HD2 A;  4CY8 A;  3ZVJ D;  4MP4 A;  5ID2 B;  3EUR A;  2HSH A;  2N5A A;  4K6X A;  4MZB A;  8GSS A;  4PNF A;  2H72 A;  4F0C A;  2DJ2 A;  1O8W A;  2IJY A;  5FT3 A;  1A0R P;  1J08 A;  6GSS A;  2WJU A;  3RPP A;  3GKN A;  4KF9 A;  1PL2 A;  1B9Y C;  3PIN A;  2H70 A;  4ACS A;  2X8C A;  3GST A;  3KGK A;  2V6K A;  1SL0 B;  4ZL7 A;  1RW1 A;  4BVX B;  1K0D A;  3WT1 A;  5ECO B;  2KHP A;  5ECN B;  2AHE A;  2ZNM A;  1PGT A;  2K8V A;  1FVJ A;  2HRA A;  3EMP A;  4K7I A;  2NTO A;  4ILF A;  2NPB A;  5KN1 A;  1GL8 A;  3GUS A;  3FRC A;  1GH2 A;  3HZ8 A;  3L4N A;  4OCF A;  3ZIV A;  1QUW A;  4OMV A;  1G6Y A;  4LMV A;  1YJ6 A;  2YWO A;  3LW9 A;  2LV3 A;  4KX4 A;  3UOM A;  1YY7 A;  4Q5N A;  5CNW A;  6GSX A;  5AIX A;  1AW9 A;  3KIJ A;  2QSI A;  1I5G A;  2LST A;  3KTL A;  3TRX A;  1O85 A;  2HYX A;  4PUF C;  1GUK A;  5G1L A;  5H5Q A;  2CVB A;  2OAC A;  2KLX A;  1QGV A;  1ZYN A;  3DWV A;  1EEM A;  5JCG A;  3UAR A;  3UEM A;  3VLN A;  4I2T A;  2X8H A;  2HRF A;  4KND A;  1PMT A;  2FNO A;  2R0G A;  4ML6 A;  2VCW A;  1FO5 A;  3GN3 A;  2ZUP A;  2K6V A;  1FG4 A;  1MD3 A;  3CRT A;  2IMF A;  5J9C A;  4KGI A;  2I9H A;  2A4H A;  2M72 A;  3HA9 A;  2V2G A;  5IO2 A;  2QC7 A;  3APO A;  6GSV A;  3VPQ A;  4HI7 A;  1JZO A;  4NPB A;  1PD2 1;  4BVX A;  3C71 A;  2K18 A;  2DKH A;  4JR4 A;  5HR3 A;  4IW9 A;  1XWG A;  2X49 A;  5INY A;  4X43 A;  1O6J A;  2FGX A;  3HCZ A;  4F03 A;  1JZR A;  3HKR A;  1MEK A;  4TN8 A;  4AJ6 A;  3QD9 A;  2KP2 A;  4NXI A;  4Z7X A;  1HNC A;  2O8V B;  4HJM A;  3KEB A;  1ML6 A;  2YN1 A;  1THO A;  3VPT A;  3F0I A;  1TKD B;  1H4O A;  1ERW A;  4K1F A;  1A2M A;  4ZBD A;  3IK7 A;  4GCI A;  2VLV A;  1WJK A;  14GS A;  2C8U A;  2B1L A;  1GSF A;  1TOF A;  3FK8 A;  5J9B A;  3I9V 2;  3L78 A;  1YEP A;  1ERV A;  4AJ7 A;  4QL7 A;  1EGO A;  2B3S A;  3IOS A;  2CT6 A;  1XZO A;  1EWX A;  1AAZ A;  4WXT A;  3GV1 A;  1SJI A;  2DC5 A;  1GNE A;  2L6D A;  2DIZ A;  5IO0 A;  2AAW A;  3LQ7 A;  1VF3 A;  2H1D A;  4BPY A;  3HVS A;  1K0A A;  5DQS A;  4JED A;  2VCV A;  2H6X A;  3FW2 A;  3APS A;  3KD0 A;  3QR6 A;  4MDC A;  4N0Z A;  2KUC A;  3L9S A;  2LNS A;  1YEX A;  2RM6 A;  3W8S A;  3MWH A;  4PXO A;  1X9W B;  2BTO T;  1U87 A;  4V1A p;  2MMN A;  5HR1 A;  2LRN A;  3HVX A;  2JSY A;  1UA5 A;  2B5Y A;  4CY6 A;  2CX3 A;  1UN2 A;  2TIR A;  1QFN A;  1AC1 A;  4AJ8 A;  3GKK A;  1U3A A;  4YKF A;  2CVK A;  3KMO A;  1TJD A;  1A24 A;  3FKF A;  3C1R A;  2C0F A;  1SD9 A;  5F06 A;  2LJA A;  1C72 A;  4USS A;  4EIQ A;  3GMF A;  1F2E A;  3UVT A;  2H6Y A;  3IR4 A;  1V2A A;  4EL1 A;  3HVV A;  4TW5 A;  2DSA A;  3RHC A;  1R5P A;  3Q6O A;  1S3A A;  3FZ5 A;  4KSM A;  2FWH A;  4MMM A;  5B8B A;  1B9X C;  1WPI A;  1TK0 B;  4FYB A;  1X5C A;  3IE3 A;  1ERU A;  1G7D A;  1GNW A;  1FHE A;  4KCA A;  1XW5 A;  5ECS A;  2IL3 A;  2FHE A;  3NOF A;  1ABA A;  1WIK A;  2H1A A;  3ZRD A;  3EC3 A;  4MJC A;  3RPN A;  2F51 A;  2WFC A;  3CTG A;  3TJF A;  4F9Z A;  2XC2 A;  1SL2 B;  10GS A;  4HZ2 A;  2VCQ A;  4WBR D;  1DUG A;  4PQI A;  2H75 A;  4K2X A;  2HZF A;  4HOJ A;  3F3R A;  1OC3 A;  1AQX A;  4K8M A;  1GSE A;  4X4J A;  3L0H A;  2ZCT A;  2R6K A;  3IRA A;  3D6I A;  5ECH B;  4FYU A;  5E59 A;  1GRX A;  1RQM A;  3TJJ A;  1I9D A;  2WRT A;  3ERW A;  5CYY A;  4HQZ A;  3TGZ A;  3FZ4 A;  4XS1 A;  1PA3 A;  2FLS A;  2WZ9 A;  1XPV A;  1NM3 A;  1BYE A;  1Z5Y E;  1WP0 A;  3CSH A;  5ECM B;  1XG8 A;  1TK5 B;  3GYK A;  3NIV A;  5IOW A;  4KE3 A;  13GS A;  5AIS A;  4IQA A;  5IPH A;  3IC8 A;  4JBB A;  1M2A A;  3GSS A;  3FEU A;  2RUE A;  3CYN A;  4KDU A;  4J57 E;  2REM A;  2LRC A;  3KZQ A;  2N5F A;  1NW2 A;  1OKT A;  5IMZ A;  2JSZ A;  2ON7 A;  3WGE A;  2P5Q A;  3UBK A;  3QMX A;  3WD6 A;  4YKG A;  4KUN A;  5GST A;  3ZTL A;  3GL3 A;  5DQY A;  4ECC A;  4BIK A;  2DJ3 A;  4KW6 A;  2LJR A;  3GX0 A;  3LGC A;  1HNA A;  1GSU A;  1U6T A;  4K2D A;  1YQ1 A;  2H30 A;  1M99 A;  4XIH A;  5IQY A;  3QPM A;  2H6Z A;  3F4T A;  2YPM A;  5C00 A;  2OBK A;  3TRQ A;  2H73 A;  3UMA A;  3HXS A;  3ZFL A;  2AJQ B;  2PVQ A;  2VCZ A;  3KJY A;  2IFQ B;  3IV4 A;  2I4A A;  4NV5 A;  2AUV A;  4MJB A;  4ZIL A;  5AIV A;  2H0I A;  5J41 A;  2HRN A;  3ZLP A;  4XCS A;  1GSQ A;  5IOX A;  3IHQ A;  4ZB6 A;  3TKS A;  3LXT A;  2VO4 A;  3GUR A;  4I6X A;  2Z9S A;  5D9X A;  1DE1 A;  2K8S A;  3EIN A;  2IPA A;  3F4R A;  2X4A A;  1BED A;  1PFO A;  3GKX A;  2YWM A;  4ZB9 A;  2GDR A;  3IAM 2;  3WGD A;  3KH7 A;  1T7P B;  4N11 A;  5G1K A;  2TRX A;  4EE0 A;  1OC9 B;  2RM5 A;  2MMO A;  1GLP A;  3IPZ A;  1AXD A;  1EV9 A;  2P5R A;  2FD3 A;  3D5J A;  4IHU A;  5G30 A;  3WT2 A;  3CXG A;  2A4V A;  4G19 A;  5KOX A;  3DEX A;  1VRS D;  4GRF A;  4FO5 A;  3H79 A;  5EL8 A;  2JL4 A;  4IN0 A;  1M7T A;  1JLW A;  4HQS A;  5GAP D;  1BX9 A;  2GTU A;  1B4Q A;  1N2A A;  4ZL8 A;  1QK8 A;  3CQF A;  3D21 A;  4XRD A;  3E9J B;  1AIU A;  3KP9 A;  5G5E A;  5IMC A;  1M2B A;  1TK8 B;  2E2G A;  3EVI A;  3C1S A;  2YZU A;  2BMX A;  2LJK A;  2H71 A;  2H01 A;  4EDY A;  3IA1 A;  1YKA A;  3CBU A;  2FA4 A;  4MJE A;  4GTU A;  5A4W A;  1EV4 A;  1SKR B;  2PER A;  2VL3 A;  5F07 A;  3ZRE A;  5DDL A;  4QQ7 A;  3IXR A;  2O85 A;  2GSS A;  4MF5 A;  5HFI A;  4J56 E;  1B8X A;  2IFQ A;  1M3I A;  3C8E A;  2GST A;  1Y25 A;  4GSS A;  1SJZ A;  2RLI A;  2RII A;  3RBT A;  3O76 A;  1SYX A;  5EY6 A;  2XHF A;  3ME7 A;  4Z2U A;  5D9V A;  1OKD A;  4KB3 A;  5D8I A;  1WE0 A;  2H1G A;  1USB A;  3EU4 A;  1ZOF A;  3J7Y k;  2WGR A;  3A2V A;  3F63 A;  4DSQ A;  3G7I A;  1TU7 A;  4IVF A;  4JZQ A;  1OC9 A;  2MBS A;  1K0B A;  1K3O A;  2PU9 C;  4HU9 A;  4JRR A;  3HJM A;  2VL2 C;  5J4U A;  4HJ2 A;  3TOT A;  4IP1 A;  1G0T A;  5H5R A;  1KTE A;  4DVC A;  3GA4 A;  1F37 A;  4O92 A;  3RDW A;  1XVW A;  4H86 A;  2HXK A;  3DXB A;  3LEF A;  3Q74 A;  4TR3 A;  4POL A;  1HNB A;  4LL4 B;  4KCE A;  1XIY A;  1VF1 A;  4TKY A;  4OO5 A;  4A5P A;  3ED3 A;  4WBJ A;  2L59 A;  3WYW A;  4I2U A;  5KN3 A;  1E6B A;  2X64 A;  2C3Q A;  1XOA A;  2PWJ A;  5G5F A;  4EKZ A;  2RUF A;  1XWC A;  3OR5 A;  3IC4 A;  2DLX A;  3EE2 A;  2VOC A;  2F8A A;  2H74 A;  4GF0 A;  4XTS A;  2LQQ A;  2HSY A;  2JZT A;  1XW9 A;  1YDK A;  1ZL9 A;  2H1B A;  3PR8 A;  19GS A;  3TOU A;  4I8B A;  2GS3 A;  2KP1 A;  2HSM A;  1J9B A;  1U88 A;  3W6G A;  3TKR A;  2AV4 A;  2UZ8 A;  4L5O A;  1B4P A;  3I69 A;  5ECP B;  4OWY A;  4XS6 A;  1SEN A;  1TI1 A;  5G31 A;  1PKW A;  22GS A;  2GT6 A;  3CMI A;  3LWA A;  4YAP A;  4ISD A;  1ERT A;  5D9T A;  2C80 A;  1GUL A;  5B8A A;  4MH3 A;  1EP7 A;  1V9W A;  4IQ1 A;  3K8N A;  5EVO A;  3JCM L;  3U5R E;  3VFI A;  4WR5 A;  3UJ1 A;  2C0D A;  3IDV A;  3FR3 A;  2H8L A;  2DKI A;  3DVX A;  1NSW A;  1PRX A;  2DIY A;  2O89 A;  5IMD A;  2R3X A;  1GLQ A;  5CRE A;  3P2A A;  3HDC A;  1A23 A;  2DJ1 A;  1F3B A;  4PQH A;  3EMX A;  4YAV A;  3P7X A;  5IM9 A;  1DBY A;  2ES7 A;  3UAP A;  2LTK A;  3AY8 A;  2V6O A;  4DSS B;  2LS5 A;  1Y6E A;  1KNG A;  5LNK e;  3G9B A;  1SK1 A;  4XRA A;  3F9U A;  6GSY A;  1Z3E A;  4TR4 A;  2F3M A;  1B48 A;  1DE2 A;  2K9F A;  4POM A;  5D73 A;  3RAZ A;  1FAA A;  2V41 A;  1MDI A;  2A2S A;  5CRH A;  2CZ2 A;  5F05 A;  3G7J A;  2CX4 A;  3GHA A;  3TUE A;  1WOU A;  3C7M A;  1YF0 A;  1LBK A;  5JCU A;  16GS A;  2HZE B;  5HR2 A;  1XWB A;  2VCT A;  2MMA A;  4AF2 A;  4EUY A;  4MK3 A;  1ILO A;  3BJ5 A;  5G2Z A;  2A2P A;  4LA1 A;  1S3R A;  3GIX A;  3F6F A;  1YF1 A;  5JWQ B;  1GTA A;  2FWF A;  1AQV A;  2PMT A;  4ZIJ A;  3HD5 A;  1FW1 A;  1A8Y A;  2VAF A;  5LD0 A;  1SK0 A;  3KH9 A;  3M9K A;  5HFK A;  1V58 A;  4AGS A;  1X9M B;  1GSD A;  3HJP A;  3APQ A;  4PNG A;  3VI7 A;  3ME8 A;  3QOU A;  3IAS 2;  2GZZ A;  1SYR A;  1H75 A;  2JZR A;  4KAE A;  2B7K A;  4TXV A;  3MAK A;  2A2R A;  2HI7 A;  3IK9 A;  5DBQ A;  1R7H A;  4MNN A;  3FZA A;  1OAZ A;  4NWY A;  1IYI A;  2JAC A;  1SU9 A;  4GQC A;  1XVQ A;  4DSS A;  5ENU A;  3P90 A;  3ZZX A;  3MIX A;  2E0Q A;  1O73 A;  4O5Q A;  1K3Y A;  3GKM A;  3LYK A;  5DVB A;  1A8L A;  5J3R A;  4MCU A;  2X99 A;  4V1A g;  4WF5 A;  3N5O A;  1V40 A;  4IS0 A;  3L9U A;  2JZS A;  4IEL A;  5ECK B;  1FVK A;  4XHM A;  2L4Q A;  2C3T A;  4PGT A;  4K7O A;  1SKS B;  4GWR A;  3LOR A;  1K0C A;  3I43 A;  2I81 A;  5C04 A;  2OKA A;  2HZE A;  2QA2 A;  4V2N A;  4MF7 A;  4K5S A;  5A5K A;  3GRX A;  5B6M A;  3CSI A;  5KEJ A;  4TVE A;  4LLR A;  2E7P A;  4I5Q A;  5CRD A;  1OC8 A;  1TRW A;  5KN2 A;  4HSC X;  2YOI A;  5CRG A;  1XW6 A;  2GGT A;  3M0F A;  1O81 A;  1GTI A;  1WWJ A;  1A0F A;  3G7Y A;  2ALB A;  1R4W A;  5D96 A;  1SKW B;  3NZN A;  4ID0 A;  1QXH A;  3C73 A;  4PUA A;  5BMU A;  3TKP A;  2EIQ A;  4HUA A;  6GSU A;  2CZ3 A;  2EIO A;  2L57 A;  4BVY B;  1K0M A;  2LNT A;  2GLR A;  2NDO A;  4WR4 A;  4YQU A;  2OE1 A;  5EPF A;  3UVH A;  5DAL B;  3LYP A;  4K0G A;  4HZ4 A;  2CA8 A;  1ZYP A;  2J23 A;  2IWT A;  5F8B A;  4Q5R A;  4EXJ A;  1NHY A;  2FWG A;  3ZML A;  1LU4 A;  1F3A A;  4KDY A;  1AQW A;  3J7Y b;  4MLY A;  4TR1 B;  4ZBA A;  3LSZ A;  1TRV A;  2MZC A;  3GX8 A;  1TW9 A;  1CQH A;  2PN8 A;  4Q5F A;  1R26 A;  2L6C A;  1W4V A;  20GS A;  1THX A;  2OE0 A;  1ZMA A;  2WB9 A;  1EOG A;  1A2J A;  4RQX A;  1UVZ A;  4IGJ A;  3BBY A;  1N8J A;  3LG6 A;  1HYU A;  3N9J A;  5JCW A;  4G0L A;  1VF4 A;  4JE1 A;  3M3M A;  2GZY A;  2ON5 A;  4YH2 A;  4V2M A;  1PN0 A;  5DAK B;  1M0U A;  4O5U A;  5GSS A;  18GS A;  2C0G A;  3TJG A;  5ECI B;  2V32 A;  1RK4 A;  4GST A;  3V1W A;  1ON4 A;  3QCP A;  3HYP A;  1BJX A;  1Z9H A;  3VWV A;  2DML A;  1EZK A;  2GQK A;  4MPG A;  4L0W A;  2JAD A;  2CAQ A;  2R0P A;  4POB A;  2WDU A;  4IBP A;  5ELG A;  4P3Y B;  1EP8 A;  1OYJ A;  4BVY A;  1XCC A;  1EOH A;  2YNX A;  2HFD A;  3I6A A;  4EF0 A;  4XS4 B;  2CV4 A;  1G6W A;  4N0V A;  5DAL A;  2QGV A;  4NHZ A;  4IJ3 A;  3LFL A;  3UL3 A;  4FIW A;  3O3T A;  4ZBB A;  4N10 A;  2IMD A;  1VGL A;  4MZW A;  5COH A;  4DSR A;  3D0Z A;  3GH6 A;  3TDG A;  3Q18 A;  2EIR A;  4TR1 A;  5BRT A;  2F9S A;  5HR0 A;  1T4Z A;  5IPG A;  5DJL A;  4MAB A;  5KOW A;  1JHB A;  4NAX A;  1XOB A;  1YZX A;  2H19 A;  4J2F A;  4BWQ A;  2CVD A;  2IME A;  3IBH A;  1F9M A;  4FYC A;  3BD2 A;  2OAD A;  3PGT A;  3VWX A;  2XPE A;  3QDN A;  4GQF A;  3H8Q A;  1FB6 A;  4K7N A;  3ERF A;  1GUH A;  3A5I A;  2VD0 A;  2IN3 A;  3FR9 A;  2P31 A;  4WEY A;  5FHI A;  5ECL B;  5DAK A;  3RHB A;  4OCE A;  3D4M A;  2R0C A;  3DIE A;  3H1N A;  4ECI A;  4RI6 A;  2B5E A;  4NHW A;  2I1U A;  2LEG A;  2GVP A;  4MH2 A;  11GS A;  3QAW A;  1G7E A;  2F8F A;  2IMK A;  3A2X A;  5DCH A;  2WS2 A;  1TU8 A;  4LL1 B;  3Q19 A;  2QKE A;  3EYT A;  1T8E B;  4X1U A;  1Z7P A;  3VWW A;  5L71 A;  3U6V A;  4E8H A;  4EIP A;  4FQU A;  2V1M A;  7GSS A;  3GTU B;  2GT5 A;  3IHG A;  6GSW A;  1R5A A;  5H5S A;  4MZC A;  4MA9 A;  4XS4 A;  4WF4 A;  4IP6 A;  1UC7 A;  3R3E A;  3D22 A;  1F6M C;  4O32 A;  1PX6 A;  1SK2 A;  2O87 A;  2EC4 A;  2YV7 A;  1DSB A;  3FZ9 A;  4CDO A;  1AUC A;  3EWL A;  2VIM A;  1K0O A;  1LJR A;  4WKW A;  3A2W A;  2XBQ A;  3VK9 A;  2VL2 A;  2OA7 A;  3DVW A;  3E0U A;  3MDK A;  1TXX A;  1GSY A;  4YQV A;  4D73 B;  3W8J A;  4IJI A;  4Q5Q A;  2NVL A;  2D2Z A;  1GP1 A;  4O7H A;  3QAG A;  1XFL A;  1M3J A;  1G7O A;  1X5E A;  4EO3 A;  2FUG 2;  3FY7 A;  4F0B A;  4POK A;  4BA7 A;  5ID2 A;  1U3I A;  3P8W A;  2TRC P;  2YP6 A;  2NBS A;  5GZZ B;  1W89 A;  4KSO A;  4LMW A;  3MNG A;  3TRP A;  1QQ2 A;  9GSS A;  4KDX A;  4BL7 B;  5DJM A;  3D4T A;  1PSQ A;  5A4V A; 
#chains in the Genus database with same CATH homology
 2OBI A;  2JU5 A;  3A3T A;  4I97 A;  3F3Q A;  2FY6 A;  2GSQ A;  4PQ1 A;  1BAY A;  3F4S A;  4G0K A;  2X8G A;  2R4V A;  3BCK A;  3GTU A;  3SWL A;  3TB2 A;  3FYG A;  1ST9 A;  1ZGN A;  3SBC A;  2PPT A;  1URM A;  2C4J A;  2PVO C;  3LXZ A;  5CO3 A;  3KXO A;  3ZIJ A;  1SJ6 A;  4X0X A;  2LKU A;  1O7U A;  4HU7 A;  2R5G A;  3TJK A;  1IYH A;  4CW9 A;  3CTF A;  2M80 A;  2YJ7 A;  5HQP A;  3BCI A;  5JWR B;  1MD4 A;  2J9H A;  1NHO A;  4D73 A;  1MTC A;  2VCX A;  1V57 A;  3F6D A;  1BQ7 A;  3GNJ A;  2HNL A;  3GFK A;  1TDI A;  5B6N A;  3UBL A;  2H0G A;  2PBJ A;  3M9J A;  3MYD A;  1KBN A;  2VLU A;  3ZL5 A;  2IMI A;  4G0I A;  4ZL9 A;  2PGT A;  1Q98 A;  2KOK A;  4ZXG A;  4PUR A;  4HDE A;  2YV9 A;  5AN1 A;  4RUV A;  3E3E A;  5F0G A;  2GSR A;  2GZP A;  3DYR A;  4GLT A;  1JFU A;  3TKS E;  5KN0 A;  3M1G A;  1XBS A;  2FWE A;  4BWS A;  3FHK A;  5IMA A;  1XWK A;  2XBI A;  1GTU A;  4GSN A;  5IMF A;  4RQR A;  1FOV A;  1VF2 A;  4BL7 A;  3FR6 A;  4MF6 A;  2CQ9 A;  2YCD A;  4OD7 A;  1Q4J A;  2DJJ A;  1PKZ A;  2PUK C;  1X5D A;  3DRN A;  2L5O A;  5LCZ A;  3DML A;  4KA0 A;  1GSS A;  4IKH A;  3ZIT A;  2I3Y A;  4K5R A;  5D9W A;  1ZYE A;  4WET A;  4HS1 A;  4NV2 A;  1ACV A;  4PX1 A;  4ZB8 A;  3WGX A;  2WCI A;  2H0H A;  1PX7 A;  4QL9 A;  1Z6N A;  1TTZ A;  1K0N A;  5CP1 A;  1S3D A;  12GS A;  1BG5 A;  1Z6M A;  2YZH A;  5CAX A;  2H66 A;  1PQN A;  4RI7 A;  1GWC A;  1JZW A;  2VM1 A;  2C3N A;  3ZMK A;  4EC0 A;  2FA8 A;  4K0N A;  6GST A;  5A4U A;  1EEJ A;  1OVN A;  5B7C A;  1JLV A;  2M66 A;  2VUP A;  2VL9 A;  4K9Z A;  3ZYW A;  3BOA A;  3M8N A;  1OE7 A;  1M2D A;  4YQM A;  1X0R A;  1XXU A;  4L5L A;  1OE8 A;  4ULX A;  4ECB A;  4F82 A;  1X9S B;  2E2M A;  3QFA C;  4G9H A;  5ELA A;  2C0E A;  1ZCP A;  1SL1 B;  2DJK A;  3KP8 A;  1WMJ A;  1E2Y A;  1TRU A;  2YAN A;  3DGQ A;  5CRW A;  5GAN D;  2MYG A;  1TP9 A;  3H4K A;  2GQM A;  4N30 A;  2LQO A;  1T1V A;  4TR0 A;  5DCG A;  4JR6 A;  2OE3 A;  2L5L A;  2B6M A;  2AB6 A;  2MBT A;  3US3 A;  2HLS A;  2LRT A;  2VM2 A;  3TCO A;  4Z2T A;  2L4C A;  3ERG A;  2IIY A;  4E8E A;  2B5X A;  3HY2 A;  4EDZ A;  4GXZ A;  3TJB A;  1YKC A;  3CSJ A;  2LUS A;  3EPT A;  1ZYQ B;  4DEJ A;  3MSZ A;  3PH9 A;  4L8E A;  1MDK A;  1Z7R A;  4OFN A;  2DJ0 A;  2YWI A;  2BJX A;  3ZVJ A;  4ECJ A;  4MJA A;  3R2Q A;  2AYT A;  3LJR A;  1T4Y A;  1GUM A;  2FCH A;  3ISO A;  5E4W A;  5IIZ A;  2R37 A;  2B7J A;  4TRX A;  1A2L A;  1TI3 A;  3KMN A;  2HE3 A;  1K3L A;  4TOP A;  1GTB A;  5ABR A;  1PL1 A;  3QAV A;  5HFG A;  5ECQ B;  4MPF A;  4ML1 A;  3EU3 A;  1O8X A;  3KM6 A;  4OFT A;  3CRU A;  4TXO B;  3F8U A;  1WRY A;  3KTB A;  4OO4 A;  5AGY A;  5FWG A;  1MDJ A;  1V98 A;  3L9V A;  4G2E A;  2VLT A;  2HRK A;  2B1K A;  3DD3 A;  3PPU A;  1SD8 A;  1T3B A;  1ZZY A;  5ECR B;  1S3C A;  5J5N A;  2H76 A;  3ZFB A;  4EVM A;  2DMM A;  3H93 A;  3GL5 A;  4HEA 2;  3TKS C;  4JU5 A;  3VI5 A;  5JWO B;  1T00 A;  4KH7 A;  4CHS A;  3GH9 A;  1FOH A;  4OFM A;  4F2I A;  3TKQ A;  2HT9 A;  3S9F A;  1KEB A;  2R2J A;  2N5B A;  2YJH A;  2WUL A;  2M46 A;  1HQO A;  3QFB C;  2DBC A;  3KCM A;  3UIW A;  1JZD A;  3HJO A;  5IMV A;  3VUR A;  1CQG A;  3VWU A;  3O6T A;  2MMZ A;  1J0F A;  2XPD A;  3HHV A;  1PN9 A;  2P0G A;  4FH8 A;  2G2Q A;  4NMU A;  1M9A A;  3DKS A;  4L0U A;  17GS A;  4ICY A;  2YWN A;  4G10 A;  1M9B A;  2G0F A;  1EGR A;  2C1Y A;  4V2L A;  1QMV A;  1TRS A;  3FMW A;  2VD1 A;  2QA1 A;  2OJL A;  4O5R A;  2CAI A;  4PTS A;  1XWA A;  3HZ4 A;  1FB0 A;  5D93 A;  4TXO A;  2O7K A;  3A5W A;  4Z2R A;  2GQL A;  1HD2 A;  4CY8 A;  3ZVJ D;  4MP4 A;  5ID2 B;  3EUR A;  2HSH A;  2N5A A;  4K6X A;  4MZB A;  8GSS A;  4PNF A;  2H72 A;  4F0C A;  2DJ2 A;  1O8W A;  2IJY A;  5FT3 A;  1A0R P;  1J08 A;  6GSS A;  2WJU A;  3RPP A;  3GKN A;  4KF9 A;  1PL2 A;  1B9Y C;  3PIN A;  2H70 A;  4ACS A;  2X8C A;  3GST A;  3KGK A;  2V6K A;  1SL0 B;  4ZL7 A;  1RW1 A;  4BVX B;  1K0D A;  3WT1 A;  5ECO B;  2KHP A;  5ECN B;  2AHE A;  2ZNM A;  1PGT A;  2K8V A;  1FVJ A;  2HRA A;  3EMP A;  4K7I A;  2NTO A;  4ILF A;  2NPB A;  5KN1 A;  1GL8 A;  3GUS A;  3FRC A;  1GH2 A;  3HZ8 A;  3L4N A;  4OCF A;  3ZIV A;  1QUW A;  4OMV A;  1G6Y A;  4LMV A;  1YJ6 A;  2YWO A;  3LW9 A;  2LV3 A;  4KX4 A;  3UOM A;  1YY7 A;  4Q5N A;  5CNW A;  6GSX A;  5AIX A;  1AW9 A;  3KIJ A;  2QSI A;  1I5G A;  2LST A;  3KTL A;  3TRX A;  1O85 A;  2HYX A;  4PUF C;  1GUK A;  5G1L A;  5H5Q A;  2CVB A;  2OAC A;  2KLX A;  1QGV A;  1ZYN A;  3DWV A;  1EEM A;  5JCG A;  3UAR A;  3UEM A;  3VLN A;  4I2T A;  2X8H A;  2HRF A;  4KND A;  1PMT A;  2FNO A;  2R0G A;  4ML6 A;  2VCW A;  1FO5 A;  3GN3 A;  2ZUP A;  2K6V A;  1FG4 A;  1MD3 A;  3CRT A;  2IMF A;  5J9C A;  4KGI A;  2I9H A;  2A4H A;  2M72 A;  3HA9 A;  2V2G A;  5IO2 A;  2QC7 A;  3APO A;  6GSV A;  3VPQ A;  4HI7 A;  1JZO A;  4NPB A;  1PD2 1;  4BVX A;  3C71 A;  2K18 A;  2DKH A;  4JR4 A;  5HR3 A;  4IW9 A;  1XWG A;  2X49 A;  5INY A;  4X43 A;  1O6J A;  2FGX A;  3HCZ A;  4F03 A;  1JZR A;  3HKR A;  1MEK A;  4TN8 A;  4AJ6 A;  3QD9 A;  2KP2 A;  4NXI A;  4Z7X A;  1HNC A;  2O8V B;  4HJM A;  3KEB A;  1ML6 A;  2YN1 A;  1THO A;  3VPT A;  3F0I A;  1TKD B;  1H4O A;  1ERW A;  4K1F A;  1A2M A;  4ZBD A;  3IK7 A;  4GCI A;  2VLV A;  1WJK A;  14GS A;  2C8U A;  2B1L A;  1GSF A;  1TOF A;  3FK8 A;  5J9B A;  3I9V 2;  3L78 A;  1YEP A;  1ERV A;  4AJ7 A;  4QL7 A;  1EGO A;  2B3S A;  3IOS A;  2CT6 A;  1XZO A;  1EWX A;  1AAZ A;  4WXT A;  3GV1 A;  1SJI A;  2DC5 A;  1GNE A;  2L6D A;  2DIZ A;  5IO0 A;  2AAW A;  3LQ7 A;  1VF3 A;  2H1D A;  4BPY A;  3HVS A;  1K0A A;  5DQS A;  4JED A;  2VCV A;  2H6X A;  3FW2 A;  3APS A;  3KD0 A;  3QR6 A;  4MDC A;  4N0Z A;  2KUC A;  3L9S A;  2LNS A;  1YEX A;  2RM6 A;  3W8S A;  3MWH A;  4PXO A;  1X9W B;  2BTO T;  1U87 A;  4V1A p;  2MMN A;  5HR1 A;  2LRN A;  3HVX A;  2JSY A;  1UA5 A;  2B5Y A;  4CY6 A;  2CX3 A;  1UN2 A;  2TIR A;  1QFN A;  1AC1 A;  4AJ8 A;  3GKK A;  1U3A A;  4YKF A;  2CVK A;  3KMO A;  1TJD A;  1A24 A;  3FKF A;  3C1R A;  2C0F A;  1SD9 A;  5F06 A;  2LJA A;  1C72 A;  4USS A;  4EIQ A;  3GMF A;  1F2E A;  3UVT A;  2H6Y A;  3IR4 A;  1V2A A;  4EL1 A;  3HVV A;  4TW5 A;  2DSA A;  3RHC A;  1R5P A;  3Q6O A;  1S3A A;  3FZ5 A;  4KSM A;  2FWH A;  4MMM A;  5B8B A;  1B9X C;  1WPI A;  1TK0 B;  4FYB A;  1X5C A;  3IE3 A;  1ERU A;  1G7D A;  1GNW A;  1FHE A;  4KCA A;  1XW5 A;  5ECS A;  2IL3 A;  2FHE A;  3NOF A;  1ABA A;  1WIK A;  2H1A A;  3ZRD A;  3EC3 A;  4MJC A;  3RPN A;  2F51 A;  2WFC A;  3CTG A;  3TJF A;  4F9Z A;  2XC2 A;  1SL2 B;  10GS A;  4HZ2 A;  2VCQ A;  4WBR D;  1DUG A;  4PQI A;  2H75 A;  4K2X A;  2HZF A;  4HOJ A;  3F3R A;  1OC3 A;  1AQX A;  4K8M A;  1GSE A;  4X4J A;  3L0H A;  2ZCT A;  2R6K A;  3IRA A;  3D6I A;  5ECH B;  4FYU A;  5E59 A;  1GRX A;  1RQM A;  3TJJ A;  1I9D A;  2WRT A;  3ERW A;  5CYY A;  4HQZ A;  3TGZ A;  3FZ4 A;  4XS1 A;  1PA3 A;  2FLS A;  2WZ9 A;  1XPV A;  1NM3 A;  1BYE A;  1Z5Y E;  1WP0 A;  3CSH A;  5ECM B;  1TK5 B;  3GYK A;  3NIV A;  5IOW A;  4KE3 A;  13GS A;  5AIS A;  4IQA A;  5IPH A;  3IC8 A;  4JBB A;  1M2A A;  3GSS A;  3FEU A;  2RUE A;  3CYN A;  4KDU A;  4J57 E;  2REM A;  2LRC A;  3KZQ A;  2N5F A;  1NW2 A;  1OKT A;  5IMZ A;  2JSZ A;  2ON7 A;  3WGE A;  2P5Q A;  3UBK A;  3QMX A;  3WD6 A;  4YKG A;  4KUN A;  5GST A;  3ZTL A;  3GL3 A;  5DQY A;  4ECC A;  2DJ3 A;  4KW6 A;  2LJR A;  3GX0 A;  3LGC A;  1HNA A;  1GSU A;  1U6T A;  4K2D A;  1YQ1 A;  2H30 A;  1M99 A;  4XIH A;  5IQY A;  3QPM A;  2H6Z A;  3F4T A;  2YPM A;  5C00 A;  2OBK A;  3TRQ A;  2H73 A;  3UMA A;  3HXS A;  3ZFL A;  2AJQ B;  2PVQ A;  2VCZ A;  3KJY A;  2IFQ B;  3IV4 A;  2I4A A;  4NV5 A;  2AUV A;  4MJB A;  4ZIL A;  5AIV A;  2H0I A;  5J41 A;  2HRN A;  3ZLP A;  4XCS A;  1GSQ A;  5IOX A;  3IHQ A;  4ZB6 A;  3TKS A;  3LXT A;  2VO4 A;  3GUR A;  4I6X A;  2Z9S A;  5D9X A;  1DE1 A;  2K8S A;  3EIN A;  2IPA A;  3F4R A;  2X4A A;  1BED A;  3GKX A;  2YWM A;  4ZB9 A;  2GDR A;  3IAM 2;  3WGD A;  3KH7 A;  1T7P B;  4N11 A;  5G1K A;  2TRX A;  4EE0 A;  1OC9 B;  2RM5 A;  2MMO A;  1GLP A;  3IPZ A;  1AXD A;  1EV9 A;  2P5R A;  2FD3 A;  3D5J A;  4IHU A;  5G30 A;  3WT2 A;  3CXG A;  2A4V A;  4G19 A;  5KOX A;  3DEX A;  1VRS D;  4GRF A;  4FO5 A;  3H79 A;  5EL8 A;  2JL4 A;  4IN0 A;  1M7T A;  1JLW A;  4HQS A;  5GAP D;  1BX9 A;  2GTU A;  1B4Q A;  1N2A A;  4ZL8 A;  1QK8 A;  3D21 A;  4XRD A;  3E9J B;  1AIU A;  3KP9 A;  5G5E A;  5IMC A;  1M2B A;  1TK8 B;  2E2G A;  3EVI A;  3C1S A;  2YZU A;  2BMX A;  2LJK A;  2H71 A;  2H01 A;  4EDY A;  3IA1 A;  1YKA A;  3CBU A;  2FA4 A;  4MJE A;  4GTU A;  5A4W A;  1EV4 A;  1SKR B;  2PER A;  2VL3 A;  5F07 A;  3ZRE A;  5DDL A;  4QQ7 A;  3IXR A;  2O85 A;  2GSS A;  4MF5 A;  5HFI A;  4J56 E;  1B8X A;  2IFQ A;  3C8E A;  2GST A;  1Y25 A;  4GSS A;  1SJZ A;  2RLI A;  2RII A;  3RBT A;  3O76 A;  1SYX A;  5EY6 A;  2XHF A;  3ME7 A;  4Z2U A;  5D9V A;  1OKD A;  4KB3 A;  5D8I A;  1WE0 A;  2H1G A;  1USB A;  3EU4 A;  1ZOF A;  3J7Y k;  2WGR A;  3A2V A;  3F63 A;  4DSQ A;  3G7I A;  1TU7 A;  4IVF A;  4JZQ A;  1OC9 A;  2MBS A;  1K0B A;  1K3O A;  2PU9 C;  4HU9 A;  4JRR A;  3HJM A;  2VL2 C;  5J4U A;  4HJ2 A;  3TOT A;  4IP1 A;  1G0T A;  5H5R A;  1KTE A;  4DVC A;  3GA4 A;  1F37 A;  4O92 A;  3RDW A;  1XVW A;  4H86 A;  2HXK A;  3DXB A;  3LEF A;  3Q74 A;  4TR3 A;  4POL A;  1HNB A;  4LL4 B;  4KCE A;  1XIY A;  1VF1 A;  4TKY A;  4OO5 A;  4A5P A;  3ED3 A;  4WBJ A;  2L59 A;  3WYW A;  4I2U A;  5KN3 A;  1E6B A;  2X64 A;  2C3Q A;  1XOA A;  2PWJ A;  5G5F A;  4EKZ A;  2RUF A;  1XWC A;  3OR5 A;  3IC4 A;  2DLX A;  3EE2 A;  2VOC A;  2F8A A;  2H74 A;  4GF0 A;  4XTS A;  2LQQ A;  2HSY A;  2JZT A;  1XW9 A;  1YDK A;  1ZL9 A;  2H1B A;  3PR8 A;  19GS A;  3TOU A;  4I8B A;  2GS3 A;  2KP1 A;  2HSM A;  1J9B A;  1U88 A;  3W6G A;  3TKR A;  2AV4 A;  2UZ8 A;  4L5O A;  1B4P A;  3I69 A;  5ECP B;  4OWY A;  4XS6 A;  1SEN A;  1TI1 A;  5G31 A;  1PKW A;  22GS A;  2GT6 A;  3CMI A;  3LWA A;  4YAP A;  4ISD A;  1ERT A;  5D9T A;  2C80 A;  1GUL A;  5B8A A;  4MH3 A;  1EP7 A;  1V9W A;  4IQ1 A;  3K8N A;  5EVO A;  3JCM L;  3U5R E;  3VFI A;  4WR5 A;  3UJ1 A;  2C0D A;  3IDV A;  3FR3 A;  2H8L A;  2DKI A;  3DVX A;  1NSW A;  1PRX A;  2DIY A;  2O89 A;  5IMD A;  2R3X A;  1GLQ A;  5CRE A;  3P2A A;  3HDC A;  1A23 A;  2DJ1 A;  1F3B A;  4PQH A;  3EMX A;  4YAV A;  3P7X A;  5IM9 A;  1DBY A;  2ES7 A;  3UAP A;  2LTK A;  3AY8 A;  2V6O A;  4DSS B;  2LS5 A;  1Y6E A;  1KNG A;  5LNK e;  3G9B A;  1SK1 A;  4XRA A;  3F9U A;  6GSY A;  1Z3E A;  4TR4 A;  2F3M A;  1B48 A;  1DE2 A;  2K9F A;  4POM A;  5D73 A;  3RAZ A;  1FAA A;  2V41 A;  1MDI A;  2A2S A;  5CRH A;  2CZ2 A;  5F05 A;  3G7J A;  2CX4 A;  3GHA A;  3TUE A;  1WOU A;  3C7M A;  1YF0 A;  1LBK A;  5JCU A;  16GS A;  2HZE B;  5HR2 A;  1XWB A;  2VCT A;  2MMA A;  4AF2 A;  4EUY A;  4MK3 A;  1ILO A;  3BJ5 A;  5G2Z A;  2A2P A;  4LA1 A;  3GIX A;  3F6F A;  1YF1 A;  5JWQ B;  1GTA A;  2FWF A;  1AQV A;  2PMT A;  4ZIJ A;  3HD5 A;  1FW1 A;  1A8Y A;  2VAF A;  5LD0 A;  1SK0 A;  3KH9 A;  3M9K A;  5HFK A;  1V58 A;  4AGS A;  1X9M B;  1GSD A;  3HJP A;  3APQ A;  4PNG A;  3VI7 A;  3ME8 A;  3QOU A;  3IAS 2;  2GZZ A;  1SYR A;  1H75 A;  2JZR A;  4KAE A;  2B7K A;  4TXV A;  3MAK A;  2A2R A;  2HI7 A;  3IK9 A;  5DBQ A;  1R7H A;  4MNN A;  3FZA A;  1OAZ A;  4NWY A;  1IYI A;  2JAC A;  1SU9 A;  4GQC A;  1XVQ A;  4DSS A;  5ENU A;  3P90 A;  3ZZX A;  3MIX A;  2E0Q A;  1O73 A;  4O5Q A;  1K3Y A;  3GKM A;  3LYK A;  5DVB A;  1A8L A;  5J3R A;  4MCU A;  2X99 A;  4V1A g;  4WF5 A;  3N5O A;  1V40 A;  4IS0 A;  3L9U A;  2JZS A;  4IEL A;  5ECK B;  1FVK A;  4XHM A;  2L4Q A;  2C3T A;  4PGT A;  4K7O A;  1SKS B;  4GWR A;  3LOR A;  1K0C A;  3I43 A;  2I81 A;  5C04 A;  2OKA A;  2HZE A;  2QA2 A;  4V2N A;  4MF7 A;  4K5S A;  5A5K A;  3GRX A;  5B6M A;  3CSI A;  5KEJ A;  4TVE A;  4LLR A;  2E7P A;  4I5Q A;  5CRD A;  1OC8 A;  1TRW A;  5KN2 A;  2YOI A;  5CRG A;  1XW6 A;  2GGT A;  3M0F A;  1O81 A;  1GTI A;  1WWJ A;  1A0F A;  3G7Y A;  2ALB A;  1R4W A;  5D96 A;  1SKW B;  3NZN A;  4ID0 A;  1QXH A;  3C73 A;  4PUA A;  5BMU A;  3TKP A;  2EIQ A;  4HUA A;  6GSU A;  2CZ3 A;  2EIO A;  2L57 A;  4BVY B;  1K0M A;  2LNT A;  2GLR A;  2NDO A;  4WR4 A;  4YQU A;  2OE1 A;  5EPF A;  3UVH A;  5DAL B;  3LYP A;  4K0G A;  4HZ4 A;  2CA8 A;  1ZYP A;  2J23 A;  2IWT A;  5F8B A;  4Q5R A;  4EXJ A;  1NHY A;  2FWG A;  3ZML A;  1LU4 A;  1F3A A;  4KDY A;  1AQW A;  3J7Y b;  4MLY A;  4TR1 B;  4ZBA A;  3LSZ A;  1TRV A;  2MZC A;  3GX8 A;  1TW9 A;  1CQH A;  2PN8 A;  4Q5F A;  1R26 A;  2L6C A;  1W4V A;  20GS A;  1THX A;  2OE0 A;  1ZMA A;  2WB9 A;  1EOG A;  1A2J A;  4RQX A;  1UVZ A;  4IGJ A;  3BBY A;  1N8J A;  3LG6 A;  1HYU A;  3N9J A;  5JCW A;  4G0L A;  1VF4 A;  4JE1 A;  3M3M A;  2GZY A;  2ON5 A;  4YH2 A;  4V2M A;  1PN0 A;  5DAK B;  1M0U A;  4O5U A;  5GSS A;  18GS A;  2C0G A;  3TJG A;  5ECI B;  2V32 A;  1RK4 A;  4GST A;  3V1W A;  1ON4 A;  3QCP A;  3HYP A;  1BJX A;  1Z9H A;  3VWV A;  2DML A;  1EZK A;  2GQK A;  4MPG A;  4L0W A;  2JAD A;  2CAQ A;  2R0P A;  4POB A;  2WDU A;  4IBP A;  5ELG A;  4P3Y B;  1EP8 A;  1OYJ A;  4BVY A;  1XCC A;  1EOH A;  2YNX A;  2HFD A;  3I6A A;  4EF0 A;  4XS4 B;  2CV4 A;  1G6W A;  4N0V A;  5DAL A;  2QGV A;  4NHZ A;  4IJ3 A;  3LFL A;  3UL3 A;  4FIW A;  3O3T A;  4ZBB A;  4N10 A;  2IMD A;  1VGL A;  4MZW A;  5COH A;  4DSR A;  3D0Z A;  3GH6 A;  3TDG A;  3Q18 A;  2EIR A;  4TR1 A;  5BRT A;  2F9S A;  5HR0 A;  1T4Z A;  5IPG A;  5DJL A;  4MAB A;  5KOW A;  1JHB A;  4NAX A;  1XOB A;  1YZX A;  2H19 A;  4J2F A;  4BWQ A;  2CVD A;  2IME A;  3IBH A;  1F9M A;  4FYC A;  3BD2 A;  2OAD A;  3PGT A;  3VWX A;  2XPE A;  3QDN A;  4GQF A;  3H8Q A;  1FB6 A;  4K7N A;  3ERF A;  1GUH A;  3A5I A;  2VD0 A;  2IN3 A;  3FR9 A;  2P31 A;  4WEY A;  5FHI A;  5ECL B;  5DAK A;  3RHB A;  4OCE A;  3D4M A;  2R0C A;  3DIE A;  3H1N A;  4ECI A;  4RI6 A;  2B5E A;  4NHW A;  2I1U A;  2LEG A;  2GVP A;  4MH2 A;  11GS A;  3QAW A;  1G7E A;  2F8F A;  2IMK A;  3A2X A;  5DCH A;  2WS2 A;  1TU8 A;  4LL1 B;  3Q19 A;  2QKE A;  3EYT A;  1T8E B;  4X1U A;  1Z7P A;  3VWW A;  5L71 A;  3U6V A;  4E8H A;  4EIP A;  4FQU A;  2V1M A;  7GSS A;  3GTU B;  2GT5 A;  3IHG A;  6GSW A;  1R5A A;  5H5S A;  4MZC A;  4MA9 A;  4XS4 A;  4WF4 A;  4IP6 A;  1UC7 A;  3R3E A;  3D22 A;  1F6M C;  4O32 A;  1PX6 A;  1SK2 A;  2O87 A;  2EC4 A;  2YV7 A;  1DSB A;  3FZ9 A;  4CDO A;  1AUC A;  3EWL A;  2VIM A;  1K0O A;  1LJR A;  4WKW A;  3A2W A;  2XBQ A;  3VK9 A;  2VL2 A;  2OA7 A;  3DVW A;  3E0U A;  3MDK A;  1TXX A;  1GSY A;  4YQV A;  4D73 B;  3W8J A;  4IJI A;  4Q5Q A;  2NVL A;  2D2Z A;  1GP1 A;  4O7H A;  3QAG A;  1XFL A;  1G7O A;  1X5E A;  4EO3 A;  2FUG 2;  3FY7 A;  4F0B A;  4POK A;  4BA7 A;  5ID2 A;  1U3I A;  3P8W A;  2TRC P;  2YP6 A;  2NBS A;  5GZZ B;  1W89 A;  4KSO A;  4LMW A;  3MNG A;  3TRP A;  1QQ2 A;  9GSS A;  4KDX A;  4BL7 B;  5DJM A;  3D4T A;  1PSQ A;  5A4V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...