1OVNA

Crystal structure and functional analysis of drosophila wind-- a pdi-related protein
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
229
structure length
229
Chain Sequence
CTGCVDLDELSFEKTVERFPYSVVKFDIAYPYGEKHEAFTAFSKSAHKATKDLLIATVGVKDYGELENKALGDRYKVDDKNFPSIFLFKGNADEYVQLPSHVDVTLDNLKAFVSANTPLYIGRDGCIKEFNEVLKNYANIPDAEQLKLIEKLQAKQEQLTDPEQQQNARAYLIYMRKIHEVGYDFLEEETKRLLRLKAGKVTEAKKEELLRKLNILEVFRVHKVTKTAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Windbeutel
publication title Crystal structure and functional analysis of Drosophila Wind, a protein-disulfide isomerase-related protein.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Chaperone
total genus 76
structure length 229
sequence length 229
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07749 ERp29 Endoplasmic reticulum protein ERp29, C-terminal domain
A PF07912 ERp29_N ERp29, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1150.12 Mainly Alpha Up-down Bundle Endoplasmic reticulum protein erp29 Endoplasmic reticulum resident protein 29, C-terminal domain 1ovnA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1ovnA01
1HD2A 1JHBA 1GTUA 4X43A 1ST9A 2LUSA 3HZ4A 5CYYA 4O32A 4PX1A 2CT6A 1SJIA 3KZQA 4QL7A 5CO3A 2E0QA 1XPVA 2K18A 2XBQA 3C71A 2HE3A 5GSTA 4OCFA 1TOFA 4ZBBA 4GSSA 2WJUA 12GSA 2DJKA 3KH7A 1FO5A 3G7YA 2LRCA 3DWVA 3F4RA 1K0OA 1JLVA 5DDLA 2HZEB 4JU5A 5LNKe 1M2DA 2HZFA 5IO2A 2H8LA 1WE0A 2OE0A 3IR4A 1RW1A 4EL1A 4BA7A 3L0HA 3ZVJA 1WP0A 4V2MA 2PU9C 3HJOA 1PGTA 3GH9A 1PKWA 1SK0A 3VPTA 4IJIA 2K8VA 4I8BA 2F51A 2C0DA 1AQWA 2I3YA 5ECOB 5G5FA 2H6XA 3HYPA 5J3RA 5DQSA 3R2QA 1FW1A 1YEPA 3DXBA 2MMNA 1Z3EA 1T8EB 3EU4A 3GN3A 2CA8A 2C0EA 3GNJA 1NM3A 3IAM2 1YDKA 1PKZA 2HYXA 1AXDA 5CRGA 22GSA 2HSYA 2WZ9A 1GUHA 1SK2A 1X5DA 1ZYEA 4GQCA 1A2LA 4TR1B 3CTFA 2WB9A 4GTUA 4Q5QA 1DBYA 2VL3A 1XW9A 2E2GA 1GSUA 1X5EA 3TRXA 2DSAA 16GSA 5DBQA 1GSDA 2YWIA 3KP8A 3ZMLA 2IFQA 2OJLA 1JLWA 3M9KA 5J4UA 3DKSA 1A0RP 1NW2A 2H6YA 2REMA 3AY8A 5HR2A 4ECIA 2FCHA 2GZZA 1K3YA 4JR4A 3TKPA 4YQUA 3HJMA 3FK8A 1XWKA 3CYNA 3EU3A 1SD8A 3LXTA 1PL2A 3GURA 3IPZA 4LMVA 2H74A 4EVMA 4PGTA 3IOSA 4KUNA 2YZHA 2LJRA 4ZBAA 4AF2A 4YH2A 1O8XA 2DJ0A 1ERWA 1F2EA 1XOAA 2K8SA 3ZFBA 3APQA 2VCQA 3DYRA 3GSTA 3IHQA 4JR6A 5CREA 1VF1A 4MJBA 2NVLA 3GTUB 1KBNA 4EO3A 2VD1A 3IDVA 2FY6A 1SU9A 1VF3A 3F3QA 3KH9A 2VCXA 5IIZA 3GIXA 5COHA 3ISOA 3ERGA 2HLSA 3DGQA 5D9XA 5J5NA 3FZ4A 4YAVA 3FY7A 5F05A 3LFLA 2LS5A 5ELGA 4X0XA 2C0FA 1V98A 3ZIJA 1ERUA 5IMZA 1SJZA 4GWRA 4N0ZA 4WR5A 5IMDA 4N11A 4ECBA 4HQSA 4BVXA 1JZOA 4L0WA 5H5RA 2FNOA 5IQYA 2VLVA 2HNLA 4POKA 3NOFA 5CRHA 2IL3A 3KTLA 4TW5A 4EE0A 3LWAA 2LRNA 5E59A 4ZILA 3TCOA 4DSRA 1G6WA 4LL4B 4MH2A 1N2AA 5HFGA 3N9JA 1GSSA 3W8JA 1ML6A 1Y6EA 5J41A 3KEBA 2YJ7A 5F06A 4KNDA 3LXZA 5B8BA 2GGTA 1ZOFA 5DAKA 4K2DA 5HR0A 2NBSA 4WETA 2FWFA 1JFUA 3BBYA 2N5BA 2Z9SA 3O6TA 1EOHA 2K6VA 2H75A 3IC4A 3CTGA 1JZWA 2ZCTA 4L0UA 4TRXA 5HFKA 4KB3A 3H1NA 1BYEA 4YQVA 2I1UA 5B8AA 1H75A 1KTEA 3TJGA 2VCTA 4XCSA 5D73A 4LLRA 1R4WA 2M66A 4PQ1A 2GT5A 3FRCA 4JBBA 4WXTA 2G2QA 1ACVA 3JCML 3GTUA 4J56E 4ISDA 3CSHA 5B7CA 3RAZA 5IMAA 17GSA 2BMXA 1X0RA 3MSZA 1BEDA 2PGTA 1SJ6A 3H93A 4G19A 2P0GA 6GSSA 4JZQA 1K3LA 3QAWA 2IMEA 1DE2A 1B48A 1LBKA 2PUKC 4K0NA 4G10A 5G5EA 1GP1A 3HVVA 1TW9A 3S9FA 1ZYQB 2O89A 3F63A 3TOUA 2H1AA 5A4VA 4PQHA 5C00A 3ZRDA 2V1MA 3C73A 3GHAA 2F8FA 3D5JA 3EURA 2LNTA 4ZL8A 3EE2A 4KDUA 3APSA 3CBUA 4IGJA 2L59A 5FT3A 3Q19A 2C8UA 2ALBA 3F6DA 2TRCP 1GTBA 4BWSA 2P5RA 4ULXA 1OKTA 2H0IA 2H19A 2OA7A 1OC9A 3GL5A 4EUYA 1K0DA 3MAKA 2H66A 3GKXA 2VOCA 1GL8A 5ECSA 1TK5B 2M72A 1R5PA 4V1Ag 1FHEA 3TRQA 3UAPA 3BD2A 2O7KA 2VAFA 2VLUA 1QQ2A 2A2RA 2A4VA 3QAVA 1T4YA 2C3QA 4F0CA 2DJJA 2ON5A 1B8XA 2X8GA 3D22A 2OE3A 4RI7A 3O3TA 1UA5A 3PR8A 2OACA 4JRRA 2JACA 4ILFA 1SL1B 4RQXA 1PD21 4O92A 3HDCA 3LSZA 1A23A 5ECHB 1AC1A 1Z9HA 3KP9A 4DEJA 1MDIA 1K0NA 5HQPA 1U87A 2C80A 4GSTA 3LYPA 1V2AA 2J9HA 1USBA 1K0MA 1XWAA 4XHMA 1V57A 1YJ6A 3M3MA 9GSSA 4XRDA 2GVPA 1T1VA 5CP1A 5IO0A 2B5EA 3W8SA 6GSWA 1FVKA 1ERTA 1VF4A 3ERWA 2VL2C 1F6MC 2R2JA 1YY7A 1M9BA 5LD0A 1AQXA 1SD9A 3IK7A 3HVXA 1X9MB 5G30A 2AB6A 1TI1A 1O73A 1OE7A 4GCIA 6GSXA 4OD7A 2CAIA 1E2YA 1Z6MA 3APOA 4OO5A 1R7HA 3FZ9A 2C3TA 1MDJA 2O85A 2WDUA 1G6YA 4ECCA 4BVYA 2EC4A 2MYGA 2B7KA 2B1LA 1QFNA 5D9VA 3WGDA 2P31A 6GSUA 3G7JA 3ZFLA 4CW9A 1NHOA 3IRAA 5ENUA 3QOUA 2FGXA 3HY2A 3L9VA 5AIVA 4LL1B 4PUFC 4V2LA 5GAND 2HXKA 5DVBA 4IQAA 1K0CA 3ME7A 1WRYA 4QQ7A 1TU8A 4TOPA 4OCEA 3BCIA 2GQLA 3GH6A 2C1YA 1JZDA 4KCEA 3QFBC 5D93A 1YQ1A 5G1LA 2HRNA 3EWLA 5IM9A 1FVJA 3ZREA 5IMFA 1O6JA 3HXSA 3UOMA 2FUG2 3RPNA 2R6KA 3BCKA 2M46A 1K0AA 3KTBA 1EOGA 5DJMA 3IBHA 1V9WA 1YKAA 2DBCA 2YZUA 3TB2A 2O8VB 3TGZA 3QDNA 4PUAA 3TUEA 2L5LA 5C04A 5F07A 3I9V2 4L5LA 4TVEA 3EVIA 1K3OA 3CXGA 2YWNA 4TXOA 1G7DA 2L4CA 3L9UA 4OFTA 3TKRA 4BPYA 3J7Yb 2BJXA 2WFCA 1F3BA 4IW9A 4JEDA 4ZB6A 1ABAA 4MH3A 2EIOA 5ECIB 2H01A 1EV9A 1DE1A 5EY6A 1QXHA 3UL3A 1OVNA 2KHPA 5JWOB 4MPFA 1M9AA 1A2MA 2LQQA 4K9ZA 1HNCA 2IIYA 1X9SB 1A8YA 4HZ2A 2YANA 1PA3A 1AAZA 3HHVA 1O8WA 5D9WA 1NHYA 4N30A 4G9HA 4GQFA 4K8MA 5DALB 3LGCA 2H73A 2KP2A 3SWLA 2IWTA 1AIUA 5CAXA 1URMA 3F4TA 2MMAA 2DIZA 2VLTA 4K7NA 6GSVA 2I9HA 4RQRA 4ZB8A 3RDWA 1SL0B 3QD9A 4HEA2 1AW9A 1ZZYA 2PMTA 1MD3A 1SL2B 4WBRD 5LCZA 3WGEA 1EZKA 4XIHA 1GTAA 2C0GA 1XCCA 3A2VA 4O5RA 1GSEA 1T4ZA 3D0ZA 4HI7A 4HU9A 2RUFA 1PX7A 1S3DA 2H0HA 5A5KA 2FD3A 2GZYA 4KE3A 2H1DA 2R37A 14GSA 4KH7A 2CV4A 1ZGNA 3EYTA 3IK9A 3BOAA 2OBKA 4MCUA 2HZEA 1QK8A 1XIYA 4NHZA 1J0FA 4MDCA 2MMZA 5AIXA 4TKYA 1V58A 2VL2A 4F82A 1BJXA 1PL1A 5IMVA 1WIKA 2G0FA 2EIRA 2WGRA 4KSMA 4L5OA 2I81A 5IPGA 6GSTA 4MJEA 5KN2A 1GLQA 4NWYA 4IKHA 1S3CA 4FYBA 2RUEA 3TOTA 3DRNA 3QR6A 4J57E 4K7OA 2F8AA 1AQVA 1A0FA 1M99A 4MK3A 1C72A 2LNSA 2H30A 2AV4A 1R5AA 2LV3A 3VWXA 3QFAC 3ME8A 2FWGA 2F3MA 3E9JB 5IPHA 2DLXA 2YJHA 4TR1A 5KEJA 2IJYA 2IMIA 3EMXA 2YCDA 3BJ5A 4ACSA 2PWJA 4MZBA 1PX6A 4O7HA 3L4NA 1FB6A 4POMA 5ID2B 3TJFA 3QAGA 1U6TA 3E3EA 3G7IA 1XWBA 2AAWA 5ECPB 1S3AA 3HKRA 4ZXGA 1EWXA 5ECMB 2LRTA 2P5QA 2WS2A 4HU7A 3MNGA 2VD0A 2FA8A 3D6IA 1Z6NA 1XWCA 5AISA 4HQZA 2YN1A 4KDYA 1F3AA 3I43A 2CVDA 2LSTA 3TKSC 3HD5A 4MPGA 3GMFA 2JSZA 4POBA 2CX4A 4E8EA 3KIJA 5EPFA 1W4VA 4HZ4A 5IMCA 2FWHA 5G31A 1MDKA 2H72A 1SKRB 3VURA 3U5RE 4IHUA 4IQ1A 3ZL5A 3F8UA 2YV9A 10GSA 4BWQA 4GRFA 4IJ3A 4ID0A 3E0UA 2D2ZA 8GSSA 1A24A 1HNBA 3Q74A 1GWCA 3GKNA 3NZNA 7GSSA 3A3TA 4RI6A 3OR5A 4LA1A 2QKEA 4IP6A 5KN0A 2X99A 1LJRA 4WF5A 2LJAA 4P3YB 1O81A 3Q18A 1OE8A 4IP1A 3C8EA 2FWEA 2R3XA 1KEBA 3KMNA 2DIYA 4D73B 1OC3A 5D9TA 2ON7A 1MTCA 1XOBA 3WYWA 1O7UA 3TJJA 4ZL7A 2V2GA 4PURA 4NHWA 2WCIA 1THOA 3ED3A 3IA1A 2RM5A 1HQOA 2YOIA 1M0UA 3ERFA 4WKWA 1CQGA 1TRWA 1EEJA 4JE1A 2OKAA 1F37A 5ECNB 4YAPA 3QPMA 1G0TA 1SYRA 3VI7A 4I97A 4WF4A 4HJMA 4LMWA 1SKSB 2X64A 4IS0A 2L57A 1GSQA 2FA4A 1RQMA 4X1UA 3UJ1A 5FWGA 2DJ2A 3CSIA 3IE3A 4ECJA 1TRSA 3SBCA 1SKWB 1N8JA 4ZB9A 4AJ7A 1F9MA 2IPAA 4MF5A 3WD6A 1QGVA 3PGTA 4AGSA 4CHSA 3VI5A 2AUVA 3EINA 4HJ2A 2KP1A 5E4WA 4KGIA 3UVHA 2OE1A 3HVSA 1Q4JA 2JZSA 2JL4A 3TDGA 3HA9A 5B6NA 2OADA 4NPBA 5FHIA 1ZMAA 4Z7XA 1GRXA 5GAPD 3GX8A 3MDKA 1DUGA 1GSFA 2X8HA 2GS3A 1GUKA 5JCWA 2GDRA 2BTOT 1PN9A 1FOVA 2LEGA 2NPBA 1XW5A 4Q5RA 2JU5A 4K0GA 2I4AA 4ZL9A 2MBSA 5ABRA 2DMMA 1XVWA 3ZIVA 3UEMA 3US3A 3IV4A 3FR9A 1J08A 5KN3A 2XPEA 2WRTA 2RLIA 3VPQA 2F9SA 2DJ3A 3V1WA 1XW6A 3HCZA 2KUCA 5J9BA 3WT1A 2KLXA 1B9XC 2JZTA 3A5WA 3ZVJD 2LTKA 3HJPA 1EGOA 1W89A 3GA4A 2PN8A 3G9BA 1O85A 3TRPA 5IOXA 4NV5A 20GSA 1R26A 4DSSB 2OBIA 1TJDA 2JADA 2VCWA 4WEYA 3GSSA 3ZLPA 2FHEA 1TTZA 2IMKA 1SK1A 3MWHA 2IFQB 1TKDB 3VFIA 4NV2A 4MJAA 4BL7A 2VM1A 1G7OA 1E6BA 1WMJA 2KOKA 2L6CA 3F6FA 3TKSA 3QCPA 4PNFA 1VRSD 2VCVA 2R4VA 1U3IA 3F4SA 2B6MA 3GX0A 3EMPA 1M2AA 1IYIA 2MZCA 1Z7PA 2YPMA 3F0IA 2PERA 5J9CA 3TKQA 1HNAA 3PINA 3EC3A 4TXVA 1VF2A 4ML6A 2RIIA 2GT6A 1V40A 4FYUA 4MP4A 4EDYA 4IVFA 1EGRA 1M7TA 3L78A 2DC5A 1FG4A 4GLTA 2H1BA 4I6XA 2H71A 5AN1A 4TR3A 2MMOA 3QMXA 4ZBDA 4GSNA 5B6MA 4FH8A 3L9SA 3P90A 2CAQA 4OO4A 1KNGA 3M0FA 3LG6A 1TXXA 4XS6A 3VWUA 3DMLA 1H4OA 3F9UA 2L4QA 4EDZA 1J9BA 1GNEA 1GH2A 3LYKA 4MF6A 3WGXA 3GV1A 5JWQB 4V2NA 2JZRA 1G7EA 3O76A 4IELA 1K0BA 6GSYA 3H79A 1XBSA 19GSA 2GZPA 4MMMA 3UVTA 4AJ8A 2AYTA 3FZAA 2CQ9A 1SENA 2AHEA 4G2EA 4ZIJA 1TI3A 4F2IA 3P8WA 4KX4A 1AUCA 1U88A 4EKZA 4DSSA 2B5XA 3IAS2 1XFLA 3DD3A 4HOJA 1FAAA 2DJ1A 2X8CA 5DAKB 3GL3A 1GULA 1OKDA 4HUAA 3FR3A 3KD0A 4E8HA 3UMAA 1T00A 2M80A 4MF7A 1B4QA 4WBJA 4EC0A 3N5OA 3D4TA 1OC8A 4ML1A 1HYUA 1GNWA 1ZL9A 3K8NA 4MZWA 2C4JA 1WJKA 1EV4A 1A8LA 1X5CA 3CMIA 3M1GA 5EL8A 1BAYA 2V6OA 4Q5NA 5DCHA 4J2FA 3UBLA 5JWRB 3C1RA 4OFMA 5HR1A 1ILOA 2EIQA 4Q5FA 2H0GA 1GSYA 4TR4A 2PPTA 4PXOA 2HFDA 2IN3A 5A4WA 5A4UA 2L5OA 3W6GA 3DVWA 3TJBA 1Z7RA 3RBTA 2YV7A 1Z5YE 3M8NA 3GFKA 4WR4A 2TRXA 5D8IA 4OMVA 3D4MA 5AGYA 2N5FA 2B1KA 1ERVA 4DVCA 1UVZA 3NIVA 2J23A 1JZRA 3CSJA 3FZ5A 5F8BA 4I2UA 2TIRA 4TN8A 1Q98A 1UC7A 3GKMA 5G2ZA 13GSA 5JCUA 4NXIA 2C3NA 5JCGA 2NDOA 2PVOC 5KN1A 3TKSE 2GSTA 2PVQA 1OYJA 3LJRA 3GRXA 2VL9A 1YF0A 1UN2A 5F0GA 1QMVA 4TR0A 5DALA 1EP7A 4XS1A 4YQMA 3ZTLA 4N0VA 2AJQB 2V41A 1OC9B 1BG5A 1RK4A 2A2SA 4EF0A 2IMDA 4V1Ap 4POLA 5DJLA 2ZNMA 1ZCPA 3GUSA 3C7MA 3GKKA 5L71A 5H5SA 3DEXA 1PQNA 5CNWA 1WWJA 4KA0A 3PH9A 4I2TA 1EP8A 2JSYA 4FYCA 1YZXA 1T3BA 3VWVA 2XBIA 3CRUA 3ZMKA 4CDOA 2V6KA 1MD4A 3Q6OA 5EVOA 2CZ3A 3VK9A 2QSIA 5ECRB 3M9JA 3KJYA 2ZUPA 4K1FA 4KSOA 1I9DA 1EEMA 2YWOA 4HDEA 4DSQA 2VM2A 1X9WB 1YF1A 3LQ7A 4N10A 1QUWA 3A2XA 4H86A 2H70A 1MEKA 1YEXA 3HZ8A 1U3AA 2E2MA 1M2BA 18GSA 2V32A 5DCGA 2L6DA 2CVKA 4AJ6A 1GLPA 1BQ7A 3DIEA 4NAXA 1FB0A 4IBPA 2RM6A 2QGVA 2H76A 3FEUA 2N5AA 2WULA 2MBTA 3IXRA 5HR3A 2GQKA 4QL9A 1TK8B 1WOUA 4GXZA 1XZOA 4MLYA 1WPIA 3FYGA 2VUPA 3RPPA 4MZCA 3A2WA 1CQHA 3J7Yk 3KXOA 3RHCA 1DSBA 3GYKA 4OWYA 5GZZB 1SYXA 2HI7A 4OFNA 4XS4B 1XXUA 5G1KA 2GSSA 4I5QA 2GTUA 1ON4A 11GSA 1PSQA 3LORA 4EXJA 2XPDA 3RHBA 1T7PB 3UARA 2YWMA 3I69A 3CRTA 5ECQB 5CRDA 3UBKA 2GSRA 4F0BA 2QC7A 2IMFA 2PBJA 2HRFA 1TDIA 4MA9A 4FO5A 4F03A 3ZZXA 1B4PA 5ID2A 3DVXA 3VLNA 3FW2A 2GSQA 4GF0A 3KMOA 4HS1A 2FLSA 4PQIA 5IOWA 3H4KA 2LJKA 1GUMA 5GSSA 4FIWA 3F3RA 4KW6A 3VWWA 1YKCA 2CZ2A 3WT2A 3ZYWA 3KGKA 4L8EA 2K9FA 2E7PA 4F9ZA 5DQYA 3ZITA 4XRAA 5HFIA 2CX3A 3P7XA 2YNXA 1TU7A 2LKUA 5ECLB 1VGLA 3UIWA 1TK0B 2HT9A 3LEFA 1XWGA 1Y25A 1IYHA 4TXOB 3I6AA 3H8QA 3U6VA 4PNGA 3KCMA 4MJCA 4K7IA 1PMTA 2NTOA 3KM6A 1LU4A 2H6ZA 5ECKB 3C1SA 3TJKA 2B5YA 2O87A 1XVQA 2YP6A 2VCZA 5H5QA 5INYA 2VIMA 5D96A 1TRVA 5CRWA 1BX9A 4RUVA 2DMLA 4KAEA 4KCAA 1GTIA 2GQMA 3FKFA 1PRXA 1TRUA 4D73A 3D21A 2VO4A 2XC2A 1A2JA 3FR6A 4K6XA 4IN0A 3P2AA 2HSHA 1I5GA 2CVBA 5ELAA 1B9YC 1TP9A 4XS4A 2R5GA 4NMUA 1THXA 1NSWA 2GLRA 2ES7A 2XHFA 4MABA 4XTSA 1OAZA 3FHKA 2B7JA 2H1GA 2LQOA 2B3SA 4KDXA
chains in the Genus database with same CATH superfamily
1HD2A 2HRAA 1JHBA 1GTUA 4X43A 1ST9A 2LUSA 3HZ4A 5CYYA 4O32A 4PX1A 2CT6A 1SJIA 3KZQA 4QL7A 5CO3A 2E0QA 1XPVA 2K18A 2XBQA 3C71A 2HE3A 5GSTA 4OCFA 1TOFA 4ZBBA 4GSSA 2WJUA 12GSA 2DJKA 3KH7A 4CY8A 1FO5A 3G7YA 2LRCA 3DWVA 3F4RA 1K0OA 1JLVA 5DDLA 2HZEB 4JU5A 5LNKe 1M2DA 2HZFA 5IO2A 2H8LA 1WE0A 2OE0A 3IR4A 1RW1A 4EL1A 4BA7A 3L0HA 3ZVJA 1WP0A 4V2MA 4Z2RA 2PU9C 3HJOA 1PGTA 3GH9A 1PKWA 1SK0A 3VPTA 4IJIA 2K8VA 4I8BA 2F51A 2C0DA 1AQWA 2I3YA 5ECOB 5G5FA 2H6XA 3MYDA 3HYPA 5J3RA 5DQSA 3PPUA 3R2QA 1FW1A 1YEPA 3DXBA 2HSMA 2MMNA 1Z3EA 1T8EB 3EU4A 3GN3A 2UZ8A 2CA8A 2C0EA 3GNJA 1NM3A 3IAM2 1YDKA 1PKZA 5KOWA 2HYXA 1AXDA 5CRGA 22GSA 2HSYA 2WZ9A 1GUHA 1SK2A 1X5DA 1ZYEA 4GQCA 1A2LA 4TR1B 3CTFA 2WB9A 4GTUA 4Q5QA 1DBYA 2VL3A 1XW9A 2X4AA 2E2GA 1GSUA 1X5EA 3TRXA 2DSAA 16GSA 5DBQA 1GSDA 2YWIA 3KP8A 3ZMLA 2IFQA 2OJLA 1JLWA 3M9KA 5J4UA 3DKSA 1A0RP 1NW2A 2H6YA 2REMA 3AY8A 5HR2A 4ECIA 2FCHA 2GZZA 1K3YA 4JR4A 3TKPA 4YQUA 3HJMA 3FK8A 1XWKA 3CYNA 3EU3A 1SD8A 3LXTA 1PL2A 3GURA 3IPZA 4LMVA 2H74A 4EVMA 4PGTA 3IOSA 4KUNA 2YZHA 2LJRA 4ZBAA 4AF2A 4YH2A 1O8XA 2DJ0A 1ERWA 1F2EA 1XOAA 2K8SA 3ZFBA 3APQA 2VCQA 3DYRA 3GSTA 3IHQA 2R0CA 4JR6A 5CREA 1VF1A 4MJBA 2NVLA 3GTUB 1KBNA 4EO3A 2VD1A 3IDVA 2FY6A 1SU9A 1VF3A 3F3QA 3KH9A 2VCXA 5IIZA 3GIXA 5COHA 3ISOA 3ERGA 2HLSA 4K2XA 3DGQA 5D9XA 5J5NA 3FZ4A 4YAVA 3FY7A 5F05A 3LFLA 2LS5A 5ELGA 4X0XA 2C0FA 1V98A 3ZIJA 1ERUA 5IMZA 1SJZA 4GWRA 4N0ZA 4WR5A 5IMDA 4N11A 4ECBA 4HQSA 4BVXA 1PFOA 1JZOA 4L0WA 5H5RA 3IC8A 2FNOA 5IQYA 2VLVA 2HNLA 4POKA 3NOFA 5CRHA 2IL3A 3KTLA 4TW5A 4EE0A 3LWAA 2LRNA 5E59A 4ZILA 3TCOA 4DSRA 1G6WA 4LL4B 4MH2A 1N2AA 5HFGA 4K5SA 3N9JA 1GSSA 3W8JA 1ML6A 1Y6EA 5J41A 3KEBA 2YJ7A 5F06A 4KNDA 3LXZA 5B8BA 2GGTA 1ZOFA 5DAKA 4K2DA 5HR0A 2NBSA 4WETA 2FWFA 1JFUA 3A5IA 3BBYA 2N5BA 2Z9SA 3O6TA 1EOHA 2K6VA 2H75A 3IC4A 3CTGA 1JZWA 3FMWA 2ZCTA 4L0UA 4TRXA 5HFKA 4KB3A 3H1NA 1BYEA 3IHGA 4YQVA 2I1UA 5B8AA 1H75A 1KTEA 3TJGA 2VCTA 4XCSA 5D73A 4LLRA 1R4WA 2M66A 4PQ1A 4G0KA 2GT5A 3FRCA 4JBBA 4WXTA 2G2QA 4CY6A 1ACVA 3JCML 3GTUA 4J56E 4ISDA 3CSHA 5B7CA 3RAZA 5IMAA 17GSA 2BMXA 1X0RA 3MSZA 1BEDA 2PGTA 1SJ6A 3H93A 4G19A 2P0GA 6GSSA 4JZQA 1K3LA 3QAWA 2IMEA 1DE2A 1B48A 1LBKA 2PUKC 4K0NA 4G10A 5G5EA 1GP1A 3HVVA 1TW9A 3S9FA 1ZYQB 2O89A 3F63A 3TOUA 2H1AA 5A4VA 4PQHA 5C00A 3ZRDA 2V1MA 3C73A 3GHAA 2F8FA 3D5JA 3EURA 2LNTA 4ZL8A 3EE2A 4KDUA 3APSA 3CBUA 4IGJA 4BL7B 2L59A 5FT3A 3Q19A 2C8UA 2ALBA 3F6DA 5BMUA 2TRCP 1GTBA 4BWSA 2R0PA 2P5RA 4ULXA 1M3JA 1OKTA 2H0IA 2H19A 2OA7A 1OC9A 3GL5A 4EUYA 1K0DA 3MAKA 2H66A 3GKXA 2VOCA 1GL8A 5ECSA 1TK5B 2M72A 1R5PA 4V1Ag 1FHEA 3TRQA 3UAPA 3BD2A 2O7KA 2VAFA 2VLUA 1QQ2A 2A2RA 2A4VA 2DKIA 3QAVA 1T4YA 2C3QA 4F0CA 2DJJA 2ON5A 1B8XA 2X8GA 3D22A 2OE3A 4RI7A 3O3TA 1UA5A 3PR8A 2OACA 4JRRA 2JACA 4ILFA 1SL1B 4RQXA 1PD21 4O92A 3HDCA 3LSZA 1A23A 5ECHB 1AC1A 1Z9HA 3KP9A 4DEJA 1MDIA 1K0NA 5HQPA 1U87A 2C80A 4GSTA 3LYPA 1V2AA 2J9HA 1USBA 1K0MA 1XWAA 4XHMA 1V57A 1YJ6A 3M3MA 9GSSA 4XRDA 2GVPA 1T1VA 5CP1A 5IO0A 2B5EA 3W8SA 6GSWA 1FVKA 1ERTA 1VF4A 3ERWA 2VL2C 1F6MC 2R2JA 1YY7A 1M9BA 5LD0A 1AQXA 1SD9A 3IK7A 3HVXA 1X9MB 5G30A 2AB6A 1TI1A 1O73A 1OE7A 4GCIA 6GSXA 4OD7A 2CAIA 1E2YA 1Z6MA 3APOA 4OO5A 1R7HA 3FZ9A 2C3TA 1MDJA 2O85A 2WDUA 1G6YA 4ECCA 4BVYA 2EC4A 2MYGA 2B7KA 2B1LA 1QFNA 5D9VA 3WGDA 2P31A 6GSUA 3G7JA 3ZFLA 4CW9A 1NHOA 3IRAA 5ENUA 3QOUA 2FGXA 3HY2A 3L9VA 5AIVA 3HVNA 4LL1B 4PUFC 4V2LA 5GAND 2HXKA 5DVBA 4IQAA 1K0CA 3ME7A 1WRYA 4QQ7A 1TU8A 4TOPA 1PN0A 4OCEA 3BCIA 2GQLA 3GH6A 2C1YA 1JZDA 4KCEA 3QFBC 5D93A 1YQ1A 4USSA 5G1LA 2HRNA 3EWLA 5IM9A 5BRTA 1FVJA 3ZREA 5IMFA 1O6JA 3HXSA 3UOMA 2FUG2 3RPNA 2R6KA 3EPTA 3BCKA 2M46A 1K0AA 3KTBA 1EOGA 5DJMA 3IBHA 1V9WA 1YKAA 2DBCA 2YZUA 3TB2A 2O8VB 3TGZA 3QDNA 4PUAA 3TUEA 2L5LA 5C04A 5F07A 3I9V2 4L5LA 4TVEA 3EVIA 1K3OA 3CXGA 2YWNA 4TXOA 1G7DA 2L4CA 3L9UA 4OFTA 3TKRA 4BPYA 3J7Yb 2BJXA 2WFCA 1F3BA 4IW9A 4JEDA 4ZB6A 1ABAA 2HRKA 4MH3A 2EIOA 5ECIB 2H01A 1EV9A 1DE1A 5EY6A 1QXHA 3UL3A 1OVNA 2KHPA 5JWOB 4MPFA 1M9AA 1A2MA 2LQQA 4K9ZA 1HNCA 2IIYA 1X9SB 1A8YA 4HZ2A 2YANA 1PA3A 1AAZA 3HHVA 1O8WA 1M3IA 5D9WA 1NHYA 4N30A 4G9HA 4GQFA 4K8MA 5DALB 3LGCA 2H73A 2KP2A 3SWLA 2IWTA 1AIUA 5CAXA 1URMA 3F4TA 2MMAA 2DIZA 2VLTA 4K7NA 6GSVA 2I9HA 4RQRA 4ZB8A 3RDWA 1SL0B 3QD9A 4HEA2 1AW9A 1ZZYA 2PMTA 1MD3A 1SL2B 4WBRD 5LCZA 3WGEA 1EZKA 4XIHA 1GTAA 2C0GA 1XCCA 3A2VA 4O5RA 1GSEA 1T4ZA 3D0ZA 4HI7A 4HU9A 4YKGA 2RUFA 1PX7A 1S3DA 2H0HA 5A5KA 2FD3A 4G0IA 2GZYA 4KE3A 2H1DA 2R37A 14GSA 4KH7A 2CV4A 1ZGNA 3EYTA 3IK9A 3BOAA 2OBKA 4MCUA 2HZEA 1QK8A 1XIYA 4NHZA 1J0FA 4MDCA 2MMZA 5AIXA 4TKYA 1V58A 2VL2A 4F82A 1BJXA 1PL1A 5IMVA 1WIKA 2G0FA 2EIRA 2WGRA 4KSMA 4L5OA 2I81A 5IPGA 6GSTA 4MJEA 5KN2A 1GLQA 4NWYA 4IKHA 1S3CA 4FYBA 2RUEA 3TOTA 3DRNA 3QR6A 4J57E 4K7OA 2F8AA 1AQVA 1A0FA 1M99A 4MK3A 1C72A 2LNSA 2H30A 2AV4A 1R5AA 2LV3A 3VWXA 3QFAC 3ME8A 2FWGA 2F3MA 3E9JB 5IPHA 2DLXA 4ICYA 2YJHA 4TR1A 5KEJA 2IJYA 2IMIA 3EMXA 2YCDA 3BJ5A 4ACSA 4O5UA 2PWJA 4MZBA 1PX6A 4O7HA 3L4NA 1FB6A 4POMA 5ID2B 3TJFA 3QAGA 1U6TA 3E3EA 3G7IA 1XWBA 2AAWA 5ECPB 1S3AA 3HKRA 4ZXGA 1EWXA 5ECMB 2LRTA 2P5QA 2WS2A 4HU7A 3MNGA 2VD0A 2FA8A 3D6IA 1Z6NA 1XWCA 5AISA 4HQZA 2YN1A 4KDYA 1F3AA 3I43A 2CVDA 2LSTA 3TKSC 3HD5A 4MPGA 3GMFA 2JSZA 4POBA 2CX4A 4E8EA 3KIJA 5EPFA 1W4VA 4HZ4A 5IMCA 2FWHA 5G31A 1MDKA 2H72A 1SKRB 3VURA 3U5RE 4IHUA 4IQ1A 3ZL5A 3F8UA 2YV9A 10GSA 4BWQA 4GRFA 4IJ3A 4ID0A 3E0UA 3CQFA 4MNNA 2D2ZA 8GSSA 1A24A 1HNBA 3Q74A 1GWCA 3GKNA 3NZNA 7GSSA 3A3TA 4RI6A 3OR5A 4LA1A 2QKEA 4IP6A 5KN0A 2X99A 1LJRA 4WF5A 2LJAA 4P3YB 1O81A 3Q18A 1OE8A 4IP1A 3C8EA 2FWEA 2R3XA 1KEBA 3KMNA 2DIYA 4D73B 1OC3A 5D9TA 2ON7A 1MTCA 1XOBA 3WYWA 1O7UA 3TJJA 4ZL7A 2V2GA 4PURA 4NHWA 2WCIA 1THOA 3ED3A 3IA1A 2RM5A 1HQOA 2YOIA 1M0UA 3ERFA 4WKWA 1CQGA 1TRWA 1EEJA 4JE1A 2OKAA 1F37A 5ECNB 4YAPA 3QPMA 1G0TA 1SYRA 2A2PA 3VI7A 4I97A 4WF4A 4HJMA 4LMWA 1SKSB 2X64A 4IS0A 2L57A 1GSQA 2FA4A 1RQMA 4X1UA 3UJ1A 5FWGA 2DJ2A 3CSIA 3IE3A 4ECJA 1TRSA 3SBCA 1SKWB 1N8JA 4ZB9A 4AJ7A 1F9MA 2IPAA 4MF5A 3WD6A 1QGVA 3PGTA 4AGSA 4CHSA 3VI5A 2AUVA 3EINA 4HJ2A 2KP1A 5E4WA 4KGIA 3UVHA 2OE1A 3HVSA 1Q4JA 2JZSA 2JL4A 3TDGA 3HA9A 5B6NA 2OADA 4NPBA 5FHIA 1ZMAA 4Z7XA 1GRXA 2QA1A 5GAPD 3GX8A 3MDKA 1DUGA 1GSFA 2X8HA 2GS3A 1GUKA 5JCWA 2GDRA 2BTOT 1PN9A 1FOVA 2LEGA 2NPBA 1XW5A 4Q5RA 2JU5A 4K0GA 2I4AA 4ZL9A 2MBSA 5ABRA 2DMMA 1XVWA 3ZIVA 3UEMA 3US3A 3IV4A 3FR9A 1J08A 5KN3A 2XPEA 2WRTA 2RLIA 3VPQA 2F9SA 2DJ3A 3V1WA 1XW6A 3HCZA 2KUCA 5J9BA 3WT1A 2KLXA 1B9XC 2JZTA 3A5WA 3ZVJD 2LTKA 3HJPA 1EGOA 1W89A 3GA4A 2PN8A 3G9BA 1O85A 3TRPA 5IOXA 4NV5A 4Z2UA 20GSA 1R26A 4DSSB 2OBIA 4PTSA 1TJDA 2JADA 2VCWA 4WEYA 3GSSA 3ZLPA 2FHEA 1TTZA 2IMKA 1SK1A 3MWHA 2IFQB 1TKDB 3VFIA 4NV2A 4MJAA 4BL7A 2VM1A 1G7OA 1E6BA 1WMJA 2KOKA 2L6CA 3F6FA 3TKSA 3QCPA 4PNFA 1VRSD 4FQUA 2VCVA 2R4VA 1U3IA 3F4SA 2B6MA 3GX0A 3EMPA 1M2AA 1IYIA 2MZCA 1Z7PA 2YPMA 3F0IA 2PERA 5J9CA 3TKQA 1HNAA 3PINA 3EC3A 4TXVA 1VF2A 4ML6A 2RIIA 2GT6A 1V40A 4FYUA 4MP4A 4EDYA 4IVFA 1S3RA 1EGRA 1M7TA 3L78A 2DC5A 2QA2A 1FG4A 4GLTA 2H1BA 4I6XA 2H71A 5AN1A 4TR3A 2MMOA 3QMXA 4YKFA 4ZBDA 4GSNA 5B6MA 4FH8A 3L9SA 3P90A 2CAQA 4OO4A 1KNGA 3M0FA 3LG6A 1TXXA 4XS6A 3VWUA 3DMLA 1H4OA 2A4HA 3F9UA 2L4QA 4EDZA 4BVXB 1J9BA 1GNEA 1GH2A 3LYKA 4MF6A 3WGXA 3GV1A 5JWQB 4V2NA 2JZRA 1G7EA 3O76A 4IELA 1K0BA 6GSYA 3H79A 1XBSA 19GSA 2GZPA 4MMMA 3UVTA 4AJ8A 2AYTA 3FZAA 2CQ9A 1SENA 2AHEA 4G2EA 4ZIJA 1FOHA 1TI3A 4F2IA 4KX4A 3P8WA 1AUCA 1U88A 4EKZA 4DSSA 2B5XA 3IAS2 1XFLA 3DD3A 4HOJA 1FAAA 2R0GA 2DJ1A 2X8CA 5DAKB 3GL3A 1GULA 1OKDA 4HUAA 3FR3A 3LW9A 3KD0A 4E8HA 3UMAA 1T00A 2M80A 4MF7A 1B4QA 4WBJA 4EC0A 4G0LA 3N5OA 3D4TA 1OC8A 4ML1A 1HYUA 1GNWA 1ZL9A 3K8NA 4MZWA 2C4JA 1WJKA 1EV4A 1A8LA 1X5CA 3CMIA 3M1GA 5EL8A 1BAYA 2V6OA 4Q5NA 5DCHA 4J2FA 3UBLA 5JWRB 3C1RA 4OFMA 5HR1A 1ILOA 2EIQA 4Q5FA 2H0GA 1GSYA 4TR4A 2PPTA 4PXOA 2HFDA 2IN3A 5A4WA 5A4UA 2L5OA 3W6GA 3DVWA 3TJBA 1Z7RA 3RBTA 2YV7A 1Z5YE 3M8NA 3GFKA 4WR4A 2TRXA 5D8IA 4OMVA 3D4MA 5AGYA 2N5FA 2B1KA 1ERVA 4DVCA 1UVZA 3NIVA 2J23A 1JZRA 3CSJA 3FZ5A 5F8BA 4I2UA 2TIRA 4TN8A 1Q98A 1UC7A 3GKMA 5G2ZA 13GSA 5JCUA 4NXIA 1ZYPA 2C3NA 5JCGA 2NDOA 2PVOC 5KN1A 3TKSE 2GSTA 2PVQA 1OYJA 3LJRA 3GRXA 2VL9A 1YF0A 1UN2A 5F0GA 1QMVA 4TR0A 5DALA 1EP7A 4XS1A 4YQMA 3ZTLA 4A5PA 4N0VA 2AJQB 2V41A 1OC9B 1BG5A 1RK4A 2A2SA 4EF0A 2IMDA 4V1Ap 4POLA 5DJLA 2ZNMA 1ZCPA 3GUSA 3C7MA 3GKKA 5L71A 4KF9A 5H5SA 3DEXA 1PQNA 4X4JA 5CNWA 1WWJA 4KA0A 3PH9A 4I2TA 1EP8A 2JSYA 4FYCA 1YZXA 1T3BA 3VWVA 2XBIA 3CRUA 3ZMKA 4CDOA 2V6KA 1MD4A 3Q6OA 5EVOA 2CZ3A 3VK9A 2QSIA 5ECRB 3M9JA 3KJYA 2ZUPA 4K1FA 4KSOA 1I9DA 1EEMA 2YWOA 4HDEA 4DSQA 2VM2A 1X9WB 1YF1A 3LQ7A 4N10A 1QUWA 3A2XA 4H86A 2H70A 1MEKA 1YEXA 3HZ8A 1U3AA 2E2MA 1M2BA 18GSA 2V32A 4K5RA 5DCGA 2L6DA 2CVKA 4AJ6A 1GLPA 1BQ7A 3DIEA 4NAXA 1FB0A 4IBPA 2RM6A 2QGVA 2H76A 3FEUA 2DKHA 2N5AA 2WULA 2MBTA 3IXRA 5HR3A 2GQKA 4QL9A 1TK8B 1WOUA 4GXZA 1XZOA 4MLYA 1WPIA 3FYGA 2VUPA 3RPPA 4MZCA 3A2WA 1CQHA 3J7Yk 3KXOA 3RHCA 1DSBA 3GYKA 1XG8A 4OWYA 5GZZB 1SYXA 2HI7A 4OFNA 4XS4B 1XXUA 5G1KA 2GSSA 4I5QA 2GTUA 1ON4A 4BVYB 3R3EA 11GSA 1PSQA 3LORA 4EXJA 2XPDA 3RHBA 1T7PB 3UARA 2YWMA 3I69A 3CRTA 5ECQB 5CRDA 3UBKA 2GSRA 4F0BA 2QC7A 2IMFA 2PBJA 2HRFA 1TDIA 4MA9A 4FO5A 4F03A 3ZZXA 1B4PA 5ID2A 3DVXA 3VLNA 3FW2A 2GSQA 4GF0A 3KMOA 4HS1A 2FLSA 4PQIA 5IOWA 3H4KA 2LJKA 1GUMA 5GSSA 4FIWA 3F3RA 4KW6A 3VWWA 1YKCA 2CZ2A 3WT2A 3ZYWA 3KGKA 4L8EA 2K9FA 2E7PA 4F9ZA 5DQYA 3ZITA 4XRAA 5HFIA 2CX3A 3P7XA 2YNXA 1TU7A 2LKUA 5ECLB 1VGLA 3UIWA 1TK0B 2HT9A 3LEFA 1XWGA 1Y25A 1IYHA 4TXOB 3I6AA 3H8QA 3U6VA 4PNGA 3KCMA 4MJCA 4K7IA 1ZYNA 1PMTA 2NTOA 2X49A 3KM6A 1LU4A 2H6ZA 5ECKB 3C1SA 3TJKA 2B5YA 2O87A 1XVQA 2YP6A 2VCZA 5H5QA 5INYA 2VIMA 5D96A 1TRVA 5CRWA 1BX9A 4RUVA 2DMLA 4KAEA 4KCAA 1GTIA 2GQMA 3FKFA 1PRXA 1TRUA 4D73A 3D21A 4Z2TA 2VO4A 2XC2A 1A2JA 4HSCX 3FR6A 4K6XA 4EIQA 4IN0A 3P2AA 2HSHA 1I5GA 2CVBA 5ELAA 1B9YC 1TP9A 4O5QA 4BIKA 4XS4A 2R5GA 4NMUA 1THXA 5KOXA 1NSWA 2GLRA 3MIXA 2ES7A 2XHFA 4MABA 4XTSA 1OAZA 4EIPA 3FHKA 2B7JA 2H1GA 2LQOA 2B3SA 4KDXA
chains in the Genus database with same CATH topology
1HD2A 2HRAA 1JHBA 1GTUA 4X43A 1ST9A 2LUSA 3HZ4A 5CYYA 4O32A 4PX1A 2CT6A 1SJIA 3KZQA 4QL7A 5CO3A 2E0QA 1XPVA 2K18A 2XBQA 3C71A 2HE3A 5GSTA 4OCFA 1TOFA 4ZBBA 4GSSA 2WJUA 12GSA 2DJKA 3KH7A 4CY8A 1FO5A 3G7YA 2LRCA 3DWVA 3F4RA 1K0OA 1JLVA 5DDLA 2HZEB 4JU5A 5LNKe 1M2DA 2HZFA 5IO2A 2H8LA 1WE0A 2OE0A 3IR4A 1RW1A 4EL1A 4BA7A 3L0HA 3ZVJA 1WP0A 4V2MA 4Z2RA 2PU9C 3HJOA 1PGTA 3GH9A 1PKWA 1SK0A 3VPTA 4IJIA 2K8VA 4I8BA 2F51A 2C0DA 1AQWA 2I3YA 5ECOB 5G5FA 2H6XA 3MYDA 3HYPA 5J3RA 5DQSA 3PPUA 3R2QA 1FW1A 1YEPA 3DXBA 2HSMA 2MMNA 1Z3EA 1T8EB 3EU4A 3GN3A 2UZ8A 2CA8A 2C0EA 3GNJA 1NM3A 3IAM2 1YDKA 1PKZA 5KOWA 2HYXA 1AXDA 5CRGA 22GSA 2HSYA 2WZ9A 1GUHA 1SK2A 1X5DA 1ZYEA 4GQCA 1A2LA 4TR1B 3CTFA 2WB9A 4GTUA 4Q5QA 1DBYA 2VL3A 1XW9A 2X4AA 2E2GA 1GSUA 1X5EA 3TRXA 2DSAA 16GSA 5DBQA 1GSDA 2YWIA 3KP8A 3ZMLA 2IFQA 2OJLA 1JLWA 3M9KA 5J4UA 3DKSA 1A0RP 1NW2A 2H6YA 2REMA 3AY8A 5HR2A 4ECIA 2FCHA 2GZZA 1K3YA 4JR4A 3TKPA 4YQUA 3HJMA 3FK8A 1XWKA 3CYNA 3EU3A 1SD8A 3LXTA 1PL2A 3GURA 3IPZA 4LMVA 2H74A 4EVMA 4PGTA 3IOSA 4KUNA 2YZHA 2LJRA 4ZBAA 4AF2A 4YH2A 1O8XA 2DJ0A 1ERWA 1F2EA 1XOAA 2K8SA 3ZFBA 3APQA 2VCQA 3DYRA 3GSTA 3IHQA 2R0CA 4JR6A 5CREA 1VF1A 4MJBA 2NVLA 3GTUB 1KBNA 4EO3A 2VD1A 3IDVA 2FY6A 1SU9A 1VF3A 3F3QA 3KH9A 2VCXA 5IIZA 3GIXA 5COHA 3ISOA 3ERGA 2HLSA 4K2XA 3DGQA 5D9XA 5J5NA 3FZ4A 4YAVA 3FY7A 5F05A 3LFLA 2LS5A 5ELGA 4X0XA 2C0FA 1V98A 3ZIJA 1ERUA 5IMZA 1SJZA 4GWRA 4N0ZA 4WR5A 5IMDA 4N11A 4ECBA 4HQSA 4BVXA 1JZOA 4L0WA 5H5RA 3IC8A 2FNOA 5IQYA 2VLVA 2HNLA 4POKA 3NOFA 5CRHA 2IL3A 3KTLA 4TW5A 4EE0A 3LWAA 2LRNA 5E59A 4ZILA 3TCOA 4DSRA 1G6WA 4LL4B 4MH2A 1N2AA 5HFGA 4K5SA 3N9JA 1GSSA 3W8JA 1ML6A 1Y6EA 5J41A 3KEBA 2YJ7A 5F06A 4KNDA 3LXZA 5B8BA 2GGTA 1ZOFA 5DAKA 4K2DA 5HR0A 2NBSA 4WETA 2FWFA 1JFUA 3A5IA 3BBYA 2N5BA 2Z9SA 3O6TA 1EOHA 2K6VA 2H75A 3IC4A 3CTGA 1JZWA 3FMWA 2ZCTA 4L0UA 4TRXA 5HFKA 4KB3A 3H1NA 1BYEA 3IHGA 4YQVA 2I1UA 5B8AA 1H75A 1KTEA 3TJGA 2VCTA 4XCSA 5D73A 4LLRA 1R4WA 2M66A 4PQ1A 4G0KA 2GT5A 3FRCA 4JBBA 4WXTA 2G2QA 4CY6A 1ACVA 3JCML 3GTUA 4J56E 4ISDA 3CSHA 5B7CA 3RAZA 5IMAA 17GSA 2BMXA 1X0RA 3MSZA 1BEDA 2PGTA 1SJ6A 3H93A 4G19A 2P0GA 6GSSA 4JZQA 1K3LA 3QAWA 2IMEA 1DE2A 1B48A 1LBKA 2PUKC 4K0NA 4G10A 5G5EA 1GP1A 3HVVA 1TW9A 3S9FA 1ZYQB 2O89A 3F63A 3TOUA 2H1AA 5A4VA 4PQHA 5C00A 3ZRDA 2V1MA 3C73A 3GHAA 2F8FA 3D5JA 3EURA 2LNTA 4ZL8A 3EE2A 4KDUA 3APSA 3CBUA 4IGJA 4BL7B 2L59A 5FT3A 3Q19A 2C8UA 2ALBA 3F6DA 5BMUA 2TRCP 1GTBA 4BWSA 2R0PA 2P5RA 4ULXA 1OKTA 2H0IA 2H19A 2OA7A 1OC9A 3GL5A 4EUYA 1K0DA 3MAKA 2H66A 3GKXA 2VOCA 1GL8A 5ECSA 1TK5B 2M72A 1R5PA 4V1Ag 1FHEA 3TRQA 3UAPA 3BD2A 2O7KA 2VAFA 2VLUA 1QQ2A 2A2RA 2A4VA 2DKIA 3QAVA 1T4YA 2C3QA 4F0CA 2DJJA 2ON5A 1B8XA 2X8GA 3D22A 2OE3A 4RI7A 3O3TA 1UA5A 3PR8A 2OACA 4JRRA 2JACA 4ILFA 1SL1B 4RQXA 1PD21 4O92A 3HDCA 3LSZA 1A23A 5ECHB 1AC1A 1Z9HA 3KP9A 4DEJA 1MDIA 1K0NA 5HQPA 1U87A 2C80A 4GSTA 3LYPA 1V2AA 2J9HA 1USBA 1K0MA 1XWAA 4XHMA 1V57A 1YJ6A 3M3MA 9GSSA 4XRDA 2GVPA 1T1VA 5CP1A 5IO0A 2B5EA 3W8SA 6GSWA 1FVKA 1ERTA 1VF4A 3ERWA 2VL2C 1F6MC 2R2JA 1YY7A 1M9BA 5LD0A 1AQXA 1SD9A 3IK7A 3HVXA 1X9MB 5G30A 2AB6A 1TI1A 1O73A 1OE7A 4GCIA 6GSXA 4OD7A 2CAIA 1E2YA 1Z6MA 3APOA 4OO5A 1R7HA 3FZ9A 2C3TA 1MDJA 2O85A 2WDUA 1G6YA 4ECCA 4BVYA 2EC4A 2MYGA 2B7KA 2B1LA 1QFNA 5D9VA 3WGDA 2P31A 6GSUA 3G7JA 3ZFLA 4CW9A 1NHOA 3IRAA 5ENUA 3QOUA 2FGXA 3HY2A 3L9VA 5AIVA 4LL1B 4PUFC 4V2LA 5GAND 2HXKA 5DVBA 4IQAA 1K0CA 3ME7A 1WRYA 4QQ7A 1TU8A 4TOPA 1PN0A 4OCEA 3BCIA 2GQLA 3GH6A 2C1YA 1JZDA 4KCEA 3QFBC 5D93A 1YQ1A 4USSA 5G1LA 2HRNA 3EWLA 5IM9A 5BRTA 1FVJA 3ZREA 5IMFA 1O6JA 3HXSA 3UOMA 2FUG2 3RPNA 2R6KA 3EPTA 3BCKA 2M46A 1K0AA 3KTBA 1EOGA 5DJMA 3IBHA 1V9WA 1YKAA 2DBCA 2YZUA 3TB2A 2O8VB 3TGZA 3QDNA 4PUAA 3TUEA 2L5LA 5C04A 5F07A 3I9V2 4L5LA 4TVEA 3EVIA 1K3OA 3CXGA 2YWNA 4TXOA 1G7DA 2L4CA 3L9UA 4OFTA 3TKRA 4BPYA 3J7Yb 2BJXA 2WFCA 1F3BA 4IW9A 4JEDA 4ZB6A 1ABAA 2HRKA 4MH3A 2EIOA 5ECIB 2H01A 1EV9A 1DE1A 5EY6A 1QXHA 3UL3A 1OVNA 2KHPA 5JWOB 4MPFA 1M9AA 1A2MA 2LQQA 4K9ZA 1HNCA 2IIYA 1X9SB 1A8YA 4HZ2A 2YANA 1PA3A 1AAZA 3HHVA 1O8WA 5D9WA 1NHYA 4N30A 4G9HA 4GQFA 4K8MA 5DALB 3LGCA 2H73A 2KP2A 3SWLA 2IWTA 1AIUA 5CAXA 1URMA 3F4TA 2MMAA 2DIZA 2VLTA 4K7NA 6GSVA 2I9HA 4RQRA 4ZB8A 3RDWA 1SL0B 3QD9A 4HEA2 1AW9A 1ZZYA 2PMTA 1MD3A 1SL2B 4WBRD 5LCZA 3WGEA 1EZKA 4XIHA 1GTAA 2C0GA 1XCCA 3A2VA 4O5RA 1GSEA 1T4ZA 3D0ZA 4HI7A 4HU9A 4YKGA 2RUFA 1PX7A 1S3DA 2H0HA 5A5KA 2FD3A 4G0IA 2GZYA 4KE3A 2H1DA 2R37A 14GSA 4KH7A 2CV4A 1ZGNA 3EYTA 3IK9A 3BOAA 2OBKA 4MCUA 2HZEA 1QK8A 1XIYA 4NHZA 1J0FA 4MDCA 2MMZA 5AIXA 4TKYA 1V58A 2VL2A 4F82A 1BJXA 1PL1A 5IMVA 1WIKA 2G0FA 2EIRA 2WGRA 4KSMA 4L5OA 2I81A 5IPGA 6GSTA 4MJEA 5KN2A 1GLQA 4NWYA 4IKHA 1S3CA 4FYBA 2RUEA 3TOTA 3DRNA 3QR6A 4J57E 4K7OA 2F8AA 1AQVA 1A0FA 1M99A 4MK3A 1C72A 2LNSA 2H30A 2AV4A 1R5AA 2LV3A 3VWXA 3QFAC 3ME8A 2FWGA 2F3MA 3E9JB 5IPHA 2DLXA 4ICYA 2YJHA 4TR1A 5KEJA 2IJYA 2IMIA 3EMXA 2YCDA 3BJ5A 4ACSA 4O5UA 2PWJA 4MZBA 1PX6A 4O7HA 3L4NA 1FB6A 4POMA 5ID2B 3TJFA 3QAGA 1U6TA 3E3EA 3G7IA 1XWBA 2AAWA 5ECPB 1S3AA 3HKRA 4ZXGA 1EWXA 5ECMB 2LRTA 2P5QA 2WS2A 4HU7A 3MNGA 2VD0A 2FA8A 3D6IA 1Z6NA 1XWCA 5AISA 4HQZA 2YN1A 4KDYA 1F3AA 3I43A 2CVDA 2LSTA 3TKSC 3HD5A 4MPGA 3GMFA 2JSZA 4POBA 2CX4A 4E8EA 3KIJA 5EPFA 1W4VA 4HZ4A 5IMCA 2FWHA 5G31A 1MDKA 2H72A 1SKRB 3VURA 3U5RE 4IHUA 4IQ1A 3ZL5A 3F8UA 2YV9A 10GSA 4BWQA 4GRFA 4IJ3A 4ID0A 3E0UA 4MNNA 2D2ZA 8GSSA 1A24A 1HNBA 3Q74A 1GWCA 3GKNA 3NZNA 7GSSA 3A3TA 4RI6A 3OR5A 4LA1A 2QKEA 4IP6A 5KN0A 2X99A 1LJRA 4WF5A 2LJAA 4P3YB 1O81A 3Q18A 1OE8A 4IP1A 3C8EA 2FWEA 2R3XA 1KEBA 3KMNA 2DIYA 4D73B 1OC3A 5D9TA 2ON7A 1MTCA 1XOBA 3WYWA 1O7UA 3TJJA 4ZL7A 2V2GA 4PURA 4NHWA 2WCIA 1THOA 3ED3A 3IA1A 2RM5A 1HQOA 2YOIA 1M0UA 3ERFA 4WKWA 1CQGA 1TRWA 1EEJA 4JE1A 2OKAA 1F37A 5ECNB 4YAPA 3QPMA 1G0TA 1SYRA 2A2PA 3VI7A 4I97A 4WF4A 4HJMA 4LMWA 1SKSB 2X64A 4IS0A 2L57A 1GSQA 2FA4A 1RQMA 4X1UA 3UJ1A 5FWGA 2DJ2A 3CSIA 3IE3A 4ECJA 1TRSA 3SBCA 1SKWB 1N8JA 4ZB9A 4AJ7A 1F9MA 2IPAA 4MF5A 3WD6A 1QGVA 3PGTA 4AGSA 4CHSA 3VI5A 2AUVA 3EINA 4HJ2A 2KP1A 5E4WA 4KGIA 3UVHA 2OE1A 3HVSA 1Q4JA 2JZSA 2JL4A 3TDGA 3HA9A 5B6NA 2OADA 4NPBA 5FHIA 1ZMAA 4Z7XA 1GRXA 2QA1A 5GAPD 3GX8A 3MDKA 1DUGA 1GSFA 2X8HA 2GS3A 1GUKA 5JCWA 2GDRA 2BTOT 1PN9A 1FOVA 2LEGA 2NPBA 1XW5A 4Q5RA 2JU5A 4K0GA 2I4AA 4ZL9A 2MBSA 5ABRA 2DMMA 1XVWA 3ZIVA 3UEMA 3US3A 3IV4A 3FR9A 1J08A 5KN3A 2XPEA 2WRTA 2RLIA 3VPQA 2F9SA 2DJ3A 3V1WA 1XW6A 3HCZA 2KUCA 5J9BA 3WT1A 2KLXA 1B9XC 2JZTA 3A5WA 3ZVJD 2LTKA 3HJPA 1EGOA 1W89A 3GA4A 2PN8A 3G9BA 1O85A 3TRPA 5IOXA 4NV5A 4Z2UA 20GSA 1R26A 4DSSB 2OBIA 4PTSA 1TJDA 2JADA 2VCWA 4WEYA 3GSSA 3ZLPA 2FHEA 1TTZA 2IMKA 1SK1A 3MWHA 2IFQB 1TKDB 3VFIA 4NV2A 4MJAA 4BL7A 2VM1A 1G7OA 1E6BA 1WMJA 2KOKA 2L6CA 3F6FA 3TKSA 3QCPA 4PNFA 1VRSD 4FQUA 2VCVA 2R4VA 1U3IA 3F4SA 2B6MA 3GX0A 3EMPA 1M2AA 1IYIA 2MZCA 1Z7PA 2YPMA 3F0IA 2PERA 5J9CA 3TKQA 1HNAA 3PINA 3EC3A 4TXVA 1VF2A 4ML6A 2RIIA 2GT6A 1V40A 4FYUA 4MP4A 4EDYA 4IVFA 1EGRA 1M7TA 3L78A 2DC5A 2QA2A 1FG4A 4GLTA 2H1BA 4I6XA 2H71A 5AN1A 4TR3A 2MMOA 3QMXA 4YKFA 4ZBDA 4GSNA 5B6MA 4FH8A 3L9SA 3P90A 2CAQA 4OO4A 1KNGA 3M0FA 3LG6A 1TXXA 4XS6A 3VWUA 3DMLA 1H4OA 2A4HA 3F9UA 2L4QA 4EDZA 4BVXB 1J9BA 1GNEA 1GH2A 3LYKA 4MF6A 3WGXA 3GV1A 5JWQB 4V2NA 2JZRA 1G7EA 3O76A 4IELA 1K0BA 6GSYA 3H79A 1XBSA 19GSA 2GZPA 4MMMA 3UVTA 4AJ8A 2AYTA 3FZAA 2CQ9A 1SENA 2AHEA 4G2EA 4ZIJA 1FOHA 1TI3A 4F2IA 4KX4A 3P8WA 1AUCA 1U88A 4EKZA 4DSSA 2B5XA 3IAS2 1XFLA 3DD3A 4HOJA 1FAAA 2R0GA 2DJ1A 2X8CA 5DAKB 3GL3A 1GULA 1OKDA 4HUAA 3FR3A 3LW9A 3KD0A 4E8HA 3UMAA 1T00A 2M80A 4MF7A 1B4QA 4WBJA 4EC0A 4G0LA 3N5OA 3D4TA 1OC8A 4ML1A 1HYUA 1GNWA 1ZL9A 3K8NA 4MZWA 2C4JA 1WJKA 1EV4A 1A8LA 1X5CA 3CMIA 3M1GA 5EL8A 1BAYA 2V6OA 4Q5NA 5DCHA 4J2FA 3UBLA 5JWRB 3C1RA 4OFMA 5HR1A 1ILOA 2EIQA 4Q5FA 2H0GA 1GSYA 4TR4A 2PPTA 4PXOA 2HFDA 2IN3A 5A4WA 5A4UA 2L5OA 3W6GA 3DVWA 3TJBA 1Z7RA 3RBTA 2YV7A 1Z5YE 3M8NA 3GFKA 4WR4A 2TRXA 5D8IA 4OMVA 3D4MA 5AGYA 2N5FA 2B1KA 1ERVA 4DVCA 1UVZA 3NIVA 2J23A 1JZRA 3CSJA 3FZ5A 5F8BA 4I2UA 2TIRA 4TN8A 1Q98A 1UC7A 3GKMA 5G2ZA 13GSA 5JCUA 4NXIA 1ZYPA 2C3NA 5JCGA 2NDOA 2PVOC 5KN1A 3TKSE 2GSTA 2PVQA 1OYJA 3LJRA 3GRXA 2VL9A 1YF0A 1UN2A 5F0GA 1QMVA 4TR0A 5DALA 1EP7A 4XS1A 4YQMA 3ZTLA 4A5PA 4N0VA 2AJQB 2V41A 1OC9B 1BG5A 1RK4A 2A2SA 4EF0A 2IMDA 4V1Ap 4POLA 5DJLA 2ZNMA 1ZCPA 3GUSA 3C7MA 3GKKA 5L71A 4KF9A 5H5SA 3DEXA 1PQNA 4X4JA 5CNWA 1WWJA 4KA0A 3PH9A 4I2TA 1EP8A 2JSYA 4FYCA 1YZXA 1T3BA 3VWVA 2XBIA 3CRUA 3ZMKA 4CDOA 2V6KA 1MD4A 3Q6OA 5EVOA 2CZ3A 3VK9A 2QSIA 5ECRB 3M9JA 3KJYA 2ZUPA 4K1FA 4KSOA 1I9DA 1EEMA 2YWOA 4HDEA 4DSQA 2VM2A 1X9WB 1YF1A 3LQ7A 4N10A 1QUWA 3A2XA 4H86A 2H70A 1MEKA 1YEXA 3HZ8A 1U3AA 2E2MA 1M2BA 18GSA 2V32A 4K5RA 5DCGA 2L6DA 2CVKA 4AJ6A 1GLPA 1BQ7A 3DIEA 4NAXA 1FB0A 4IBPA 2RM6A 2QGVA 2H76A 3FEUA 2DKHA 2N5AA 2WULA 2MBTA 3IXRA 5HR3A 2GQKA 4QL9A 1TK8B 1WOUA 4GXZA 1XZOA 4MLYA 1WPIA 3FYGA 2VUPA 3RPPA 4MZCA 3A2WA 1CQHA 3J7Yk 3KXOA 3RHCA 1DSBA 3GYKA 4OWYA 5GZZB 1SYXA 2HI7A 4OFNA 4XS4B 1XXUA 5G1KA 2GSSA 4I5QA 2GTUA 1ON4A 4BVYB 3R3EA 11GSA 1PSQA 3LORA 4EXJA 2XPDA 3RHBA 1T7PB 3UARA 2YWMA 3I69A 3CRTA 5ECQB 5CRDA 3UBKA 2GSRA 4F0BA 2QC7A 2IMFA 2PBJA 2HRFA 1TDIA 4MA9A 4FO5A 4F03A 3ZZXA 1B4PA 5ID2A 3DVXA 3VLNA 3FW2A 2GSQA 4GF0A 3KMOA 4HS1A 2FLSA 4PQIA 5IOWA 3H4KA 2LJKA 1GUMA 5GSSA 4FIWA 3F3RA 4KW6A 3VWWA 1YKCA 2CZ2A 3WT2A 3ZYWA 3KGKA 4L8EA 2K9FA 2E7PA 4F9ZA 5DQYA 3ZITA 4XRAA 5HFIA 2CX3A 3P7XA 2YNXA 1TU7A 2LKUA 5ECLB 1VGLA 3UIWA 1TK0B 2HT9A 3LEFA 1XWGA 1Y25A 1IYHA 4TXOB 3I6AA 3H8QA 3U6VA 4PNGA 3KCMA 4MJCA 4K7IA 1ZYNA 1PMTA 2NTOA 2X49A 3KM6A 1LU4A 2H6ZA 5ECKB 3C1SA 3TJKA 2B5YA 2O87A 1XVQA 2YP6A 2VCZA 5H5QA 5INYA 2VIMA 5D96A 1TRVA 5CRWA 1BX9A 4RUVA 2DMLA 4KAEA 4KCAA 1GTIA 2GQMA 3FKFA 1PRXA 1TRUA 4D73A 3D21A 4Z2TA 2VO4A 2XC2A 1A2JA 3FR6A 4K6XA 4EIQA 4IN0A 3P2AA 2HSHA 1I5GA 2CVBA 5ELAA 1B9YC 1TP9A 4O5QA 4XS4A 2R5GA 4NMUA 1THXA 5KOXA 1NSWA 2GLRA 3MIXA 2ES7A 2XHFA 4MABA 4XTSA 1OAZA 4EIPA 3FHKA 2B7JA 2H1GA 2LQOA 2B3SA 4KDXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HD2 A;  1JHB A;  1GTU A;  4X43 A;  1ST9 A;  2LUS A;  3HZ4 A;  5CYY A;  4O32 A;  4PX1 A;  2CT6 A;  1SJI A;  3KZQ A;  4QL7 A;  5CO3 A;  2E0Q A;  1XPV A;  2K18 A;  2XBQ A;  3C71 A;  2HE3 A;  5GST A;  4OCF A;  1TOF A;  4ZBB A;  4GSS A;  2WJU A;  12GS A;  2DJK A;  3KH7 A;  1FO5 A;  3G7Y A;  2LRC A;  3DWV A;  3F4R A;  1K0O A;  1JLV A;  5DDL A;  2HZE B;  4JU5 A;  5LNK e;  1M2D A;  2HZF A;  5IO2 A;  2H8L A;  1WE0 A;  2OE0 A;  3IR4 A;  1RW1 A;  4EL1 A;  4BA7 A;  3L0H A;  3ZVJ A;  1WP0 A;  4V2M A;  2PU9 C;  3HJO A;  1PGT A;  3GH9 A;  1PKW A;  1SK0 A;  3VPT A;  4IJI A;  2K8V A;  4I8B A;  2F51 A;  2C0D A;  1AQW A;  2I3Y A;  5ECO B;  5G5F A;  2H6X A;  3HYP A;  5J3R A;  5DQS A;  3R2Q A;  1FW1 A;  1YEP A;  3DXB A;  2MMN A;  1Z3E A;  1T8E B;  3EU4 A;  3GN3 A;  2CA8 A;  2C0E A;  3GNJ A;  1NM3 A;  3IAM 2;  1YDK A;  1PKZ A;  2HYX A;  1AXD A;  5CRG A;  22GS A;  2HSY A;  2WZ9 A;  1GUH A;  1SK2 A;  1X5D A;  1ZYE A;  4GQC A;  1A2L A;  4TR1 B;  3CTF A;  2WB9 A;  4GTU A;  4Q5Q A;  1DBY A;  2VL3 A;  1XW9 A;  2E2G A;  1GSU A;  1X5E A;  3TRX A;  2DSA A;  16GS A;  5DBQ A;  1GSD A;  2YWI A;  3KP8 A;  3ZML A;  2IFQ A;  2OJL A;  1JLW A;  3M9K A;  5J4U A;  3DKS A;  1A0R P;  1NW2 A;  2H6Y A;  2REM A;  3AY8 A;  5HR2 A;  4ECI A;  2FCH A;  2GZZ A;  1K3Y A;  4JR4 A;  3TKP A;  4YQU A;  3HJM A;  3FK8 A;  1XWK A;  3CYN A;  3EU3 A;  1SD8 A;  3LXT A;  1PL2 A;  3GUR A;  3IPZ A;  4LMV A;  2H74 A;  4EVM A;  4PGT A;  3IOS A;  4KUN A;  2YZH A;  2LJR A;  4ZBA A;  4AF2 A;  4YH2 A;  1O8X A;  2DJ0 A;  1ERW A;  1F2E A;  1XOA A;  2K8S A;  3ZFB A;  3APQ A;  2VCQ A;  3DYR A;  3GST A;  3IHQ A;  4JR6 A;  5CRE A;  1VF1 A;  4MJB A;  2NVL A;  3GTU B;  1KBN A;  4EO3 A;  2VD1 A;  3IDV A;  2FY6 A;  1SU9 A;  1VF3 A;  3F3Q A;  3KH9 A;  2VCX A;  5IIZ A;  3GIX A;  5COH A;  3ISO A;  3ERG A;  2HLS A;  3DGQ A;  5D9X A;  5J5N A;  3FZ4 A;  4YAV A;  3FY7 A;  5F05 A;  3LFL A;  2LS5 A;  5ELG A;  4X0X A;  2C0F A;  1V98 A;  3ZIJ A;  1ERU A;  5IMZ A;  1SJZ A;  4GWR A;  4N0Z A;  4WR5 A;  5IMD A;  4N11 A;  4ECB A;  4HQS A;  4BVX A;  1JZO A;  4L0W A;  5H5R A;  2FNO A;  5IQY A;  2VLV A;  2HNL A;  4POK A;  3NOF A;  5CRH A;  2IL3 A;  3KTL A;  4TW5 A;  4EE0 A;  3LWA A;  2LRN A;  5E59 A;  4ZIL A;  3TCO A;  4DSR A;  1G6W A;  4LL4 B;  4MH2 A;  1N2A A;  5HFG A;  3N9J A;  1GSS A;  3W8J A;  1ML6 A;  1Y6E A;  5J41 A;  3KEB A;  2YJ7 A;  5F06 A;  4KND A;  3LXZ A;  5B8B A;  2GGT A;  1ZOF A;  5DAK A;  4K2D A;  5HR0 A;  2NBS A;  4WET A;  2FWF A;  1JFU A;  3BBY A;  2N5B A;  2Z9S A;  3O6T A;  1EOH A;  2K6V A;  2H75 A;  3IC4 A;  3CTG A;  1JZW A;  2ZCT A;  4L0U A;  4TRX A;  5HFK A;  4KB3 A;  3H1N A;  1BYE A;  4YQV A;  2I1U A;  5B8A A;  1H75 A;  1KTE A;  3TJG A;  2VCT A;  4XCS A;  5D73 A;  4LLR A;  1R4W A;  2M66 A;  4PQ1 A;  2GT5 A;  3FRC A;  4JBB A;  4WXT A;  2G2Q A;  1ACV A;  3JCM L;  3GTU A;  4J56 E;  4ISD A;  3CSH A;  5B7C A;  3RAZ A;  5IMA A;  17GS A;  2BMX A;  1X0R A;  3MSZ A;  1BED A;  2PGT A;  1SJ6 A;  3H93 A;  4G19 A;  2P0G A;  6GSS A;  4JZQ A;  1K3L A;  3QAW A;  2IME A;  1DE2 A;  1B48 A;  1LBK A;  2PUK C;  4K0N A;  4G10 A;  5G5E A;  1GP1 A;  3HVV A;  1TW9 A;  3S9F A;  1ZYQ B;  2O89 A;  3F63 A;  3TOU A;  2H1A A;  5A4V A;  4PQH A;  5C00 A;  3ZRD A;  2V1M A;  3C73 A;  3GHA A;  2F8F A;  3D5J A;  3EUR A;  2LNT A;  4ZL8 A;  3EE2 A;  4KDU A;  3APS A;  3CBU A;  4IGJ A;  2L59 A;  5FT3 A;  3Q19 A;  2C8U A;  2ALB A;  3F6D A;  2TRC P;  1GTB A;  4BWS A;  2P5R A;  4ULX A;  1OKT A;  2H0I A;  2H19 A;  2OA7 A;  1OC9 A;  3GL5 A;  4EUY A;  1K0D A;  3MAK A;  2H66 A;  3GKX A;  2VOC A;  1GL8 A;  5ECS A;  1TK5 B;  2M72 A;  1R5P A;  4V1A g;  1FHE A;  3TRQ A;  3UAP A;  3BD2 A;  2O7K A;  2VAF A;  2VLU A;  1QQ2 A;  2A2R A;  2A4V A;  3QAV A;  1T4Y A;  2C3Q A;  4F0C A;  2DJJ A;  2ON5 A;  1B8X A;  2X8G A;  3D22 A;  2OE3 A;  4RI7 A;  3O3T A;  1UA5 A;  3PR8 A;  2OAC A;  4JRR A;  2JAC A;  4ILF A;  1SL1 B;  4RQX A;  1PD2 1;  4O92 A;  3HDC A;  3LSZ A;  1A23 A;  5ECH B;  1AC1 A;  1Z9H A;  3KP9 A;  4DEJ A;  1MDI A;  1K0N A;  5HQP A;  1U87 A;  2C80 A;  4GST A;  3LYP A;  1V2A A;  2J9H A;  1USB A;  1K0M A;  1XWA A;  4XHM A;  1V57 A;  1YJ6 A;  3M3M A;  9GSS A;  4XRD A;  2GVP A;  1T1V A;  5CP1 A;  5IO0 A;  2B5E A;  3W8S A;  6GSW A;  1FVK A;  1ERT A;  1VF4 A;  3ERW A;  2VL2 C;  1F6M C;  2R2J A;  1YY7 A;  1M9B A;  5LD0 A;  1AQX A;  1SD9 A;  3IK7 A;  3HVX A;  1X9M B;  5G30 A;  2AB6 A;  1TI1 A;  1O73 A;  1OE7 A;  4GCI A;  6GSX A;  4OD7 A;  2CAI A;  1E2Y A;  1Z6M A;  3APO A;  4OO5 A;  1R7H A;  3FZ9 A;  2C3T A;  1MDJ A;  2O85 A;  2WDU A;  1G6Y A;  4ECC A;  4BVY A;  2EC4 A;  2MYG A;  2B7K A;  2B1L A;  1QFN A;  5D9V A;  3WGD A;  2P31 A;  6GSU A;  3G7J A;  3ZFL A;  4CW9 A;  1NHO A;  3IRA A;  5ENU A;  3QOU A;  2FGX A;  3HY2 A;  3L9V A;  5AIV A;  4LL1 B;  4PUF C;  4V2L A;  5GAN D;  2HXK A;  5DVB A;  4IQA A;  1K0C A;  3ME7 A;  1WRY A;  4QQ7 A;  1TU8 A;  4TOP A;  4OCE A;  3BCI A;  2GQL A;  3GH6 A;  2C1Y A;  1JZD A;  4KCE A;  3QFB C;  5D93 A;  1YQ1 A;  5G1L A;  2HRN A;  3EWL A;  5IM9 A;  1FVJ A;  3ZRE A;  5IMF A;  1O6J A;  3HXS A;  3UOM A;  2FUG 2;  3RPN A;  2R6K A;  3BCK A;  2M46 A;  1K0A A;  3KTB A;  1EOG A;  5DJM A;  3IBH A;  1V9W A;  1YKA A;  2DBC A;  2YZU A;  3TB2 A;  2O8V B;  3TGZ A;  3QDN A;  4PUA A;  3TUE A;  2L5L A;  5C04 A;  5F07 A;  3I9V 2;  4L5L A;  4TVE A;  3EVI A;  1K3O A;  3CXG A;  2YWN A;  4TXO A;  1G7D A;  2L4C A;  3L9U A;  4OFT A;  3TKR A;  4BPY A;  3J7Y b;  2BJX A;  2WFC A;  1F3B A;  4IW9 A;  4JED A;  4ZB6 A;  1ABA A;  4MH3 A;  2EIO A;  5ECI B;  2H01 A;  1EV9 A;  1DE1 A;  5EY6 A;  1QXH A;  3UL3 A;  1OVN A;  2KHP A;  5JWO B;  4MPF A;  1M9A A;  1A2M A;  2LQQ A;  4K9Z A;  1HNC A;  2IIY A;  1X9S B;  1A8Y A;  4HZ2 A;  2YAN A;  1PA3 A;  1AAZ A;  3HHV A;  1O8W A;  5D9W A;  1NHY A;  4N30 A;  4G9H A;  4GQF A;  4K8M A;  5DAL B;  3LGC A;  2H73 A;  2KP2 A;  3SWL A;  2IWT A;  1AIU A;  5CAX A;  1URM A;  3F4T A;  2MMA A;  2DIZ A;  2VLT A;  4K7N A;  6GSV A;  2I9H A;  4RQR A;  4ZB8 A;  3RDW A;  1SL0 B;  3QD9 A;  4HEA 2;  1AW9 A;  1ZZY A;  2PMT A;  1MD3 A;  1SL2 B;  4WBR D;  5LCZ A;  3WGE A;  1EZK A;  4XIH A;  1GTA A;  2C0G A;  1XCC A;  3A2V A;  4O5R A;  1GSE A;  1T4Z A;  3D0Z A;  4HI7 A;  4HU9 A;  2RUF A;  1PX7 A;  1S3D A;  2H0H A;  5A5K A;  2FD3 A;  2GZY A;  4KE3 A;  2H1D A;  2R37 A;  14GS A;  4KH7 A;  2CV4 A;  1ZGN A;  3EYT A;  3IK9 A;  3BOA A;  2OBK A;  4MCU A;  2HZE A;  1QK8 A;  1XIY A;  4NHZ A;  1J0F A;  4MDC A;  2MMZ A;  5AIX A;  4TKY A;  1V58 A;  2VL2 A;  4F82 A;  1BJX A;  1PL1 A;  5IMV A;  1WIK A;  2G0F A;  2EIR A;  2WGR A;  4KSM A;  4L5O A;  2I81 A;  5IPG A;  6GST A;  4MJE A;  5KN2 A;  1GLQ A;  4NWY A;  4IKH A;  1S3C A;  4FYB A;  2RUE A;  3TOT A;  3DRN A;  3QR6 A;  4J57 E;  4K7O A;  2F8A A;  1AQV A;  1A0F A;  1M99 A;  4MK3 A;  1C72 A;  2LNS A;  2H30 A;  2AV4 A;  1R5A A;  2LV3 A;  3VWX A;  3QFA C;  3ME8 A;  2FWG A;  2F3M A;  3E9J B;  5IPH A;  2DLX A;  2YJH A;  4TR1 A;  5KEJ A;  2IJY A;  2IMI A;  3EMX A;  2YCD A;  3BJ5 A;  4ACS A;  2PWJ A;  4MZB A;  1PX6 A;  4O7H A;  3L4N A;  1FB6 A;  4POM A;  5ID2 B;  3TJF A;  3QAG A;  1U6T A;  3E3E A;  3G7I A;  1XWB A;  2AAW A;  5ECP B;  1S3A A;  3HKR A;  4ZXG A;  1EWX A;  5ECM B;  2LRT A;  2P5Q A;  2WS2 A;  4HU7 A;  3MNG A;  2VD0 A;  2FA8 A;  3D6I A;  1Z6N A;  1XWC A;  5AIS A;  4HQZ A;  2YN1 A;  4KDY A;  1F3A A;  3I43 A;  2CVD A;  2LST A;  3TKS C;  3HD5 A;  4MPG A;  3GMF A;  2JSZ A;  4POB A;  2CX4 A;  4E8E A;  3KIJ A;  5EPF A;  1W4V A;  4HZ4 A;  5IMC A;  2FWH A;  5G31 A;  1MDK A;  2H72 A;  1SKR B;  3VUR A;  3U5R E;  4IHU A;  4IQ1 A;  3ZL5 A;  3F8U A;  2YV9 A;  10GS A;  4BWQ A;  4GRF A;  4IJ3 A;  4ID0 A;  3E0U A;  2D2Z A;  8GSS A;  1A24 A;  1HNB A;  3Q74 A;  1GWC A;  3GKN A;  3NZN A;  7GSS A;  3A3T A;  4RI6 A;  3OR5 A;  4LA1 A;  2QKE A;  4IP6 A;  5KN0 A;  2X99 A;  1LJR A;  4WF5 A;  2LJA A;  4P3Y B;  1O81 A;  3Q18 A;  1OE8 A;  4IP1 A;  3C8E A;  2FWE A;  2R3X A;  1KEB A;  3KMN A;  2DIY A;  4D73 B;  1OC3 A;  5D9T A;  2ON7 A;  1MTC A;  1XOB A;  3WYW A;  1O7U A;  3TJJ A;  4ZL7 A;  2V2G A;  4PUR A;  4NHW A;  2WCI A;  1THO A;  3ED3 A;  3IA1 A;  2RM5 A;  1HQO A;  2YOI A;  1M0U A;  3ERF A;  4WKW A;  1CQG A;  1TRW A;  1EEJ A;  4JE1 A;  2OKA A;  1F37 A;  5ECN B;  4YAP A;  3QPM A;  1G0T A;  1SYR A;  3VI7 A;  4I97 A;  4WF4 A;  4HJM A;  4LMW A;  1SKS B;  2X64 A;  4IS0 A;  2L57 A;  1GSQ A;  2FA4 A;  1RQM A;  4X1U A;  3UJ1 A;  5FWG A;  2DJ2 A;  3CSI A;  3IE3 A;  4ECJ A;  1TRS A;  3SBC A;  1SKW B;  1N8J A;  4ZB9 A;  4AJ7 A;  1F9M A;  2IPA A;  4MF5 A;  3WD6 A;  1QGV A;  3PGT A;  4AGS A;  4CHS A;  3VI5 A;  2AUV A;  3EIN A;  4HJ2 A;  2KP1 A;  5E4W A;  4KGI A;  3UVH A;  2OE1 A;  3HVS A;  1Q4J A;  2JZS A;  2JL4 A;  3TDG A;  3HA9 A;  5B6N A;  2OAD A;  4NPB A;  5FHI A;  1ZMA A;  4Z7X A;  1GRX A;  5GAP D;  3GX8 A;  3MDK A;  1DUG A;  1GSF A;  2X8H A;  2GS3 A;  1GUK A;  5JCW A;  2GDR A;  2BTO T;  1PN9 A;  1FOV A;  2LEG A;  2NPB A;  1XW5 A;  4Q5R A;  2JU5 A;  4K0G A;  2I4A A;  4ZL9 A;  2MBS A;  5ABR A;  2DMM A;  1XVW A;  3ZIV A;  3UEM A;  3US3 A;  3IV4 A;  3FR9 A;  1J08 A;  5KN3 A;  2XPE A;  2WRT A;  2RLI A;  3VPQ A;  2F9S A;  2DJ3 A;  3V1W A;  1XW6 A;  3HCZ A;  2KUC A;  5J9B A;  3WT1 A;  2KLX A;  1B9X C;  2JZT A;  3A5W A;  3ZVJ D;  2LTK A;  3HJP A;  1EGO A;  1W89 A;  3GA4 A;  2PN8 A;  3G9B A;  1O85 A;  3TRP A;  5IOX A;  4NV5 A;  20GS A;  1R26 A;  4DSS B;  2OBI A;  1TJD A;  2JAD A;  2VCW A;  4WEY A;  3GSS A;  3ZLP A;  2FHE A;  1TTZ A;  2IMK A;  1SK1 A;  3MWH A;  2IFQ B;  1TKD B;  3VFI A;  4NV2 A;  4MJA A;  4BL7 A;  2VM1 A;  1G7O A;  1E6B A;  1WMJ A;  2KOK A;  2L6C A;  3F6F A;  3TKS A;  3QCP A;  4PNF A;  1VRS D;  2VCV A;  2R4V A;  1U3I A;  3F4S A;  2B6M A;  3GX0 A;  3EMP A;  1M2A A;  1IYI A;  2MZC A;  1Z7P A;  2YPM A;  3F0I A;  2PER A;  5J9C A;  3TKQ A;  1HNA A;  3PIN A;  3EC3 A;  4TXV A;  1VF2 A;  4ML6 A;  2RII A;  2GT6 A;  1V40 A;  4FYU A;  4MP4 A;  4EDY A;  4IVF A;  1EGR A;  1M7T A;  3L78 A;  2DC5 A;  1FG4 A;  4GLT A;  2H1B A;  4I6X A;  2H71 A;  5AN1 A;  4TR3 A;  2MMO A;  3QMX A;  4ZBD A;  4GSN A;  5B6M A;  4FH8 A;  3L9S A;  3P90 A;  2CAQ A;  4OO4 A;  1KNG A;  3M0F A;  3LG6 A;  1TXX A;  4XS6 A;  3VWU A;  3DML A;  1H4O A;  3F9U A;  2L4Q A;  4EDZ A;  1J9B A;  1GNE A;  1GH2 A;  3LYK A;  4MF6 A;  3WGX A;  3GV1 A;  5JWQ B;  4V2N A;  2JZR A;  1G7E A;  3O76 A;  4IEL A;  1K0B A;  6GSY A;  3H79 A;  1XBS A;  19GS A;  2GZP A;  4MMM A;  3UVT A;  4AJ8 A;  2AYT A;  3FZA A;  2CQ9 A;  1SEN A;  2AHE A;  4G2E A;  4ZIJ A;  1TI3 A;  4F2I A;  3P8W A;  4KX4 A;  1AUC A;  1U88 A;  4EKZ A;  4DSS A;  2B5X A;  3IAS 2;  1XFL A;  3DD3 A;  4HOJ A;  1FAA A;  2DJ1 A;  2X8C A;  5DAK B;  3GL3 A;  1GUL A;  1OKD A;  4HUA A;  3FR3 A;  3KD0 A;  4E8H A;  3UMA A;  1T00 A;  2M80 A;  4MF7 A;  1B4Q A;  4WBJ A;  4EC0 A;  3N5O A;  3D4T A;  1OC8 A;  4ML1 A;  1HYU A;  1GNW A;  1ZL9 A;  3K8N A;  4MZW A;  2C4J A;  1WJK A;  1EV4 A;  1A8L A;  1X5C A;  3CMI A;  3M1G A;  5EL8 A;  1BAY A;  2V6O A;  4Q5N A;  5DCH A;  4J2F A;  3UBL A;  5JWR B;  3C1R A;  4OFM A;  5HR1 A;  1ILO A;  2EIQ A;  4Q5F A;  2H0G A;  1GSY A;  4TR4 A;  2PPT A;  4PXO A;  2HFD A;  2IN3 A;  5A4W A;  5A4U A;  2L5O A;  3W6G A;  3DVW A;  3TJB A;  1Z7R A;  3RBT A;  2YV7 A;  1Z5Y E;  3M8N A;  3GFK A;  4WR4 A;  2TRX A;  5D8I A;  4OMV A;  3D4M A;  5AGY A;  2N5F A;  2B1K A;  1ERV A;  4DVC A;  1UVZ A;  3NIV A;  2J23 A;  1JZR A;  3CSJ A;  3FZ5 A;  5F8B A;  4I2U A;  2TIR A;  4TN8 A;  1Q98 A;  1UC7 A;  3GKM A;  5G2Z A;  13GS A;  5JCU A;  4NXI A;  2C3N A;  5JCG A;  2NDO A;  2PVO C;  5KN1 A;  3TKS E;  2GST A;  2PVQ A;  1OYJ A;  3LJR A;  3GRX A;  2VL9 A;  1YF0 A;  1UN2 A;  5F0G A;  1QMV A;  4TR0 A;  5DAL A;  1EP7 A;  4XS1 A;  4YQM A;  3ZTL A;  4N0V A;  2AJQ B;  2V41 A;  1OC9 B;  1BG5 A;  1RK4 A;  2A2S A;  4EF0 A;  2IMD A;  4V1A p;  4POL A;  5DJL A;  2ZNM A;  1ZCP A;  3GUS A;  3C7M A;  3GKK A;  5L71 A;  5H5S A;  3DEX A;  1PQN A;  5CNW A;  1WWJ A;  4KA0 A;  3PH9 A;  4I2T A;  1EP8 A;  2JSY A;  4FYC A;  1YZX A;  1T3B A;  3VWV A;  2XBI A;  3CRU A;  3ZMK A;  4CDO A;  2V6K A;  1MD4 A;  3Q6O A;  5EVO A;  2CZ3 A;  3VK9 A;  2QSI A;  5ECR B;  3M9J A;  3KJY A;  2ZUP A;  4K1F A;  4KSO A;  1I9D A;  1EEM A;  2YWO A;  4HDE A;  4DSQ A;  2VM2 A;  1X9W B;  1YF1 A;  3LQ7 A;  4N10 A;  1QUW A;  3A2X A;  4H86 A;  2H70 A;  1MEK A;  1YEX A;  3HZ8 A;  1U3A A;  2E2M A;  1M2B A;  18GS A;  2V32 A;  5DCG A;  2L6D A;  2CVK A;  4AJ6 A;  1GLP A;  1BQ7 A;  3DIE A;  4NAX A;  1FB0 A;  4IBP A;  2RM6 A;  2QGV A;  2H76 A;  3FEU A;  2N5A A;  2WUL A;  2MBT A;  3IXR A;  5HR3 A;  2GQK A;  4QL9 A;  1TK8 B;  1WOU A;  4GXZ A;  1XZO A;  4MLY A;  1WPI A;  3FYG A;  2VUP A;  3RPP A;  4MZC A;  3A2W A;  1CQH A;  3J7Y k;  3KXO A;  3RHC A;  1DSB A;  3GYK A;  4OWY A;  5GZZ B;  1SYX A;  2HI7 A;  4OFN A;  4XS4 B;  1XXU A;  5G1K A;  2GSS A;  4I5Q A;  2GTU A;  1ON4 A;  11GS A;  1PSQ A;  3LOR A;  4EXJ A;  2XPD A;  3RHB A;  1T7P B;  3UAR A;  2YWM A;  3I69 A;  3CRT A;  5ECQ B;  5CRD A;  3UBK A;  2GSR A;  4F0B A;  2QC7 A;  2IMF A;  2PBJ A;  2HRF A;  1TDI A;  4MA9 A;  4FO5 A;  4F03 A;  3ZZX A;  1B4P A;  5ID2 A;  3DVX A;  3VLN A;  3FW2 A;  2GSQ A;  4GF0 A;  3KMO A;  4HS1 A;  2FLS A;  4PQI A;  5IOW A;  3H4K A;  2LJK A;  1GUM A;  5GSS A;  4FIW A;  3F3R A;  4KW6 A;  3VWW A;  1YKC A;  2CZ2 A;  3WT2 A;  3ZYW A;  3KGK A;  4L8E A;  2K9F A;  2E7P A;  4F9Z A;  5DQY A;  3ZIT A;  4XRA A;  5HFI A;  2CX3 A;  3P7X A;  2YNX A;  1TU7 A;  2LKU A;  5ECL B;  1VGL A;  3UIW A;  1TK0 B;  2HT9 A;  3LEF A;  1XWG A;  1Y25 A;  1IYH A;  4TXO B;  3I6A A;  3H8Q A;  3U6V A;  4PNG A;  3KCM A;  4MJC A;  4K7I A;  1PMT A;  2NTO A;  3KM6 A;  1LU4 A;  2H6Z A;  5ECK B;  3C1S A;  3TJK A;  2B5Y A;  2O87 A;  1XVQ A;  2YP6 A;  2VCZ A;  5H5Q A;  5INY A;  2VIM A;  5D96 A;  1TRV A;  5CRW A;  1BX9 A;  4RUV A;  2DML A;  4KAE A;  4KCA A;  1GTI A;  2GQM A;  3FKF A;  1PRX A;  1TRU A;  4D73 A;  3D21 A;  2VO4 A;  2XC2 A;  1A2J A;  3FR6 A;  4K6X A;  4IN0 A;  3P2A A;  2HSH A;  1I5G A;  2CVB A;  5ELA A;  1B9Y C;  1TP9 A;  4XS4 A;  2R5G A;  4NMU A;  1THX A;  1NSW A;  2GLR A;  2ES7 A;  2XHF A;  4MAB A;  4XTS A;  1OAZ A;  3FHK A;  2B7J A;  2H1G A;  2LQO A;  2B3S A;  4KDX A; 
#chains in the Genus database with same CATH topology
 1HD2 A;  2HRA A;  1JHB A;  1GTU A;  4X43 A;  1ST9 A;  2LUS A;  3HZ4 A;  5CYY A;  4O32 A;  4PX1 A;  2CT6 A;  1SJI A;  3KZQ A;  4QL7 A;  5CO3 A;  2E0Q A;  1XPV A;  2K18 A;  2XBQ A;  3C71 A;  2HE3 A;  5GST A;  4OCF A;  1TOF A;  4ZBB A;  4GSS A;  2WJU A;  12GS A;  2DJK A;  3KH7 A;  4CY8 A;  1FO5 A;  3G7Y A;  2LRC A;  3DWV A;  3F4R A;  1K0O A;  1JLV A;  5DDL A;  2HZE B;  4JU5 A;  5LNK e;  1M2D A;  2HZF A;  5IO2 A;  2H8L A;  1WE0 A;  2OE0 A;  3IR4 A;  1RW1 A;  4EL1 A;  4BA7 A;  3L0H A;  3ZVJ A;  1WP0 A;  4V2M A;  4Z2R A;  2PU9 C;  3HJO A;  1PGT A;  3GH9 A;  1PKW A;  1SK0 A;  3VPT A;  4IJI A;  2K8V A;  4I8B A;  2F51 A;  2C0D A;  1AQW A;  2I3Y A;  5ECO B;  5G5F A;  2H6X A;  3MYD A;  3HYP A;  5J3R A;  5DQS A;  3PPU A;  3R2Q A;  1FW1 A;  1YEP A;  3DXB A;  2HSM A;  2MMN A;  1Z3E A;  1T8E B;  3EU4 A;  3GN3 A;  2UZ8 A;  2CA8 A;  2C0E A;  3GNJ A;  1NM3 A;  3IAM 2;  1YDK A;  1PKZ A;  5KOW A;  2HYX A;  1AXD A;  5CRG A;  22GS A;  2HSY A;  2WZ9 A;  1GUH A;  1SK2 A;  1X5D A;  1ZYE A;  4GQC A;  1A2L A;  4TR1 B;  3CTF A;  2WB9 A;  4GTU A;  4Q5Q A;  1DBY A;  2VL3 A;  1XW9 A;  2X4A A;  2E2G A;  1GSU A;  1X5E A;  3TRX A;  2DSA A;  16GS A;  5DBQ A;  1GSD A;  2YWI A;  3KP8 A;  3ZML A;  2IFQ A;  2OJL A;  1JLW A;  3M9K A;  5J4U A;  3DKS A;  1A0R P;  1NW2 A;  2H6Y A;  2REM A;  3AY8 A;  5HR2 A;  4ECI A;  2FCH A;  2GZZ A;  1K3Y A;  4JR4 A;  3TKP A;  4YQU A;  3HJM A;  3FK8 A;  1XWK A;  3CYN A;  3EU3 A;  1SD8 A;  3LXT A;  1PL2 A;  3GUR A;  3IPZ A;  4LMV A;  2H74 A;  4EVM A;  4PGT A;  3IOS A;  4KUN A;  2YZH A;  2LJR A;  4ZBA A;  4AF2 A;  4YH2 A;  1O8X A;  2DJ0 A;  1ERW A;  1F2E A;  1XOA A;  2K8S A;  3ZFB A;  3APQ A;  2VCQ A;  3DYR A;  3GST A;  3IHQ A;  2R0C A;  4JR6 A;  5CRE A;  1VF1 A;  4MJB A;  2NVL A;  3GTU B;  1KBN A;  4EO3 A;  2VD1 A;  3IDV A;  2FY6 A;  1SU9 A;  1VF3 A;  3F3Q A;  3KH9 A;  2VCX A;  5IIZ A;  3GIX A;  5COH A;  3ISO A;  3ERG A;  2HLS A;  4K2X A;  3DGQ A;  5D9X A;  5J5N A;  3FZ4 A;  4YAV A;  3FY7 A;  5F05 A;  3LFL A;  2LS5 A;  5ELG A;  4X0X A;  2C0F A;  1V98 A;  3ZIJ A;  1ERU A;  5IMZ A;  1SJZ A;  4GWR A;  4N0Z A;  4WR5 A;  5IMD A;  4N11 A;  4ECB A;  4HQS A;  4BVX A;  1PFO A;  1JZO A;  4L0W A;  5H5R A;  3IC8 A;  2FNO A;  5IQY A;  2VLV A;  2HNL A;  4POK A;  3NOF A;  5CRH A;  2IL3 A;  3KTL A;  4TW5 A;  4EE0 A;  3LWA A;  2LRN A;  5E59 A;  4ZIL A;  3TCO A;  4DSR A;  1G6W A;  4LL4 B;  4MH2 A;  1N2A A;  5HFG A;  4K5S A;  3N9J A;  1GSS A;  3W8J A;  1ML6 A;  1Y6E A;  5J41 A;  3KEB A;  2YJ7 A;  5F06 A;  4KND A;  3LXZ A;  5B8B A;  2GGT A;  1ZOF A;  5DAK A;  4K2D A;  5HR0 A;  2NBS A;  4WET A;  2FWF A;  1JFU A;  3A5I A;  3BBY A;  2N5B A;  2Z9S A;  3O6T A;  1EOH A;  2K6V A;  2H75 A;  3IC4 A;  3CTG A;  1JZW A;  3FMW A;  2ZCT A;  4L0U A;  4TRX A;  5HFK A;  4KB3 A;  3H1N A;  1BYE A;  3IHG A;  4YQV A;  2I1U A;  5B8A A;  1H75 A;  1KTE A;  3TJG A;  2VCT A;  4XCS A;  5D73 A;  4LLR A;  1R4W A;  2M66 A;  4PQ1 A;  4G0K A;  2GT5 A;  3FRC A;  4JBB A;  4WXT A;  2G2Q A;  4CY6 A;  1ACV A;  3JCM L;  3GTU A;  4J56 E;  4ISD A;  3CSH A;  5B7C A;  3RAZ A;  5IMA A;  17GS A;  2BMX A;  1X0R A;  3MSZ A;  1BED A;  2PGT A;  1SJ6 A;  3H93 A;  4G19 A;  2P0G A;  6GSS A;  4JZQ A;  1K3L A;  3QAW A;  2IME A;  1DE2 A;  1B48 A;  1LBK A;  2PUK C;  4K0N A;  4G10 A;  5G5E A;  1GP1 A;  3HVV A;  1TW9 A;  3S9F A;  1ZYQ B;  2O89 A;  3F63 A;  3TOU A;  2H1A A;  5A4V A;  4PQH A;  5C00 A;  3ZRD A;  2V1M A;  3C73 A;  3GHA A;  2F8F A;  3D5J A;  3EUR A;  2LNT A;  4ZL8 A;  3EE2 A;  4KDU A;  3APS A;  3CBU A;  4IGJ A;  4BL7 B;  2L59 A;  5FT3 A;  3Q19 A;  2C8U A;  2ALB A;  3F6D A;  5BMU A;  2TRC P;  1GTB A;  4BWS A;  2R0P A;  2P5R A;  4ULX A;  1M3J A;  1OKT A;  2H0I A;  2H19 A;  2OA7 A;  1OC9 A;  3GL5 A;  4EUY A;  1K0D A;  3MAK A;  2H66 A;  3GKX A;  2VOC A;  1GL8 A;  5ECS A;  1TK5 B;  2M72 A;  1R5P A;  4V1A g;  1FHE A;  3TRQ A;  3UAP A;  3BD2 A;  2O7K A;  2VAF A;  2VLU A;  1QQ2 A;  2A2R A;  2A4V A;  2DKI A;  3QAV A;  1T4Y A;  2C3Q A;  4F0C A;  2DJJ A;  2ON5 A;  1B8X A;  2X8G A;  3D22 A;  2OE3 A;  4RI7 A;  3O3T A;  1UA5 A;  3PR8 A;  2OAC A;  4JRR A;  2JAC A;  4ILF A;  1SL1 B;  4RQX A;  1PD2 1;  4O92 A;  3HDC A;  3LSZ A;  1A23 A;  5ECH B;  1AC1 A;  1Z9H A;  3KP9 A;  4DEJ A;  1MDI A;  1K0N A;  5HQP A;  1U87 A;  2C80 A;  4GST A;  3LYP A;  1V2A A;  2J9H A;  1USB A;  1K0M A;  1XWA A;  4XHM A;  1V57 A;  1YJ6 A;  3M3M A;  9GSS A;  4XRD A;  2GVP A;  1T1V A;  5CP1 A;  5IO0 A;  2B5E A;  3W8S A;  6GSW A;  1FVK A;  1ERT A;  1VF4 A;  3ERW A;  2VL2 C;  1F6M C;  2R2J A;  1YY7 A;  1M9B A;  5LD0 A;  1AQX A;  1SD9 A;  3IK7 A;  3HVX A;  1X9M B;  5G30 A;  2AB6 A;  1TI1 A;  1O73 A;  1OE7 A;  4GCI A;  6GSX A;  4OD7 A;  2CAI A;  1E2Y A;  1Z6M A;  3APO A;  4OO5 A;  1R7H A;  3FZ9 A;  2C3T A;  1MDJ A;  2O85 A;  2WDU A;  1G6Y A;  4ECC A;  4BVY A;  2EC4 A;  2MYG A;  2B7K A;  2B1L A;  1QFN A;  5D9V A;  3WGD A;  2P31 A;  6GSU A;  3G7J A;  3ZFL A;  4CW9 A;  1NHO A;  3IRA A;  5ENU A;  3QOU A;  2FGX A;  3HY2 A;  3L9V A;  5AIV A;  3HVN A;  4LL1 B;  4PUF C;  4V2L A;  5GAN D;  2HXK A;  5DVB A;  4IQA A;  1K0C A;  3ME7 A;  1WRY A;  4QQ7 A;  1TU8 A;  4TOP A;  1PN0 A;  4OCE A;  3BCI A;  2GQL A;  3GH6 A;  2C1Y A;  1JZD A;  4KCE A;  3QFB C;  5D93 A;  1YQ1 A;  4USS A;  5G1L A;  2HRN A;  3EWL A;  5IM9 A;  5BRT A;  1FVJ A;  3ZRE A;  5IMF A;  1O6J A;  3HXS A;  3UOM A;  2FUG 2;  3RPN A;  2R6K A;  3EPT A;  3BCK A;  2M46 A;  1K0A A;  3KTB A;  1EOG A;  5DJM A;  3IBH A;  1V9W A;  1YKA A;  2DBC A;  2YZU A;  3TB2 A;  2O8V B;  3TGZ A;  3QDN A;  4PUA A;  3TUE A;  2L5L A;  5C04 A;  5F07 A;  3I9V 2;  4L5L A;  4TVE A;  3EVI A;  1K3O A;  3CXG A;  2YWN A;  4TXO A;  1G7D A;  2L4C A;  3L9U A;  4OFT A;  3TKR A;  4BPY A;  3J7Y b;  2BJX A;  2WFC A;  1F3B A;  4IW9 A;  4JED A;  4ZB6 A;  1ABA A;  2HRK A;  4MH3 A;  2EIO A;  5ECI B;  2H01 A;  1EV9 A;  1DE1 A;  5EY6 A;  1QXH A;  3UL3 A;  1OVN A;  2KHP A;  5JWO B;  4MPF A;  1M9A A;  1A2M A;  2LQQ A;  4K9Z A;  1HNC A;  2IIY A;  1X9S B;  1A8Y A;  4HZ2 A;  2YAN A;  1PA3 A;  1AAZ A;  3HHV A;  1O8W A;  1M3I A;  5D9W A;  1NHY A;  4N30 A;  4G9H A;  4GQF A;  4K8M A;  5DAL B;  3LGC A;  2H73 A;  2KP2 A;  3SWL A;  2IWT A;  1AIU A;  5CAX A;  1URM A;  3F4T A;  2MMA A;  2DIZ A;  2VLT A;  4K7N A;  6GSV A;  2I9H A;  4RQR A;  4ZB8 A;  3RDW A;  1SL0 B;  3QD9 A;  4HEA 2;  1AW9 A;  1ZZY A;  2PMT A;  1MD3 A;  1SL2 B;  4WBR D;  5LCZ A;  3WGE A;  1EZK A;  4XIH A;  1GTA A;  2C0G A;  1XCC A;  3A2V A;  4O5R A;  1GSE A;  1T4Z A;  3D0Z A;  4HI7 A;  4HU9 A;  4YKG A;  2RUF A;  1PX7 A;  1S3D A;  2H0H A;  5A5K A;  2FD3 A;  4G0I A;  2GZY A;  4KE3 A;  2H1D A;  2R37 A;  14GS A;  4KH7 A;  2CV4 A;  1ZGN A;  3EYT A;  3IK9 A;  3BOA A;  2OBK A;  4MCU A;  2HZE A;  1QK8 A;  1XIY A;  4NHZ A;  1J0F A;  4MDC A;  2MMZ A;  5AIX A;  4TKY A;  1V58 A;  2VL2 A;  4F82 A;  1BJX A;  1PL1 A;  5IMV A;  1WIK A;  2G0F A;  2EIR A;  2WGR A;  4KSM A;  4L5O A;  2I81 A;  5IPG A;  6GST A;  4MJE A;  5KN2 A;  1GLQ A;  4NWY A;  4IKH A;  1S3C A;  4FYB A;  2RUE A;  3TOT A;  3DRN A;  3QR6 A;  4J57 E;  4K7O A;  2F8A A;  1AQV A;  1A0F A;  1M99 A;  4MK3 A;  1C72 A;  2LNS A;  2H30 A;  2AV4 A;  1R5A A;  2LV3 A;  3VWX A;  3QFA C;  3ME8 A;  2FWG A;  2F3M A;  3E9J B;  5IPH A;  2DLX A;  4ICY A;  2YJH A;  4TR1 A;  5KEJ A;  2IJY A;  2IMI A;  3EMX A;  2YCD A;  3BJ5 A;  4ACS A;  4O5U A;  2PWJ A;  4MZB A;  1PX6 A;  4O7H A;  3L4N A;  1FB6 A;  4POM A;  5ID2 B;  3TJF A;  3QAG A;  1U6T A;  3E3E A;  3G7I A;  1XWB A;  2AAW A;  5ECP B;  1S3A A;  3HKR A;  4ZXG A;  1EWX A;  5ECM B;  2LRT A;  2P5Q A;  2WS2 A;  4HU7 A;  3MNG A;  2VD0 A;  2FA8 A;  3D6I A;  1Z6N A;  1XWC A;  5AIS A;  4HQZ A;  2YN1 A;  4KDY A;  1F3A A;  3I43 A;  2CVD A;  2LST A;  3TKS C;  3HD5 A;  4MPG A;  3GMF A;  2JSZ A;  4POB A;  2CX4 A;  4E8E A;  3KIJ A;  5EPF A;  1W4V A;  4HZ4 A;  5IMC A;  2FWH A;  5G31 A;  1MDK A;  2H72 A;  1SKR B;  3VUR A;  3U5R E;  4IHU A;  4IQ1 A;  3ZL5 A;  3F8U A;  2YV9 A;  10GS A;  4BWQ A;  4GRF A;  4IJ3 A;  4ID0 A;  3E0U A;  3CQF A;  4MNN A;  2D2Z A;  8GSS A;  1A24 A;  1HNB A;  3Q74 A;  1GWC A;  3GKN A;  3NZN A;  7GSS A;  3A3T A;  4RI6 A;  3OR5 A;  4LA1 A;  2QKE A;  4IP6 A;  5KN0 A;  2X99 A;  1LJR A;  4WF5 A;  2LJA A;  4P3Y B;  1O81 A;  3Q18 A;  1OE8 A;  4IP1 A;  3C8E A;  2FWE A;  2R3X A;  1KEB A;  3KMN A;  2DIY A;  4D73 B;  1OC3 A;  5D9T A;  2ON7 A;  1MTC A;  1XOB A;  3WYW A;  1O7U A;  3TJJ A;  4ZL7 A;  2V2G A;  4PUR A;  4NHW A;  2WCI A;  1THO A;  3ED3 A;  3IA1 A;  2RM5 A;  1HQO A;  2YOI A;  1M0U A;  3ERF A;  4WKW A;  1CQG A;  1TRW A;  1EEJ A;  4JE1 A;  2OKA A;  1F37 A;  5ECN B;  4YAP A;  3QPM A;  1G0T A;  1SYR A;  2A2P A;  3VI7 A;  4I97 A;  4WF4 A;  4HJM A;  4LMW A;  1SKS B;  2X64 A;  4IS0 A;  2L57 A;  1GSQ A;  2FA4 A;  1RQM A;  4X1U A;  3UJ1 A;  5FWG A;  2DJ2 A;  3CSI A;  3IE3 A;  4ECJ A;  1TRS A;  3SBC A;  1SKW B;  1N8J A;  4ZB9 A;  4AJ7 A;  1F9M A;  2IPA A;  4MF5 A;  3WD6 A;  1QGV A;  3PGT A;  4AGS A;  4CHS A;  3VI5 A;  2AUV A;  3EIN A;  4HJ2 A;  2KP1 A;  5E4W A;  4KGI A;  3UVH A;  2OE1 A;  3HVS A;  1Q4J A;  2JZS A;  2JL4 A;  3TDG A;  3HA9 A;  5B6N A;  2OAD A;  4NPB A;  5FHI A;  1ZMA A;  4Z7X A;  1GRX A;  2QA1 A;  5GAP D;  3GX8 A;  3MDK A;  1DUG A;  1GSF A;  2X8H A;  2GS3 A;  1GUK A;  5JCW A;  2GDR A;  2BTO T;  1PN9 A;  1FOV A;  2LEG A;  2NPB A;  1XW5 A;  4Q5R A;  2JU5 A;  4K0G A;  2I4A A;  4ZL9 A;  2MBS A;  5ABR A;  2DMM A;  1XVW A;  3ZIV A;  3UEM A;  3US3 A;  3IV4 A;  3FR9 A;  1J08 A;  5KN3 A;  2XPE A;  2WRT A;  2RLI A;  3VPQ A;  2F9S A;  2DJ3 A;  3V1W A;  1XW6 A;  3HCZ A;  2KUC A;  5J9B A;  3WT1 A;  2KLX A;  1B9X C;  2JZT A;  3A5W A;  3ZVJ D;  2LTK A;  3HJP A;  1EGO A;  1W89 A;  3GA4 A;  2PN8 A;  3G9B A;  1O85 A;  3TRP A;  5IOX A;  4NV5 A;  4Z2U A;  20GS A;  1R26 A;  4DSS B;  2OBI A;  4PTS A;  1TJD A;  2JAD A;  2VCW A;  4WEY A;  3GSS A;  3ZLP A;  2FHE A;  1TTZ A;  2IMK A;  1SK1 A;  3MWH A;  2IFQ B;  1TKD B;  3VFI A;  4NV2 A;  4MJA A;  4BL7 A;  2VM1 A;  1G7O A;  1E6B A;  1WMJ A;  2KOK A;  2L6C A;  3F6F A;  3TKS A;  3QCP A;  4PNF A;  1VRS D;  4FQU A;  2VCV A;  2R4V A;  1U3I A;  3F4S A;  2B6M A;  3GX0 A;  3EMP A;  1M2A A;  1IYI A;  2MZC A;  1Z7P A;  2YPM A;  3F0I A;  2PER A;  5J9C A;  3TKQ A;  1HNA A;  3PIN A;  3EC3 A;  4TXV A;  1VF2 A;  4ML6 A;  2RII A;  2GT6 A;  1V40 A;  4FYU A;  4MP4 A;  4EDY A;  4IVF A;  1S3R A;  1EGR A;  1M7T A;  3L78 A;  2DC5 A;  2QA2 A;  1FG4 A;  4GLT A;  2H1B A;  4I6X A;  2H71 A;  5AN1 A;  4TR3 A;  2MMO A;  3QMX A;  4YKF A;  4ZBD A;  4GSN A;  5B6M A;  4FH8 A;  3L9S A;  3P90 A;  2CAQ A;  4OO4 A;  1KNG A;  3M0F A;  3LG6 A;  1TXX A;  4XS6 A;  3VWU A;  3DML A;  1H4O A;  2A4H A;  3F9U A;  2L4Q A;  4EDZ A;  4BVX B;  1J9B A;  1GNE A;  1GH2 A;  3LYK A;  4MF6 A;  3WGX A;  3GV1 A;  5JWQ B;  4V2N A;  2JZR A;  1G7E A;  3O76 A;  4IEL A;  1K0B A;  6GSY A;  3H79 A;  1XBS A;  19GS A;  2GZP A;  4MMM A;  3UVT A;  4AJ8 A;  2AYT A;  3FZA A;  2CQ9 A;  1SEN A;  2AHE A;  4G2E A;  4ZIJ A;  1FOH A;  1TI3 A;  4F2I A;  4KX4 A;  3P8W A;  1AUC A;  1U88 A;  4EKZ A;  4DSS A;  2B5X A;  3IAS 2;  1XFL A;  3DD3 A;  4HOJ A;  1FAA A;  2R0G A;  2DJ1 A;  2X8C A;  5DAK B;  3GL3 A;  1GUL A;  1OKD A;  4HUA A;  3FR3 A;  3LW9 A;  3KD0 A;  4E8H A;  3UMA A;  1T00 A;  2M80 A;  4MF7 A;  1B4Q A;  4WBJ A;  4EC0 A;  4G0L A;  3N5O A;  3D4T A;  1OC8 A;  4ML1 A;  1HYU A;  1GNW A;  1ZL9 A;  3K8N A;  4MZW A;  2C4J A;  1WJK A;  1EV4 A;  1A8L A;  1X5C A;  3CMI A;  3M1G A;  5EL8 A;  1BAY A;  2V6O A;  4Q5N A;  5DCH A;  4J2F A;  3UBL A;  5JWR B;  3C1R A;  4OFM A;  5HR1 A;  1ILO A;  2EIQ A;  4Q5F A;  2H0G A;  1GSY A;  4TR4 A;  2PPT A;  4PXO A;  2HFD A;  2IN3 A;  5A4W A;  5A4U A;  2L5O A;  3W6G A;  3DVW A;  3TJB A;  1Z7R A;  3RBT A;  2YV7 A;  1Z5Y E;  3M8N A;  3GFK A;  4WR4 A;  2TRX A;  5D8I A;  4OMV A;  3D4M A;  5AGY A;  2N5F A;  2B1K A;  1ERV A;  4DVC A;  1UVZ A;  3NIV A;  2J23 A;  1JZR A;  3CSJ A;  3FZ5 A;  5F8B A;  4I2U A;  2TIR A;  4TN8 A;  1Q98 A;  1UC7 A;  3GKM A;  5G2Z A;  13GS A;  5JCU A;  4NXI A;  1ZYP A;  2C3N A;  5JCG A;  2NDO A;  2PVO C;  5KN1 A;  3TKS E;  2GST A;  2PVQ A;  1OYJ A;  3LJR A;  3GRX A;  2VL9 A;  1YF0 A;  1UN2 A;  5F0G A;  1QMV A;  4TR0 A;  5DAL A;  1EP7 A;  4XS1 A;  4YQM A;  3ZTL A;  4A5P A;  4N0V A;  2AJQ B;  2V41 A;  1OC9 B;  1BG5 A;  1RK4 A;  2A2S A;  4EF0 A;  2IMD A;  4V1A p;  4POL A;  5DJL A;  2ZNM A;  1ZCP A;  3GUS A;  3C7M A;  3GKK A;  5L71 A;  4KF9 A;  5H5S A;  3DEX A;  1PQN A;  4X4J A;  5CNW A;  1WWJ A;  4KA0 A;  3PH9 A;  4I2T A;  1EP8 A;  2JSY A;  4FYC A;  1YZX A;  1T3B A;  3VWV A;  2XBI A;  3CRU A;  3ZMK A;  4CDO A;  2V6K A;  1MD4 A;  3Q6O A;  5EVO A;  2CZ3 A;  3VK9 A;  2QSI A;  5ECR B;  3M9J A;  3KJY A;  2ZUP A;  4K1F A;  4KSO A;  1I9D A;  1EEM A;  2YWO A;  4HDE A;  4DSQ A;  2VM2 A;  1X9W B;  1YF1 A;  3LQ7 A;  4N10 A;  1QUW A;  3A2X A;  4H86 A;  2H70 A;  1MEK A;  1YEX A;  3HZ8 A;  1U3A A;  2E2M A;  1M2B A;  18GS A;  2V32 A;  4K5R A;  5DCG A;  2L6D A;  2CVK A;  4AJ6 A;  1GLP A;  1BQ7 A;  3DIE A;  4NAX A;  1FB0 A;  4IBP A;  2RM6 A;  2QGV A;  2H76 A;  3FEU A;  2DKH A;  2N5A A;  2WUL A;  2MBT A;  3IXR A;  5HR3 A;  2GQK A;  4QL9 A;  1TK8 B;  1WOU A;  4GXZ A;  1XZO A;  4MLY A;  1WPI A;  3FYG A;  2VUP A;  3RPP A;  4MZC A;  3A2W A;  1CQH A;  3J7Y k;  3KXO A;  3RHC A;  1DSB A;  3GYK A;  1XG8 A;  4OWY A;  5GZZ B;  1SYX A;  2HI7 A;  4OFN A;  4XS4 B;  1XXU A;  5G1K A;  2GSS A;  4I5Q A;  2GTU A;  1ON4 A;  4BVY B;  3R3E A;  11GS A;  1PSQ A;  3LOR A;  4EXJ A;  2XPD A;  3RHB A;  1T7P B;  3UAR A;  2YWM A;  3I69 A;  3CRT A;  5ECQ B;  5CRD A;  3UBK A;  2GSR A;  4F0B A;  2QC7 A;  2IMF A;  2PBJ A;  2HRF A;  1TDI A;  4MA9 A;  4FO5 A;  4F03 A;  3ZZX A;  1B4P A;  5ID2 A;  3DVX A;  3VLN A;  3FW2 A;  2GSQ A;  4GF0 A;  3KMO A;  4HS1 A;  2FLS A;  4PQI A;  5IOW A;  3H4K A;  2LJK A;  1GUM A;  5GSS A;  4FIW A;  3F3R A;  4KW6 A;  3VWW A;  1YKC A;  2CZ2 A;  3WT2 A;  3ZYW A;  3KGK A;  4L8E A;  2K9F A;  2E7P A;  4F9Z A;  5DQY A;  3ZIT A;  4XRA A;  5HFI A;  2CX3 A;  3P7X A;  2YNX A;  1TU7 A;  2LKU A;  5ECL B;  1VGL A;  3UIW A;  1TK0 B;  2HT9 A;  3LEF A;  1XWG A;  1Y25 A;  1IYH A;  4TXO B;  3I6A A;  3H8Q A;  3U6V A;  4PNG A;  3KCM A;  4MJC A;  4K7I A;  1ZYN A;  1PMT A;  2NTO A;  2X49 A;  3KM6 A;  1LU4 A;  2H6Z A;  5ECK B;  3C1S A;  3TJK A;  2B5Y A;  2O87 A;  1XVQ A;  2YP6 A;  2VCZ A;  5H5Q A;  5INY A;  2VIM A;  5D96 A;  1TRV A;  5CRW A;  1BX9 A;  4RUV A;  2DML A;  4KAE A;  4KCA A;  1GTI A;  2GQM A;  3FKF A;  1PRX A;  1TRU A;  4D73 A;  3D21 A;  4Z2T A;  2VO4 A;  2XC2 A;  1A2J A;  4HSC X;  3FR6 A;  4K6X A;  4EIQ A;  4IN0 A;  3P2A A;  2HSH A;  1I5G A;  2CVB A;  5ELA A;  1B9Y C;  1TP9 A;  4O5Q A;  4BIK A;  4XS4 A;  2R5G A;  4NMU A;  1THX A;  5KOX A;  1NSW A;  2GLR A;  3MIX A;  2ES7 A;  2XHF A;  4MAB A;  4XTS A;  1OAZ A;  4EIP A;  3FHK A;  2B7J A;  2H1G A;  2LQO A;  2B3S A;  4KDX A; 
#chains in the Genus database with same CATH homology
 1HD2 A;  2HRA A;  1JHB A;  1GTU A;  4X43 A;  1ST9 A;  2LUS A;  3HZ4 A;  5CYY A;  4O32 A;  4PX1 A;  2CT6 A;  1SJI A;  3KZQ A;  4QL7 A;  5CO3 A;  2E0Q A;  1XPV A;  2K18 A;  2XBQ A;  3C71 A;  2HE3 A;  5GST A;  4OCF A;  1TOF A;  4ZBB A;  4GSS A;  2WJU A;  12GS A;  2DJK A;  3KH7 A;  4CY8 A;  1FO5 A;  3G7Y A;  2LRC A;  3DWV A;  3F4R A;  1K0O A;  1JLV A;  5DDL A;  2HZE B;  4JU5 A;  5LNK e;  1M2D A;  2HZF A;  5IO2 A;  2H8L A;  1WE0 A;  2OE0 A;  3IR4 A;  1RW1 A;  4EL1 A;  4BA7 A;  3L0H A;  3ZVJ A;  1WP0 A;  4V2M A;  4Z2R A;  2PU9 C;  3HJO A;  1PGT A;  3GH9 A;  1PKW A;  1SK0 A;  3VPT A;  4IJI A;  2K8V A;  4I8B A;  2F51 A;  2C0D A;  1AQW A;  2I3Y A;  5ECO B;  5G5F A;  2H6X A;  3MYD A;  3HYP A;  5J3R A;  5DQS A;  3PPU A;  3R2Q A;  1FW1 A;  1YEP A;  3DXB A;  2HSM A;  2MMN A;  1Z3E A;  1T8E B;  3EU4 A;  3GN3 A;  2UZ8 A;  2CA8 A;  2C0E A;  3GNJ A;  1NM3 A;  3IAM 2;  1YDK A;  1PKZ A;  5KOW A;  2HYX A;  1AXD A;  5CRG A;  22GS A;  2HSY A;  2WZ9 A;  1GUH A;  1SK2 A;  1X5D A;  1ZYE A;  4GQC A;  1A2L A;  4TR1 B;  3CTF A;  2WB9 A;  4GTU A;  4Q5Q A;  1DBY A;  2VL3 A;  1XW9 A;  2X4A A;  2E2G A;  1GSU A;  1X5E A;  3TRX A;  2DSA A;  16GS A;  5DBQ A;  1GSD A;  2YWI A;  3KP8 A;  3ZML A;  2IFQ A;  2OJL A;  1JLW A;  3M9K A;  5J4U A;  3DKS A;  1A0R P;  1NW2 A;  2H6Y A;  2REM A;  3AY8 A;  5HR2 A;  4ECI A;  2FCH A;  2GZZ A;  1K3Y A;  4JR4 A;  3TKP A;  4YQU A;  3HJM A;  3FK8 A;  1XWK A;  3CYN A;  3EU3 A;  1SD8 A;  3LXT A;  1PL2 A;  3GUR A;  3IPZ A;  4LMV A;  2H74 A;  4EVM A;  4PGT A;  3IOS A;  4KUN A;  2YZH A;  2LJR A;  4ZBA A;  4AF2 A;  4YH2 A;  1O8X A;  2DJ0 A;  1ERW A;  1F2E A;  1XOA A;  2K8S A;  3ZFB A;  3APQ A;  2VCQ A;  3DYR A;  3GST A;  3IHQ A;  2R0C A;  4JR6 A;  5CRE A;  1VF1 A;  4MJB A;  2NVL A;  3GTU B;  1KBN A;  4EO3 A;  2VD1 A;  3IDV A;  2FY6 A;  1SU9 A;  1VF3 A;  3F3Q A;  3KH9 A;  2VCX A;  5IIZ A;  3GIX A;  5COH A;  3ISO A;  3ERG A;  2HLS A;  4K2X A;  3DGQ A;  5D9X A;  5J5N A;  3FZ4 A;  4YAV A;  3FY7 A;  5F05 A;  3LFL A;  2LS5 A;  5ELG A;  4X0X A;  2C0F A;  1V98 A;  3ZIJ A;  1ERU A;  5IMZ A;  1SJZ A;  4GWR A;  4N0Z A;  4WR5 A;  5IMD A;  4N11 A;  4ECB A;  4HQS A;  4BVX A;  1JZO A;  4L0W A;  5H5R A;  3IC8 A;  2FNO A;  5IQY A;  2VLV A;  2HNL A;  4POK A;  3NOF A;  5CRH A;  2IL3 A;  3KTL A;  4TW5 A;  4EE0 A;  3LWA A;  2LRN A;  5E59 A;  4ZIL A;  3TCO A;  4DSR A;  1G6W A;  4LL4 B;  4MH2 A;  1N2A A;  5HFG A;  4K5S A;  3N9J A;  1GSS A;  3W8J A;  1ML6 A;  1Y6E A;  5J41 A;  3KEB A;  2YJ7 A;  5F06 A;  4KND A;  3LXZ A;  5B8B A;  2GGT A;  1ZOF A;  5DAK A;  4K2D A;  5HR0 A;  2NBS A;  4WET A;  2FWF A;  1JFU A;  3A5I A;  3BBY A;  2N5B A;  2Z9S A;  3O6T A;  1EOH A;  2K6V A;  2H75 A;  3IC4 A;  3CTG A;  1JZW A;  3FMW A;  2ZCT A;  4L0U A;  4TRX A;  5HFK A;  4KB3 A;  3H1N A;  1BYE A;  3IHG A;  4YQV A;  2I1U A;  5B8A A;  1H75 A;  1KTE A;  3TJG A;  2VCT A;  4XCS A;  5D73 A;  4LLR A;  1R4W A;  2M66 A;  4PQ1 A;  4G0K A;  2GT5 A;  3FRC A;  4JBB A;  4WXT A;  2G2Q A;  4CY6 A;  1ACV A;  3JCM L;  3GTU A;  4J56 E;  4ISD A;  3CSH A;  5B7C A;  3RAZ A;  5IMA A;  17GS A;  2BMX A;  1X0R A;  3MSZ A;  1BED A;  2PGT A;  1SJ6 A;  3H93 A;  4G19 A;  2P0G A;  6GSS A;  4JZQ A;  1K3L A;  3QAW A;  2IME A;  1DE2 A;  1B48 A;  1LBK A;  2PUK C;  4K0N A;  4G10 A;  5G5E A;  1GP1 A;  3HVV A;  1TW9 A;  3S9F A;  1ZYQ B;  2O89 A;  3F63 A;  3TOU A;  2H1A A;  5A4V A;  4PQH A;  5C00 A;  3ZRD A;  2V1M A;  3C73 A;  3GHA A;  2F8F A;  3D5J A;  3EUR A;  2LNT A;  4ZL8 A;  3EE2 A;  4KDU A;  3APS A;  3CBU A;  4IGJ A;  4BL7 B;  2L59 A;  5FT3 A;  3Q19 A;  2C8U A;  2ALB A;  3F6D A;  5BMU A;  2TRC P;  1GTB A;  4BWS A;  2R0P A;  2P5R A;  4ULX A;  1OKT A;  2H0I A;  2H19 A;  2OA7 A;  1OC9 A;  3GL5 A;  4EUY A;  1K0D A;  3MAK A;  2H66 A;  3GKX A;  2VOC A;  1GL8 A;  5ECS A;  1TK5 B;  2M72 A;  1R5P A;  4V1A g;  1FHE A;  3TRQ A;  3UAP A;  3BD2 A;  2O7K A;  2VAF A;  2VLU A;  1QQ2 A;  2A2R A;  2A4V A;  2DKI A;  3QAV A;  1T4Y A;  2C3Q A;  4F0C A;  2DJJ A;  2ON5 A;  1B8X A;  2X8G A;  3D22 A;  2OE3 A;  4RI7 A;  3O3T A;  1UA5 A;  3PR8 A;  2OAC A;  4JRR A;  2JAC A;  4ILF A;  1SL1 B;  4RQX A;  1PD2 1;  4O92 A;  3HDC A;  3LSZ A;  1A23 A;  5ECH B;  1AC1 A;  1Z9H A;  3KP9 A;  4DEJ A;  1MDI A;  1K0N A;  5HQP A;  1U87 A;  2C80 A;  4GST A;  3LYP A;  1V2A A;  2J9H A;  1USB A;  1K0M A;  1XWA A;  4XHM A;  1V57 A;  1YJ6 A;  3M3M A;  9GSS A;  4XRD A;  2GVP A;  1T1V A;  5CP1 A;  5IO0 A;  2B5E A;  3W8S A;  6GSW A;  1FVK A;  1ERT A;  1VF4 A;  3ERW A;  2VL2 C;  1F6M C;  2R2J A;  1YY7 A;  1M9B A;  5LD0 A;  1AQX A;  1SD9 A;  3IK7 A;  3HVX A;  1X9M B;  5G30 A;  2AB6 A;  1TI1 A;  1O73 A;  1OE7 A;  4GCI A;  6GSX A;  4OD7 A;  2CAI A;  1E2Y A;  1Z6M A;  3APO A;  4OO5 A;  1R7H A;  3FZ9 A;  2C3T A;  1MDJ A;  2O85 A;  2WDU A;  1G6Y A;  4ECC A;  4BVY A;  2EC4 A;  2MYG A;  2B7K A;  2B1L A;  1QFN A;  5D9V A;  3WGD A;  2P31 A;  6GSU A;  3G7J A;  3ZFL A;  4CW9 A;  1NHO A;  3IRA A;  5ENU A;  3QOU A;  2FGX A;  3HY2 A;  3L9V A;  5AIV A;  4LL1 B;  4PUF C;  4V2L A;  5GAN D;  2HXK A;  5DVB A;  4IQA A;  1K0C A;  3ME7 A;  1WRY A;  4QQ7 A;  1TU8 A;  4TOP A;  1PN0 A;  4OCE A;  3BCI A;  2GQL A;  3GH6 A;  2C1Y A;  1JZD A;  4KCE A;  3QFB C;  5D93 A;  1YQ1 A;  4USS A;  5G1L A;  2HRN A;  3EWL A;  5IM9 A;  5BRT A;  1FVJ A;  3ZRE A;  5IMF A;  1O6J A;  3HXS A;  3UOM A;  2FUG 2;  3RPN A;  2R6K A;  3EPT A;  3BCK A;  2M46 A;  1K0A A;  3KTB A;  1EOG A;  5DJM A;  3IBH A;  1V9W A;  1YKA A;  2DBC A;  2YZU A;  3TB2 A;  2O8V B;  3TGZ A;  3QDN A;  4PUA A;  3TUE A;  2L5L A;  5C04 A;  5F07 A;  3I9V 2;  4L5L A;  4TVE A;  3EVI A;  1K3O A;  3CXG A;  2YWN A;  4TXO A;  1G7D A;  2L4C A;  3L9U A;  4OFT A;  3TKR A;  4BPY A;  3J7Y b;  2BJX A;  2WFC A;  1F3B A;  4IW9 A;  4JED A;  4ZB6 A;  1ABA A;  2HRK A;  4MH3 A;  2EIO A;  5ECI B;  2H01 A;  1EV9 A;  1DE1 A;  5EY6 A;  1QXH A;  3UL3 A;  1OVN A;  2KHP A;  5JWO B;  4MPF A;  1M9A A;  1A2M A;  2LQQ A;  4K9Z A;  1HNC A;  2IIY A;  1X9S B;  1A8Y A;  4HZ2 A;  2YAN A;  1PA3 A;  1AAZ A;  3HHV A;  1O8W A;  5D9W A;  1NHY A;  4N30 A;  4G9H A;  4GQF A;  4K8M A;  5DAL B;  3LGC A;  2H73 A;  2KP2 A;  3SWL A;  2IWT A;  1AIU A;  5CAX A;  1URM A;  3F4T A;  2MMA A;  2DIZ A;  2VLT A;  4K7N A;  6GSV A;  2I9H A;  4RQR A;  4ZB8 A;  3RDW A;  1SL0 B;  3QD9 A;  4HEA 2;  1AW9 A;  1ZZY A;  2PMT A;  1MD3 A;  1SL2 B;  4WBR D;  5LCZ A;  3WGE A;  1EZK A;  4XIH A;  1GTA A;  2C0G A;  1XCC A;  3A2V A;  4O5R A;  1GSE A;  1T4Z A;  3D0Z A;  4HI7 A;  4HU9 A;  4YKG A;  2RUF A;  1PX7 A;  1S3D A;  2H0H A;  5A5K A;  2FD3 A;  4G0I A;  2GZY A;  4KE3 A;  2H1D A;  2R37 A;  14GS A;  4KH7 A;  2CV4 A;  1ZGN A;  3EYT A;  3IK9 A;  3BOA A;  2OBK A;  4MCU A;  2HZE A;  1QK8 A;  1XIY A;  4NHZ A;  1J0F A;  4MDC A;  2MMZ A;  5AIX A;  4TKY A;  1V58 A;  2VL2 A;  4F82 A;  1BJX A;  1PL1 A;  5IMV A;  1WIK A;  2G0F A;  2EIR A;  2WGR A;  4KSM A;  4L5O A;  2I81 A;  5IPG A;  6GST A;  4MJE A;  5KN2 A;  1GLQ A;  4NWY A;  4IKH A;  1S3C A;  4FYB A;  2RUE A;  3TOT A;  3DRN A;  3QR6 A;  4J57 E;  4K7O A;  2F8A A;  1AQV A;  1A0F A;  1M99 A;  4MK3 A;  1C72 A;  2LNS A;  2H30 A;  2AV4 A;  1R5A A;  2LV3 A;  3VWX A;  3QFA C;  3ME8 A;  2FWG A;  2F3M A;  3E9J B;  5IPH A;  2DLX A;  4ICY A;  2YJH A;  4TR1 A;  5KEJ A;  2IJY A;  2IMI A;  3EMX A;  2YCD A;  3BJ5 A;  4ACS A;  4O5U A;  2PWJ A;  4MZB A;  1PX6 A;  4O7H A;  3L4N A;  1FB6 A;  4POM A;  5ID2 B;  3TJF A;  3QAG A;  1U6T A;  3E3E A;  3G7I A;  1XWB A;  2AAW A;  5ECP B;  1S3A A;  3HKR A;  4ZXG A;  1EWX A;  5ECM B;  2LRT A;  2P5Q A;  2WS2 A;  4HU7 A;  3MNG A;  2VD0 A;  2FA8 A;  3D6I A;  1Z6N A;  1XWC A;  5AIS A;  4HQZ A;  2YN1 A;  4KDY A;  1F3A A;  3I43 A;  2CVD A;  2LST A;  3TKS C;  3HD5 A;  4MPG A;  3GMF A;  2JSZ A;  4POB A;  2CX4 A;  4E8E A;  3KIJ A;  5EPF A;  1W4V A;  4HZ4 A;  5IMC A;  2FWH A;  5G31 A;  1MDK A;  2H72 A;  1SKR B;  3VUR A;  3U5R E;  4IHU A;  4IQ1 A;  3ZL5 A;  3F8U A;  2YV9 A;  10GS A;  4BWQ A;  4GRF A;  4IJ3 A;  4ID0 A;  3E0U A;  4MNN A;  2D2Z A;  8GSS A;  1A24 A;  1HNB A;  3Q74 A;  1GWC A;  3GKN A;  3NZN A;  7GSS A;  3A3T A;  4RI6 A;  3OR5 A;  4LA1 A;  2QKE A;  4IP6 A;  5KN0 A;  2X99 A;  1LJR A;  4WF5 A;  2LJA A;  4P3Y B;  1O81 A;  3Q18 A;  1OE8 A;  4IP1 A;  3C8E A;  2FWE A;  2R3X A;  1KEB A;  3KMN A;  2DIY A;  4D73 B;  1OC3 A;  5D9T A;  2ON7 A;  1MTC A;  1XOB A;  3WYW A;  1O7U A;  3TJJ A;  4ZL7 A;  2V2G A;  4PUR A;  4NHW A;  2WCI A;  1THO A;  3ED3 A;  3IA1 A;  2RM5 A;  1HQO A;  2YOI A;  1M0U A;  3ERF A;  4WKW A;  1CQG A;  1TRW A;  1EEJ A;  4JE1 A;  2OKA A;  1F37 A;  5ECN B;  4YAP A;  3QPM A;  1G0T A;  1SYR A;  2A2P A;  3VI7 A;  4I97 A;  4WF4 A;  4HJM A;  4LMW A;  1SKS B;  2X64 A;  4IS0 A;  2L57 A;  1GSQ A;  2FA4 A;  1RQM A;  4X1U A;  3UJ1 A;  5FWG A;  2DJ2 A;  3CSI A;  3IE3 A;  4ECJ A;  1TRS A;  3SBC A;  1SKW B;  1N8J A;  4ZB9 A;  4AJ7 A;  1F9M A;  2IPA A;  4MF5 A;  3WD6 A;  1QGV A;  3PGT A;  4AGS A;  4CHS A;  3VI5 A;  2AUV A;  3EIN A;  4HJ2 A;  2KP1 A;  5E4W A;  4KGI A;  3UVH A;  2OE1 A;  3HVS A;  1Q4J A;  2JZS A;  2JL4 A;  3TDG A;  3HA9 A;  5B6N A;  2OAD A;  4NPB A;  5FHI A;  1ZMA A;  4Z7X A;  1GRX A;  2QA1 A;  5GAP D;  3GX8 A;  3MDK A;  1DUG A;  1GSF A;  2X8H A;  2GS3 A;  1GUK A;  5JCW A;  2GDR A;  2BTO T;  1PN9 A;  1FOV A;  2LEG A;  2NPB A;  1XW5 A;  4Q5R A;  2JU5 A;  4K0G A;  2I4A A;  4ZL9 A;  2MBS A;  5ABR A;  2DMM A;  1XVW A;  3ZIV A;  3UEM A;  3US3 A;  3IV4 A;  3FR9 A;  1J08 A;  5KN3 A;  2XPE A;  2WRT A;  2RLI A;  3VPQ A;  2F9S A;  2DJ3 A;  3V1W A;  1XW6 A;  3HCZ A;  2KUC A;  5J9B A;  3WT1 A;  2KLX A;  1B9X C;  2JZT A;  3A5W A;  3ZVJ D;  2LTK A;  3HJP A;  1EGO A;  1W89 A;  3GA4 A;  2PN8 A;  3G9B A;  1O85 A;  3TRP A;  5IOX A;  4NV5 A;  4Z2U A;  20GS A;  1R26 A;  4DSS B;  2OBI A;  4PTS A;  1TJD A;  2JAD A;  2VCW A;  4WEY A;  3GSS A;  3ZLP A;  2FHE A;  1TTZ A;  2IMK A;  1SK1 A;  3MWH A;  2IFQ B;  1TKD B;  3VFI A;  4NV2 A;  4MJA A;  4BL7 A;  2VM1 A;  1G7O A;  1E6B A;  1WMJ A;  2KOK A;  2L6C A;  3F6F A;  3TKS A;  3QCP A;  4PNF A;  1VRS D;  4FQU A;  2VCV A;  2R4V A;  1U3I A;  3F4S A;  2B6M A;  3GX0 A;  3EMP A;  1M2A A;  1IYI A;  2MZC A;  1Z7P A;  2YPM A;  3F0I A;  2PER A;  5J9C A;  3TKQ A;  1HNA A;  3PIN A;  3EC3 A;  4TXV A;  1VF2 A;  4ML6 A;  2RII A;  2GT6 A;  1V40 A;  4FYU A;  4MP4 A;  4EDY A;  4IVF A;  1EGR A;  1M7T A;  3L78 A;  2DC5 A;  2QA2 A;  1FG4 A;  4GLT A;  2H1B A;  4I6X A;  2H71 A;  5AN1 A;  4TR3 A;  2MMO A;  3QMX A;  4YKF A;  4ZBD A;  4GSN A;  5B6M A;  4FH8 A;  3L9S A;  3P90 A;  2CAQ A;  4OO4 A;  1KNG A;  3M0F A;  3LG6 A;  1TXX A;  4XS6 A;  3VWU A;  3DML A;  1H4O A;  2A4H A;  3F9U A;  2L4Q A;  4EDZ A;  4BVX B;  1J9B A;  1GNE A;  1GH2 A;  3LYK A;  4MF6 A;  3WGX A;  3GV1 A;  5JWQ B;  4V2N A;  2JZR A;  1G7E A;  3O76 A;  4IEL A;  1K0B A;  6GSY A;  3H79 A;  1XBS A;  19GS A;  2GZP A;  4MMM A;  3UVT A;  4AJ8 A;  2AYT A;  3FZA A;  2CQ9 A;  1SEN A;  2AHE A;  4G2E A;  4ZIJ A;  1FOH A;  1TI3 A;  4F2I A;  4KX4 A;  3P8W A;  1AUC A;  1U88 A;  4EKZ A;  4DSS A;  2B5X A;  3IAS 2;  1XFL A;  3DD3 A;  4HOJ A;  1FAA A;  2R0G A;  2DJ1 A;  2X8C A;  5DAK B;  3GL3 A;  1GUL A;  1OKD A;  4HUA A;  3FR3 A;  3LW9 A;  3KD0 A;  4E8H A;  3UMA A;  1T00 A;  2M80 A;  4MF7 A;  1B4Q A;  4WBJ A;  4EC0 A;  4G0L A;  3N5O A;  3D4T A;  1OC8 A;  4ML1 A;  1HYU A;  1GNW A;  1ZL9 A;  3K8N A;  4MZW A;  2C4J A;  1WJK A;  1EV4 A;  1A8L A;  1X5C A;  3CMI A;  3M1G A;  5EL8 A;  1BAY A;  2V6O A;  4Q5N A;  5DCH A;  4J2F A;  3UBL A;  5JWR B;  3C1R A;  4OFM A;  5HR1 A;  1ILO A;  2EIQ A;  4Q5F A;  2H0G A;  1GSY A;  4TR4 A;  2PPT A;  4PXO A;  2HFD A;  2IN3 A;  5A4W A;  5A4U A;  2L5O A;  3W6G A;  3DVW A;  3TJB A;  1Z7R A;  3RBT A;  2YV7 A;  1Z5Y E;  3M8N A;  3GFK A;  4WR4 A;  2TRX A;  5D8I A;  4OMV A;  3D4M A;  5AGY A;  2N5F A;  2B1K A;  1ERV A;  4DVC A;  1UVZ A;  3NIV A;  2J23 A;  1JZR A;  3CSJ A;  3FZ5 A;  5F8B A;  4I2U A;  2TIR A;  4TN8 A;  1Q98 A;  1UC7 A;  3GKM A;  5G2Z A;  13GS A;  5JCU A;  4NXI A;  1ZYP A;  2C3N A;  5JCG A;  2NDO A;  2PVO C;  5KN1 A;  3TKS E;  2GST A;  2PVQ A;  1OYJ A;  3LJR A;  3GRX A;  2VL9 A;  1YF0 A;  1UN2 A;  5F0G A;  1QMV A;  4TR0 A;  5DAL A;  1EP7 A;  4XS1 A;  4YQM A;  3ZTL A;  4A5P A;  4N0V A;  2AJQ B;  2V41 A;  1OC9 B;  1BG5 A;  1RK4 A;  2A2S A;  4EF0 A;  2IMD A;  4V1A p;  4POL A;  5DJL A;  2ZNM A;  1ZCP A;  3GUS A;  3C7M A;  3GKK A;  5L71 A;  4KF9 A;  5H5S A;  3DEX A;  1PQN A;  4X4J A;  5CNW A;  1WWJ A;  4KA0 A;  3PH9 A;  4I2T A;  1EP8 A;  2JSY A;  4FYC A;  1YZX A;  1T3B A;  3VWV A;  2XBI A;  3CRU A;  3ZMK A;  4CDO A;  2V6K A;  1MD4 A;  3Q6O A;  5EVO A;  2CZ3 A;  3VK9 A;  2QSI A;  5ECR B;  3M9J A;  3KJY A;  2ZUP A;  4K1F A;  4KSO A;  1I9D A;  1EEM A;  2YWO A;  4HDE A;  4DSQ A;  2VM2 A;  1X9W B;  1YF1 A;  3LQ7 A;  4N10 A;  1QUW A;  3A2X A;  4H86 A;  2H70 A;  1MEK A;  1YEX A;  3HZ8 A;  1U3A A;  2E2M A;  1M2B A;  18GS A;  2V32 A;  4K5R A;  5DCG A;  2L6D A;  2CVK A;  4AJ6 A;  1GLP A;  1BQ7 A;  3DIE A;  4NAX A;  1FB0 A;  4IBP A;  2RM6 A;  2QGV A;  2H76 A;  3FEU A;  2DKH A;  2N5A A;  2WUL A;  2MBT A;  3IXR A;  5HR3 A;  2GQK A;  4QL9 A;  1TK8 B;  1WOU A;  4GXZ A;  1XZO A;  4MLY A;  1WPI A;  3FYG A;  2VUP A;  3RPP A;  4MZC A;  3A2W A;  1CQH A;  3J7Y k;  3KXO A;  3RHC A;  1DSB A;  3GYK A;  4OWY A;  5GZZ B;  1SYX A;  2HI7 A;  4OFN A;  4XS4 B;  1XXU A;  5G1K A;  2GSS A;  4I5Q A;  2GTU A;  1ON4 A;  4BVY B;  3R3E A;  11GS A;  1PSQ A;  3LOR A;  4EXJ A;  2XPD A;  3RHB A;  1T7P B;  3UAR A;  2YWM A;  3I69 A;  3CRT A;  5ECQ B;  5CRD A;  3UBK A;  2GSR A;  4F0B A;  2QC7 A;  2IMF A;  2PBJ A;  2HRF A;  1TDI A;  4MA9 A;  4FO5 A;  4F03 A;  3ZZX A;  1B4P A;  5ID2 A;  3DVX A;  3VLN A;  3FW2 A;  2GSQ A;  4GF0 A;  3KMO A;  4HS1 A;  2FLS A;  4PQI A;  5IOW A;  3H4K A;  2LJK A;  1GUM A;  5GSS A;  4FIW A;  3F3R A;  4KW6 A;  3VWW A;  1YKC A;  2CZ2 A;  3WT2 A;  3ZYW A;  3KGK A;  4L8E A;  2K9F A;  2E7P A;  4F9Z A;  5DQY A;  3ZIT A;  4XRA A;  5HFI A;  2CX3 A;  3P7X A;  2YNX A;  1TU7 A;  2LKU A;  5ECL B;  1VGL A;  3UIW A;  1TK0 B;  2HT9 A;  3LEF A;  1XWG A;  1Y25 A;  1IYH A;  4TXO B;  3I6A A;  3H8Q A;  3U6V A;  4PNG A;  3KCM A;  4MJC A;  4K7I A;  1ZYN A;  1PMT A;  2NTO A;  2X49 A;  3KM6 A;  1LU4 A;  2H6Z A;  5ECK B;  3C1S A;  3TJK A;  2B5Y A;  2O87 A;  1XVQ A;  2YP6 A;  2VCZ A;  5H5Q A;  5INY A;  2VIM A;  5D96 A;  1TRV A;  5CRW A;  1BX9 A;  4RUV A;  2DML A;  4KAE A;  4KCA A;  1GTI A;  2GQM A;  3FKF A;  1PRX A;  1TRU A;  4D73 A;  3D21 A;  4Z2T A;  2VO4 A;  2XC2 A;  1A2J A;  3FR6 A;  4K6X A;  4EIQ A;  4IN0 A;  3P2A A;  2HSH A;  1I5G A;  2CVB A;  5ELA A;  1B9Y C;  1TP9 A;  4O5Q A;  4XS4 A;  2R5G A;  4NMU A;  1THX A;  5KOX A;  1NSW A;  2GLR A;  3MIX A;  2ES7 A;  2XHF A;  4MAB A;  4XTS A;  1OAZ A;  4EIP A;  3FHK A;  2B7J A;  2H1G A;  2LQO A;  2B3S A;  4KDX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...