1OVNA

Crystal structure and functional analysis of drosophila wind-- a pdi-related protein
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
229
structure length
229
Chain Sequence
CTGCVDLDELSFEKTVERFPYSVVKFDIAYPYGEKHEAFTAFSKSAHKATKDLLIATVGVKDYGELENKALGDRYKVDDKNFPSIFLFKGNADEYVQLPSHVDVTLDNLKAFVSANTPLYIGRDGCIKEFNEVLKNYANIPDAEQLKLIEKLQAKQEQLTDPEQQQNARAYLIYMRKIHEVGYDFLEEETKRLLRLKAGKVTEAKKEELLRKLNILEVFRVHKVTKTAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Windbeutel
publication title Crystal structure and functional analysis of Drosophila Wind, a protein-disulfide isomerase-related protein.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 76
structure length 229
sequence length 229
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07749 ERp29 Endoplasmic reticulum protein ERp29, C-terminal domain
A PF07912 ERp29_N ERp29, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1150.12 Mainly Alpha Up-down Bundle Endoplasmic reticulum protein erp29 Endoplasmic reticulum resident protein 29, C-terminal domain 1ovnA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1ovnA01
2V6KA 2RUEA 1E2YA 2H8LA 1MDIA 2P0GA 2YPMA 4MABA 2L6DA 2OBKA 5IPHA 4L0WA 4Q5QA 5AIXA 4EUYA 4AF2A 5COHA 3FZ5A 1K3LA 3S9FA 4J57E 3G7YA 3KP9A 3RPPA 14GSA 1T00A 2IPAA 1FB0A 4YQMA 4MA9A 1NW2A 3E9JB 3HD5A 1O85A 1FHEA 2OACA 4MP4A 4WEYA 2OE1A 2J9HA 1OC9B 3N9JA 3GKMA 4POMA 4L8EA 3GTUB 5LD0A 4WF4A 5GAND 2GDRA 4TR4A 1TRSA 5A4WA 1QUWA 3Q74A 4ID0A 2P31A 3EC3A 5DALB 2H6XA 2A2SA 3GA4A 3CYNA 3HXSA 2YWNA 1F6MC 1XWCA 1U87A 1EGOA 1FB6A 1JHBA 2C4JA 2E0QA 2DJKA 3VI5A 1O6JA 2QSIA 2HT9A 3A2VA 5H5QA 1XZOA 2EIOA 4BWSA 2VIMA 3TJGA 2WB9A 2H1BA 5G2ZA 4FYBA 3D4TA 3GX8A 1MDJA 1JLWA 1ST9A 2VUPA 3F3QA 1XPVA 2KOKA 4FH8A 3I43A 2IJYA 3C7MA 2XBQA 3ZREA 4OMVA 1XFLA 1PX7A 1WPIA 4POKA 5J5NA 1HD2A 2DIYA 4MH3A 2DJ1A 2AUVA 5B7CA 4Z7XA 3DGQA 2OE0A 1O73A 3EMXA 4AJ7A 2IMKA 2JSZA 4KH7A 1SD8A 2L5OA 5ECNB 1JZOA 3EVIA 5JCUA 1TTZA 2OJLA 2VD1A 2CV4A 3H1NA 1X0RA 4IP1A 3F63A 2LQOA 3HCZA 1A0FA 1V2AA 2GQLA 4F82A 1DBYA 4DEJA 2YV9A 2VCXA 2GVPA 3GL3A 4JR6A 4DSRA 2VL2C 1B9YC 4ML1A 3E3EA 1X9MB 3PR8A 1XVQA 2DLXA 1ZGNA 2C0EA 3BJ5A 3DWVA 1EZKA 5IOXA 3GFKA 4EXJA 2I1UA 4WR5A 1OKTA 1FW1A 5DCGA 8GSSA 2HXKA 3ZMLA 2F9SA 3A3TA 4V1Ag 4MH2A 2JZTA 3WD6A 1Y6EA 4JRRA 1Z9HA 4I6XA 4J2FA 3EWLA 2FWFA 3GHAA 2K9FA 1YY7A 2YZUA 1EP7A 2GZPA 2PGTA 4K6XA 3HVVA 4PX1A 5JWOB 5HFGA 4K0GA 4NMUA 3C1SA 1XOBA 2IWTA 3VI7A 4OWYA 4IN0A 4N10A 5CRWA 5ECLB 1PA3A 3FYGA 3QAGA 2HLSA 4NV5A 4HQSA 3HZ8A 1ABAA 1LJRA 3KIJA 1VF4A 1SJZA 3FZAA 1OC9A 3W6GA 3GTUA 1YF0A 5ECIB 3G7IA 1AQWA 2Z9SA 3M9KA 2YV7A 1ILOA 4LMWA 3GUSA 1JZWA 1AIUA 5CAXA 1GTBA 1N8JA 5DALA 3NOFA 3RHBA 2TRCP 4NHWA 2V32A 4PXOA 2FA4A 5G1KA 2O89A 1W89A 1B48A 4JU5A 1PX6A 3K8NA 4KDUA 1BEDA 2OKAA 2NTOA 1OE7A 2YJHA 1UC7A 2H70A 2YANA 2QKEA 3CSJA 2NBSA 4ZB6A 3DKSA 1O7UA 1QMVA 3KP8A 3CBUA 3IOSA 4JR4A 3HVSA 2GSRA 5DQYA 1LBKA 4KCAA 4OO4A 4X1UA 3ZIJA 2YWOA 1AC1A 5ELAA 1BX9A 1HQOA 2B5EA 3LXZA 2QC7A 1KTEA 3LG6A 3GMFA 4MZCA 2CZ2A 2WFCA 1DE1A 2WRTA 1G7OA 4TR0A 4IHUA 2BTOT 4K7OA 4OD7A 1Z7PA 4KB3A 1DUGA 1Z7RA 2IMEA 1B8XA 3APQA 4PQ1A 1HNAA 1NHOA 5GSSA 2FNOA 3VLNA 2LEGA 2PUKC 5D9VA 5E4WA 1V9WA 4D73B 2R3XA 4EDYA 3IHQA 1GTAA 1OC8A 5B6NA 2RM5A 5CRDA 1F3BA 3GX0A 4I5QA 1T8EB 3F4RA 5AIVA 4AGSA 4GLTA 4WF5A 1EP8A 1UA5A 3O3TA 1A8YA 4X0XA 4FIWA 4L5OA 1GTUA 1BJXA 2X64A 1J9BA 2R6KA 3FY7A 1KNGA 3C8EA 2BMXA 4TXVA 3GSSA 2C0GA 3L78A 2C3QA 5C00A 3ZMKA 1DSBA 3ZITA 3DIEA 2VCWA 3LGCA 6GSTA 5KEJA 4ACSA 1PL2A 2ON7A 3IR4A 2IFQB 5DVBA 5J4UA 1UN2A 4I97A 5F06A 2LSTA 4KCEA 3R2QA 4XTSA 1MTCA 1X5CA 1U3AA 2CAQA 1PKWA 4KE3A 4V2LA 4KA0A 1XW6A 2VL3A 4G9HA 1THOA 1XWGA 3IAM2 2VCVA 1W4VA 4HZ2A 2MMNA 3V1WA 2PVOC 1NM3A 5DCHA 3IV4A 4GSNA 1F2EA 1ZMAA 4POBA 2PPTA 3A2XA 4EKZA 2VLVA 1SK2A 5IO2A 1GSDA 5JCGA 1K0DA 1S3CA 3ZFBA 4MJAA 3HA9A 5J9BA 3DRNA 4QL9A 2H0HA 3KTLA 9GSSA 6GSXA 2AV4A 2H74A 4E8EA 4PNGA 2C0FA 2VM2A 2MMZA 2RIIA 2GZYA 1YF1A 1AUCA 4GQCA 2FUG2 4XRDA 4O7HA 4WXTA 1XW5A 4K0NA 4GF0A 3CTFA 3TKQA 4BA7A 1FO5A 3VWXA 4HU9A 3G9BA 2MMAA 4NHZA 1T4YA 1OAZA 2EC4A 5G30A 4MLYA 2KUCA 1QFNA 1TXXA 1WE0A 3IK9A 1K0MA 3ME8A 4IS0A 4CHSA 4WKWA 3ZRDA 3DVXA 1SL2B 1WIKA 2OADA 1JZRA 1AQVA 3TGZA 1ZYQB 2FGXA 4RUVA 2M80A 3M1GA 5L71A 3G7JA 1U6TA 1ML6A 3CMIA 1GWCA 4G19A 2LKUA 1QQ2A 3TRQA 2DSAA 2L59A 5D96A 1VGLA 4K1FA 4KX4A 1R4WA 1XOAA 3KZQA 1EGRA 2MYGA 3F9UA 2ES7A 4IVFA 2HSHA 4MF5A 4TR1B 1A8LA 5JWQB 1T4ZA 2YJ7A 2IMFA 1PRXA 4N0VA 5H5RA 4PUFC 4YAPA 4F2IA 4POLA 2CZ3A 5EY6A 6GSWA 4D73A 1TP9A 4JEDA 2G0FA 3RHCA 1WWJA 4ZB8A 1M9BA 2FD3A 4GSTA 5G1LA 1V98A 5KN3A 3TRPA 2CT6A 2I9HA 1K3OA 3VWUA 5CRHA 5JWRB 2H66A 4FO5A 3BD2A 2M46A 4P3YB 2HI7A 1A2JA 2NPBA 20GSA 3D4MA 2F3MA 4NV2A 7GSSA 2WZ9A 4MPFA 3PH9A 3GRXA 1PD21 4PQIA 4ULXA 3WYWA 18GSA 4IQ1A 4LL1B 5ECOB 1FVKA 1PMTA 3I6AA 2IFQA 1TW9A 22GSA 2HYXA 4IGJA 1YJ6A 1AQXA 1URMA 2DBCA 5CREA 4ZIJA 4K7IA 4WR4A 1TK8B 1O8XA 5EPFA 5CNWA 1OYJA 2AJQB 4H86A 4L0UA 5HR2A 3GSTA 3M0FA 3ZL5A 2L5LA 1PKZA 1Z3EA 1THXA 4FYCA 3LXTA 3UJ1A 1Z5YE 1F3AA 6GSVA 2K18A 4GSSA 2R37A 5AGYA 3VK9A 1J08A 5ENUA 3GKKA 4GQFA 1AAZA 3LJRA 5FWGA 1EEMA 3GURA 5IMZA 1TRVA 5GSTA 2HRNA 4QL7A 2PBJA 1KBNA 2WCIA 3M3MA 2KP2A 2TIRA 1PL1A 4KNDA 1OC3A 2ALBA 2FCHA 3GV1A 5ECRB 1GL8A 2CVKA 3H8QA 5F8BA 2IL3A 4Q5RA 5AN1A 1Z6NA 4ZILA 2HFDA 4Q5FA 4KUNA 4ZBAA 3F4TA 5AISA 4YH2A 5B8AA 4F0CA 2C1YA 2CVDA 2X99A 2DIZA 3IBHA 1EOHA 1NSWA 4DSQA 3J7Yb 1GSYA 2I3YA 1X9WB 1GNEA 1G6WA 2VLTA 2JADA 5IOWA 2B7JA 2B5YA 2JU5A 1QK8A 1QGVA 4G2EA 1GNWA 4OFNA 4OFMA 1GUHA 3IA1A 2PU9C 1SU9A 3E0UA 3FKFA 5F0GA 1K0AA 4OCFA 4ECBA 1GUKA 1V58A 4TR1A 1MDKA 2VCTA 3IPZA 4HJ2A 1I9DA 2LNSA 3LSZA 2RUFA 2H72A 1OE8A 2TRXA 2IN3A 1YEXA 3ME7A 3HJPA 3ZYWA 2WDUA 3P8WA 2GS3A 4MJEA 2LJAA 5CRGA 2XHFA 2I4AA 4HDEA 3L9SA 4HUAA 4K9ZA 2O7KA 2X8GA 2C0DA 2F8AA 4IJ3A 2K6VA 2CVBA 3Q18A 1NHYA 3UARA 3CSHA 3HJOA 1TKDB 2N5AA 2CQ9A 2KLXA 2VL9A 3ZLPA 5IMDA 2A2RA 1E6BA 3WT1A 4IELA 5CO3A 4ZL9A 3PGTA 3FRCA 1WMJA 1TI1A 3J7Yk 2YP6A 3W8SA 2X8HA 4XCSA 3TKPA 4PUAA 4HU7A 1PQNA 2LTKA 3L9VA 4KDXA 4MJCA 3VURA 4XS4B 3KJYA 1FG4A 2H1AA 4NAXA 1GSSA 3RDWA 3TKSE 5J9CA 2MBSA 2OA7A 3L4NA 2H1DA 5G5FA 1K0NA 1FOVA 3O6TA 2MMOA 3QDNA 4OCEA 1GULA 1YKAA 1DE2A 5F07A 1AW9A 3HHVA 1GRXA 13GSA 1J0FA 2GT5A 1CQHA 5LNKe 3KMOA 1GP1A 2L6CA 1WOUA 4FYUA 4DSSB 2XPDA 4XS6A 2IMIA 2H01A 2RM6A 3FW2A 4ZB9A 12GSA 3QAWA 3GN3A 3VFIA 4LL4B 3KEBA 2X8CA 2LJRA 1RK4A 3DYRA 2LJKA 4O92A 2I81A 4PNFA 4YQUA 2XBIA 3GH9A 1HYUA 2C80A 3IC4A 3H4KA 4K8MA 1HNCA 3WT2A 1GTIA 2YWIA 17GSA 5DAKB 3BBYA 4PURA 5KN2A 4OFTA 4HJMA 4Q5NA 3WGXA 3EE2A 1LU4A 3BCIA 1A2MA 2LRCA 3MWHA 3ZVJA 1TU8A 3C71A 3D6IA 3IRAA 3CRTA 2DJ3A 1TRUA 3VPQA 2CX3A 3D22A 3FR3A 5FHIA 2LNTA 3OR5A 2L57A 1XWBA 3EURA 3MDKA 3CXGA 1QXHA 4ZL7A 1K0CA 1YQ1A 1V40A 3U6VA 3TCOA 2HSYA 4TXOB 1SKRB 4ZBDA 4EC0A 3BOAA 5J41A 2YNXA 16GSA 1GSEA 3ISOA 5IMFA 3TKSA 2CA8A 2KHPA 1EEJA 4MMMA 1G7DA 5ECQB 1TOFA 3TUEA 1OVNA 5INYA 1K0OA 2GSQA 2G2QA 2AYTA 2VAFA 3TKRA 4V2NA 5B6MA 4IBPA 3SBCA 3O76A 1ZZYA 5D8IA 3GKNA 3QOUA 2V1MA 1S3DA 4HQZA 1N2AA 3EMPA 4HI7A 1TK5B 3UVTA 1XW9A 4CDOA 2B6MA 4BWQA 1V57A 2M72A 5G31A 1VF2A 1JLVA 3FR6A 4F03A 3FK8A 2FLSA 2B7KA 2LRTA 1GSUA 2CX4A 3IAS2 5HR1A 1WP0A 1YEPA 2H30A 4HEA2 2PMTA 4TRXA 3FEUA 1XBSA 2MBTA 5F05A 2PERA 5GZZB 1K0BA 4WBRD 4MJBA 3HZ4A 2N5BA 4XS4A 3LQ7A 4RI7A 2LQQA 2PVQA 3WGEA 2JZSA 1S3AA 2E7PA 3Q6OA 4TN8A 4BPYA 1MD4A 2IMDA 1VF3A 3N5OA 3F0IA 3QFAC 3KTBA 1IYIA 4O5RA 1A2LA 3GNJA 4I8BA 1SENA 1ERWA 1TJDA 4GRFA 3ZZXA 2C3NA 4WETA 3CTGA 2GQKA 3KH9A 1T3BA 1R7HA 2DMMA 2WJUA 1B4PA 2B3SA 1K3YA 2JL4A 3A5WA 3UMAA 4DSSA 2GLRA 3ZTLA 2FWHA 3RBTA 3FHKA 4QQ7A 3NIVA 4HOJA 3C1RA 4EO3A 2LS5A 1XCCA 4MDCA 1Q98A 4TW5A 4GCIA 5HR0A 2YWMA 3GIXA 4JBBA 2REMA 4N11A 2MZCA 1Q4JA 3FZ4A 1BG5A 1FAAA 3PINA 4TVEA 2O87A 3ZFLA 3JCML 2DJ2A 4ZBBA 1R5AA 3TDGA 3LYKA 5DAKA 4ECIA 1ERVA 3Q19A 4IKHA 4KSMA 3KCMA 3UIWA 5CYYA 3FR9A 3ZIVA 2O8VB 3KD0A 5ID2B 2DJJA 4ML6A 4V2MA 3GYKA 2J23A 4LMVA 2ZUPA 1SL1B 2E2MA 3TJKA 5KN0A 2EIRA 4K7NA 2OE3A 3IK7A 4JE1A 4RQXA 1X5EA 2GSSA 3LYPA 1VRSD 2FWEA 4EVMA 2H6ZA 1XXUA 4RQRA 5IMCA 1PN9A 1ON4A 2K8VA 2O85A 1TK0B 4TXOA 1JZDA 3LEFA 3KM6A 1SJIA 1ZL9A 3TB2A 5EVOA 2WS2A 2FHEA 3HY2A 1F9MA 1C72A 5IIZA 4MPGA 3F4SA 2V6OA 3AY8A 1OKDA 3U5RE 3UBLA 1A0RP 10GSA 3IE3A 1Y25A 4OO5A 5HR3A 3P7XA 3QD9A 2B5XA 2VD0A 4TOPA 2P5RA 2P5QA 5IMVA 3IDVA 5IQYA 3D5JA 3I69A 3ERWA 4DVCA 5FT3A 1SKSB 2DMLA 4PQHA 5A4VA 2RLIA 3HVXA 5DDLA 4KW6A 3UBKA 4MZWA 3TJBA 5A5KA 2DJ0A 5ECHB 4WBJA 1ZCPA 4CW9A 2M66A 3LORA 1T7PB 5IM9A 5JCWA 3QPMA 5KN1A 1GUMA 3MSZA 2IIYA 1EWXA 5IO0A 2KP1A 1M2BA 2BJXA 11GSA 2EIQA 3APSA 5E59A 3RAZA 5IMAA 4EDZA 1GLPA 1H75A 3DD3A 4L5LA 2VOCA 2B1LA 5B8BA 3UOMA 3LWAA 4XHMA 1VF1A 2HE3A 4AJ6A 2WULA 2H73A 5GAPD 3GL5A 4J56E 4MZBA 2JACA 4F9ZA 2DC5A 3M8NA 1G7EA 4ECJA 4I2TA 3UAPA 2VM1A 2XC2A 3QAVA 5HFKA 1TI3A 3UVHA 2L4QA 1EOGA 2YZHA 1PSQA 4JZQA 5ECSA 4HZ4A 1FVJA 4AJ8A 1WJKA 1YDKA 1JFUA 3KH7A 3DMLA 1WRYA 1TRWA 5H5SA 1SYXA 4F0BA 2YN1A 3WGDA 1R26A 1M2DA 1M2AA 2N5FA 3EU3A 2A4VA 1MD3A 2VCZA 2VL2A 2H0IA 4N0ZA 1F37A 1IYHA 3DEXA 1G0TA 2CAIA 1AXDA 4XS1A 2GT6A 4MCUA 3ZVJD 2YCDA 1R5PA 3GH6A 1YKCA 1BYEA 2FY6A 2B1KA 4BVYA 1EV9A 1G6YA 2GSTA 4KGIA 1M99A 1SKWB 3F3RA 5A4UA 2HNLA 5ID2A 3BCKA 3F6FA 2C8UA 3EINA 4MF6A 2H71A 3ERFA 3KGKA 1PGTA 4MF7A 2ZCTA 2H1GA 2HZEB 5G5EA 5J3RA 4IJIA 3US3A 1M7TA 5ECKB 2AAWA 3LFLA 3D0ZA 1GLQA 1XIYA 5DJMA 1USBA 4MK3A 2H76A 2FWGA 3D21A 3VPTA 4NPBA 1ERTA 1O81A 3NZNA 4LA1A 2ZNMA 3SWLA 3CSIA 1O8WA 5DQSA 2VLUA 6GSUA 1M9AA 3RPNA 1A23A 1ERUA 2H75A 2C3TA 3TJFA 1XWKA 1UVZA 3QFBC 1M0UA 1SD9A 2GZZA 4ECCA 2JSYA 1TU7A 3H93A 2GTUA 2R2JA 5D73A 3QMXA 4I2UA 4TKYA 2LV3A 4KSOA 5D9TA 5C04A 2OBIA 4GWRA 19GSA 1H4OA 4PGTA 2JZRA 1ZOFA 3TKSC 4KDYA 2ON5A 1RQMA 5D9WA 2VO4A 4ILFA 2V2GA 3F6DA 3W8JA 5LCZA 3EYTA 1XWAA 3APOA 3MAKA 1B4QA 4RI6A 3HJMA 3TJJA 3A2WA 4IQAA 4XRAA 3TOTA 4YQVA 1SYRA 4TR3A 2NDOA 5DBQA 1I5GA 4NXIA 1SJ6A 5ECPB 1U3IA 2F51A 1X9SB 4BL7A 4G10A 1MEKA 3UEMA 5ABRA 3QR6A 4ZXGA 2PWJA 3F8UA 3I9V2 2XPEA 4O32A 2H0GA 2AHEA 4ISDA 2H19A 2WGRA 5DJLA 4K2DA 1ZYEA 5IPGA 1XVWA 1RW1A 2V41A 3HKRA 2H6YA 4IP6A 1Z6MA 4NWYA 3DVWA 1U88A 5HQPA 1A24A 1X5DA 1YZXA 4N30A 5D9XA 1T1VA 4EE0A 1B9XC 5CP1A 3TOUA 4EL1A 2LRNA 1BAYA 2L4CA 2LUSA 2YOIA 1GSFA 3C73A 2GQMA 3KXOA 5ECMB 2HZFA 3EU4A 2K8SA 2D2ZA 3DXBA 2HRFA 3FZ9A 1CQGA 4YAVA 3ERGA 3IXRA 2R5GA 4GTUA 2F8FA 2QGVA 3P90A 2NVLA 3CRUA 3UL3A 2R4VA 6GSSA 3QCPA 5D93A 3P2AA 1SK0A 2GGTA 1ACVA 1GH2A 3L9UA 2AB6A 4V1Ap 4E8HA 1SK1A 3GKXA 3M9JA 3VWVA 3HDCA 4X43A 1GSQA 3HYPA 2FA8A 3ED3A 4BVXA 4EF0A 4KAEA 1HNBA 3TRXA 2E2GA 3L0HA 1EV4A 4LLRA 2VCQA 5ELGA 2HZEA 5HFIA 3VWWA 4XIHA 3H79A 4ZL8A 1SL0B 3MNGA 4HS1A 1KEBA 3KMNA 4IW9A 5EL8A 1TDIA 1BQ7A 2PN8A 4GXZA 6GSYA
chains in the Genus database with same CATH superfamily
2V6KA 2RUEA 1E2YA 2H8LA 1MDIA 2P0GA 2YPMA 4MABA 2L6DA 2OBKA 5IPHA 4L0WA 4Q5QA 5AIXA 4EUYA 4AF2A 5COHA 3FZ5A 1K3LA 3S9FA 4J57E 3G7YA 3KP9A 3RPPA 14GSA 1T00A 2IPAA 1FB0A 4YQMA 4MA9A 1NW2A 3E9JB 3HD5A 1O85A 1FHEA 3HVNA 2OACA 4MP4A 4WEYA 2OE1A 2J9HA 1OC9B 3N9JA 3GKMA 4POMA 4L8EA 2HSMA 3GTUB 5LD0A 4WF4A 5GAND 2GDRA 4TR4A 1TRSA 5A4WA 1QUWA 3Q74A 4ID0A 4BVYB 2P31A 3EC3A 5DALB 2H6XA 2A2SA 3GA4A 3CYNA 3HXSA 2YWNA 1F6MC 1XWCA 1U87A 1EGOA 1FB6A 1JHBA 2C4JA 2E0QA 2DJKA 3VI5A 1O6JA 2QSIA 2HT9A 3A2VA 5H5QA 1XZOA 2EIOA 4BWSA 2VIMA 3TJGA 2WB9A 2H1BA 5G2ZA 4FYBA 3D4TA 3GX8A 4MNNA 1MDJA 1JLWA 1ST9A 2VUPA 3F3QA 1XPVA 2KOKA 4FH8A 3I43A 2IJYA 3C7MA 2XBQA 3ZREA 4OMVA 1XFLA 1PX7A 1WPIA 4POKA 5J5NA 1HD2A 2DIYA 4MH3A 2DJ1A 2AUVA 5B7CA 4Z7XA 3DGQA 2OE0A 5KOXA 1O73A 3EMXA 4AJ7A 2IMKA 2JSZA 4KH7A 1SD8A 2L5OA 5ECNB 1JZOA 3EVIA 5JCUA 1TTZA 2OJLA 2VD1A 2CV4A 3H1NA 1X0RA 4IP1A 3F63A 2LQOA 3HCZA 1A0FA 1V2AA 2GQLA 4F82A 1DBYA 4DEJA 2YV9A 2VCXA 2GVPA 3GL3A 4JR6A 4DSRA 2VL2C 1B9YC 2R0CA 4ML1A 3E3EA 1X9MB 3PR8A 1XVQA 2DLXA 1ZGNA 2C0EA 3BJ5A 4A5PA 3DWVA 1EZKA 4BL7B 5IOXA 3GFKA 4EXJA 2I1UA 4WR5A 1OKTA 1FW1A 5DCGA 8GSSA 2HXKA 3ZMLA 2F9SA 3A3TA 4V1Ag 4MH2A 2JZTA 3WD6A 1Y6EA 2UZ8A 4JRRA 1Z9HA 4I6XA 4J2FA 4CY6A 3EWLA 2FWFA 3GHAA 2K9FA 1YY7A 2YZUA 1EP7A 2GZPA 2PGTA 4K6XA 3HVVA 4PX1A 5JWOB 5HFGA 4K0GA 4NMUA 3C1SA 1XOBA 2IWTA 3VI7A 4OWYA 4IN0A 4N10A 5CRWA 5ECLB 1PA3A 3FYGA 3QAGA 2HLSA 4NV5A 4HQSA 3HZ8A 1ABAA 1LJRA 3KIJA 1VF4A 1SJZA 3FZAA 1OC9A 3W6GA 3GTUA 1YF0A 5ECIB 3G7IA 1AQWA 2Z9SA 3M9KA 2YV7A 1ILOA 4LMWA 3GUSA 1JZWA 1AIUA 5CAXA 1FOHA 1GTBA 1N8JA 5DALA 3NOFA 3RHBA 2TRCP 4NHWA 2V32A 4PXOA 2FA4A 5G1KA 2O89A 1W89A 1B48A 4JU5A 1PX6A 3K8NA 4KDUA 1BEDA 2OKAA 2NTOA 4O5QA 1OE7A 2YJHA 1UC7A 2H70A 2YANA 2QKEA 3CSJA 2NBSA 3MYDA 4ZB6A 3DKSA 1O7UA 1QMVA 3KP8A 3CBUA 3IOSA 4JR4A 3HVSA 2GSRA 5DQYA 1LBKA 4KCAA 4OO4A 4X1UA 3ZIJA 2YWOA 1AC1A 2A4HA 5ELAA 1BX9A 1HQOA 2B5EA 2QA2A 3LXZA 2QC7A 1KTEA 3LG6A 3GMFA 4MZCA 2CZ2A 2WFCA 1DE1A 2WRTA 1G7OA 4TR0A 4IHUA 2BTOT 4K7OA 4OD7A 1Z7PA 4KB3A 1DUGA 1Z7RA 2IMEA 1B8XA 3APQA 4PQ1A 1HNAA 1NHOA 5GSSA 2FNOA 3VLNA 2LEGA 2PUKC 5D9VA 5E4WA 1V9WA 4D73B 2R3XA 4EDYA 3IHQA 1GTAA 1OC8A 5B6NA 2RM5A 5CRDA 1F3BA 3GX0A 4I5QA 1T8EB 3F4RA 5AIVA 4AGSA 4GLTA 4WF5A 1EP8A 1UA5A 3O3TA 1A8YA 4X0XA 4FIWA 4L5OA 1GTUA 1BJXA 2X64A 1J9BA 2R6KA 3FY7A 1KNGA 3C8EA 2BMXA 4TXVA 3GSSA 2C0GA 3L78A 2C3QA 5C00A 3ZMKA 1DSBA 3ZITA 3DIEA 2VCWA 3LGCA 6GSTA 5KEJA 4ACSA 1PL2A 2ON7A 3IR4A 2IFQB 5DVBA 5J4UA 1UN2A 4I97A 5F06A 2LSTA 4KCEA 3R2QA 4XTSA 1MTCA 1X5CA 1U3AA 2CAQA 1PKWA 4KE3A 4V2LA 4KA0A 1XW6A 2VL3A 4G9HA 1THOA 4Z2UA 1XWGA 3IAM2 2VCVA 1W4VA 4HZ2A 2MMNA 3V1WA 2PVOC 1NM3A 5DCHA 3IV4A 4GSNA 1F2EA 1ZMAA 4POBA 2PPTA 3A2XA 4EKZA 2VLVA 1SK2A 5IO2A 1GSDA 5JCGA 1K0DA 1S3CA 3ZFBA 4MJAA 3HA9A 5J9BA 3DRNA 4K2XA 4QL9A 2H0HA 3KTLA 9GSSA 6GSXA 2AV4A 2H74A 4E8EA 4PNGA 2C0FA 2VM2A 2MMZA 2RIIA 2GZYA 1YF1A 1AUCA 4GQCA 2FUG2 4XRDA 4O7HA 5BMUA 4WXTA 1XW5A 4K0NA 4GF0A 3CTFA 3TKQA 4BA7A 1FO5A 3VWXA 4HU9A 4K5RA 3G9BA 2MMAA 4NHZA 1T4YA 1OAZA 2EC4A 5G30A 4MLYA 2KUCA 1QFNA 1TXXA 1WE0A 3IK9A 1K0MA 3ME8A 4IS0A 4CHSA 4YKFA 4WKWA 1ZYPA 3ZRDA 3DVXA 1SL2B 1WIKA 2OADA 1JZRA 1AQVA 3TGZA 1ZYQB 2FGXA 4RUVA 4Z2TA 2M80A 3M1GA 5L71A 3G7JA 1U6TA 1ML6A 3CMIA 1GWCA 4G19A 2LKUA 2R0GA 1QQ2A 3TRQA 2DSAA 2L59A 4Z2RA 5D96A 1VGLA 2X49A 4K1FA 4KX4A 1R4WA 1XOAA 3KZQA 1EGRA 2MYGA 3F9UA 2ES7A 4IVFA 2HSHA 4MF5A 4TR1B 1A8LA 5JWQB 1T4ZA 2YJ7A 2IMFA 1PRXA 4N0VA 5H5RA 4PUFC 4YAPA 4F2IA 4POLA 2CZ3A 5EY6A 6GSWA 4D73A 1TP9A 4JEDA 2G0FA 3RHCA 1WWJA 4ZB8A 1M9BA 2FD3A 4GSTA 5G1LA 1V98A 5KN3A 3TRPA 2CT6A 2I9HA 1K3OA 3VWUA 5CRHA 4BIKA 5JWRB 2H66A 4FO5A 3BD2A 2M46A 4P3YB 2HI7A 1A2JA 2NPBA 20GSA 3D4MA 2F3MA 3R3EA 4NV2A 7GSSA 2WZ9A 4MPFA 3PH9A 3GRXA 1PD21 4PQIA 4ULXA 3WYWA 18GSA 4IQ1A 4LL1B 1FVKA 5ECOB 1PMTA 3I6AA 2IFQA 3IHGA 1TW9A 22GSA 2HYXA 4IGJA 1YJ6A 1AQXA 1URMA 2DBCA 5CREA 4ZIJA 4K7IA 4WR4A 1TK8B 1O8XA 5EPFA 5CNWA 1OYJA 2AJQB 4H86A 4L0UA 5HR2A 3GSTA 3M0FA 3ZL5A 2L5LA 1PKZA 1Z3EA 1THXA 4FYCA 3LXTA 3UJ1A 1Z5YE 3PPUA 1F3AA 6GSVA 2K18A 4GSSA 2R37A 5AGYA 3VK9A 1J08A 5ENUA 3GKKA 4GQFA 1AAZA 3LJRA 5FWGA 1EEMA 3GURA 5IMZA 1TRVA 5GSTA 2HRNA 4QL7A 2PBJA 1KBNA 2WCIA 3M3MA 2KP2A 2TIRA 1PL1A 4KNDA 1OC3A 2ALBA 2FCHA 3GV1A 5ECRB 4EIQA 1GL8A 1S3RA 2CVKA 3H8QA 5F8BA 2IL3A 4Q5RA 5AN1A 1Z6NA 4ZILA 2HFDA 4Q5FA 4KUNA 4ZBAA 3F4TA 5AISA 4YH2A 5B8AA 4F0CA 2C1YA 2CVDA 3CQFA 2X99A 2DIZA 3IBHA 1EOHA 1NSWA 4DSQA 3J7Yb 1GSYA 2I3YA 1X9WB 1GNEA 1G6WA 2VLTA 2JADA 5IOWA 2B7JA 2B5YA 2JU5A 1QK8A 1QGVA 4G2EA 1GNWA 4OFNA 4OFMA 1GUHA 3IA1A 2PU9C 1SU9A 3E0UA 3FKFA 5F0GA 1K0AA 2X4AA 4OCFA 4ECBA 1GUKA 1V58A 4TR1A 1MDKA 4EIPA 2VCTA 3IPZA 4HJ2A 1I9DA 2LNSA 3LSZA 2RUFA 2H72A 1OE8A 2TRXA 2IN3A 1YEXA 3ME7A 3HJPA 3ZYWA 2WDUA 3P8WA 2GS3A 4MJEA 2LJAA 5CRGA 2XHFA 2I4AA 4HDEA 3L9SA 4HUAA 4K9ZA 2O7KA 2X8GA 2C0DA 2F8AA 4IJ3A 2K6VA 2CVBA 3Q18A 1NHYA 3UARA 3CSHA 3HJOA 5KOWA 1TKDB 2N5AA 2CQ9A 2KLXA 2VL9A 3ZLPA 2DKHA 5IMDA 2A2RA 1E6BA 4PTSA 3WT1A 4IELA 5CO3A 4ZL9A 3PGTA 3FRCA 1WMJA 1TI1A 3J7Yk 2YP6A 3W8SA 2X8HA 4XCSA 3TKPA 4PUAA 4CY8A 4HU7A 1PQNA 2LTKA 3L9VA 4KDXA 4MJCA 3VURA 4XS4B 3KJYA 1FG4A 2H1AA 4NAXA 1GSSA 3RDWA 3TKSE 5J9CA 2MBSA 2OA7A 3L4NA 2H1DA 5G5FA 1K0NA 1FOVA 3O6TA 2MMOA 3QDNA 4OCEA 1GULA 1YKAA 1DE2A 5F07A 1AW9A 3HHVA 1GRXA 13GSA 1J0FA 2GT5A 1CQHA 5LNKe 3KMOA 1GP1A 2L6CA 1WOUA 3IC8A 4FYUA 4O5UA 4DSSB 2XPDA 4XS6A 2IMIA 2H01A 2RM6A 3FW2A 4ZB9A 12GSA 3QAWA 3GN3A 3VFIA 4LL4B 4YKGA 3KEBA 2X8CA 2LJRA 1RK4A 3DYRA 2LJKA 4O92A 2I81A 4PNFA 4YQUA 2XBIA 3GH9A 3LW9A 1HYUA 2C80A 3IC4A 4KF9A 3H4KA 4K8MA 1HNCA 3WT2A 1GTIA 2YWIA 17GSA 5DAKB 3BBYA 4PURA 5KN2A 4OFTA 4HJMA 4Q5NA 3WGXA 3EE2A 1LU4A 3BCIA 1A2MA 2LRCA 3MWHA 3ZVJA 1TU8A 3C71A 3D6IA 3IRAA 3CRTA 2DJ3A 1TRUA 3VPQA 2CX3A 3D22A 3FR3A 5FHIA 2LNTA 3OR5A 2L57A 1XWBA 3EURA 3MDKA 3CXGA 1QXHA 3EPTA 4ZL7A 4FQUA 1K0CA 1YQ1A 1V40A 3U6VA 3TCOA 2HSYA 1M3JA 4TXOB 1SKRB 4ZBDA 4EC0A 3BOAA 5J41A 2YNXA 16GSA 1GSEA 3ISOA 5IMFA 3TKSA 2CA8A 2KHPA 1EEJA 4MMMA 1G7DA 5ECQB 1TOFA 3TUEA 1OVNA 5INYA 1K0OA 2GSQA 2G2QA 2AYTA 3FMWA 2VAFA 2A2PA 3TKRA 4V2NA 5B6MA 4IBPA 3SBCA 1XG8A 3O76A 1ZZYA 5D8IA 3GKNA 3QOUA 2V1MA 1S3DA 4HQZA 1N2AA 3EMPA 4HI7A 1TK5B 4USSA 3MIXA 3UVTA 1XW9A 4CDOA 2B6MA 4BWQA 1V57A 2M72A 5G31A 1VF2A 1JLVA 3FR6A 4F03A 3FK8A 2FLSA 2B7KA 2LRTA 1GSUA 2CX4A 3IAS2 5HR1A 1WP0A 1YEPA 2H30A 4HEA2 2QA1A 2PMTA 4TRXA 3FEUA 1XBSA 2MBTA 5F05A 2PERA 5GZZB 1K0BA 4WBRD 4MJBA 3HZ4A 2N5BA 4XS4A 3LQ7A 4RI7A 2LQQA 2PVQA 3WGEA 2JZSA 1S3AA 2E7PA 3Q6OA 4TN8A 4BPYA 1MD4A 2IMDA 1VF3A 3N5OA 3F0IA 3QFAC 3KTBA 1IYIA 4O5RA 1A2LA 3GNJA 4I8BA 1SENA 1ERWA 1TJDA 4GRFA 3ZZXA 2C3NA 4WETA 3CTGA 2GQKA 2HRAA 3KH9A 1T3BA 1R7HA 2DMMA 2WJUA 1B4PA 2B3SA 1K3YA 2JL4A 3A5WA 3UMAA 4G0LA 4DSSA 2GLRA 3ZTLA 2FWHA 3RBTA 3FHKA 4QQ7A 3NIVA 4HOJA 3C1RA 4EO3A 2LS5A 2HRKA 1XCCA 4G0KA 4MDCA 1Q98A 4TW5A 4GCIA 5HR0A 2YWMA 3GIXA 4JBBA 2REMA 4N11A 2MZCA 1Q4JA 3FZ4A 1BG5A 1FAAA 3PINA 4TVEA 2O87A 3ZFLA 3JCML 2DJ2A 4ZBBA 1R5AA 3TDGA 3LYKA 5DAKA 4ECIA 1ERVA 3Q19A 4ICYA 4IKHA 4KSMA 3KCMA 3UIWA 5CYYA 3FR9A 3ZIVA 2O8VB 3KD0A 5ID2B 2DJJA 4ML6A 4V2MA 3GYKA 2J23A 4LMVA 2ZUPA 1SL1B 2E2MA 3TJKA 5BRTA 5KN0A 2EIRA 4K7NA 2OE3A 3IK7A 4G0IA 4JE1A 4RQXA 1X5EA 2GSSA 3LYPA 1VRSD 2FWEA 4EVMA 2H6ZA 1XXUA 4RQRA 5IMCA 1PN9A 1ON4A 2K8VA 2O85A 1TK0B 4TXOA 1JZDA 3LEFA 3KM6A 1SJIA 1ZL9A 3TB2A 5EVOA 2WS2A 2FHEA 3HY2A 1F9MA 1C72A 5IIZA 4MPGA 3F4SA 2V6OA 3AY8A 1OKDA 3U5RE 3UBLA 1A0RP 10GSA 3IE3A 1Y25A 4OO5A 5HR3A 3P7XA 3QD9A 2B5XA 2VD0A 4TOPA 2P5RA 2P5QA 5IMVA 3IDVA 4K5SA 5IQYA 3D5JA 3I69A 4X4JA 3ERWA 4DVCA 5FT3A 1SKSB 2DMLA 4PQHA 5A4VA 2RLIA 3HVXA 5DDLA 4KW6A 3UBKA 4MZWA 3TJBA 5A5KA 2DJ0A 5ECHB 4WBJA 1ZCPA 4CW9A 2M66A 3LORA 1T7PB 5IM9A 5JCWA 3QPMA 5KN1A 1GUMA 3MSZA 2IIYA 1EWXA 5IO0A 2KP1A 1M2BA 2BJXA 11GSA 2EIQA 3APSA 5E59A 3RAZA 5IMAA 4EDZA 1GLPA 1H75A 3DD3A 4L5LA 2VOCA 2B1LA 5B8BA 3UOMA 3LWAA 4XHMA 1VF1A 2HE3A 4AJ6A 2WULA 2H73A 5GAPD 3GL5A 4J56E 4MZBA 2JACA 4F9ZA 2DC5A 3M8NA 1G7EA 4ECJA 4I2TA 3UAPA 2VM1A 2XC2A 3QAVA 5HFKA 1TI3A 3UVHA 2L4QA 1EOGA 2YZHA 1PSQA 4JZQA 5ECSA 4HZ4A 1FVJA 4AJ8A 1WJKA 1YDKA 1JFUA 3KH7A 3DMLA 1WRYA 1TRWA 5H5SA 1SYXA 4F0BA 2YN1A 3WGDA 1R26A 1M2DA 1M2AA 2N5FA 3EU3A 2A4VA 1MD3A 2VCZA 2VL2A 2H0IA 4N0ZA 1F37A 1IYHA 3DEXA 1G0TA 2CAIA 1M3IA 1AXDA 4XS1A 2GT6A 4MCUA 3ZVJD 2YCDA 1R5PA 3GH6A 1YKCA 1BYEA 2FY6A 2B1KA 4BVYA 1EV9A 1G6YA 2GSTA 4KGIA 1M99A 1SKWB 3F3RA 5A4UA 2HNLA 5ID2A 3BCKA 3F6FA 2C8UA 3EINA 4MF6A 2H71A 3ERFA 3KGKA 1PGTA 4BVXB 4MF7A 2ZCTA 2H1GA 2HZEB 5G5EA 5J3RA 4IJIA 3US3A 1M7TA 5ECKB 2AAWA 2DKIA 3LFLA 3D0ZA 1GLQA 1XIYA 5DJMA 1USBA 1PFOA 4MK3A 2H76A 2FWGA 3D21A 3VPTA 4NPBA 1ERTA 1O81A 3NZNA 4LA1A 2ZNMA 3SWLA 3CSIA 1O8WA 5DQSA 2VLUA 6GSUA 1M9AA 3RPNA 1A23A 1ERUA 2H75A 2C3TA 3TJFA 1XWKA 1UVZA 3QFBC 1M0UA 1SD9A 2GZZA 4ECCA 2JSYA 1TU7A 3H93A 2GTUA 2R2JA 5D73A 3QMXA 2R0PA 4I2UA 4TKYA 2LV3A 4KSOA 5D9TA 5C04A 2OBIA 4GWRA 19GSA 1H4OA 4PGTA 2JZRA 1ZOFA 3A5IA 3TKSC 4KDYA 2ON5A 1RQMA 5D9WA 2VO4A 4ILFA 2V2GA 3F6DA 3W8JA 5LCZA 3EYTA 1XWAA 3APOA 3MAKA 1B4QA 4RI6A 3HJMA 3TJJA 3A2WA 4IQAA 4XRAA 3TOTA 4YQVA 1SYRA 4TR3A 2NDOA 5DBQA 1I5GA 4NXIA 1SJ6A 5ECPB 1U3IA 2F51A 1PN0A 1X9SB 4BL7A 4G10A 1MEKA 3UEMA 5ABRA 3QR6A 4ZXGA 2PWJA 3F8UA 3I9V2 2XPEA 4O32A 2H0GA 2AHEA 4ISDA 2H19A 2WGRA 5DJLA 4K2DA 1ZYEA 5IPGA 1XVWA 1RW1A 2V41A 3HKRA 2H6YA 4IP6A 1Z6MA 4NWYA 3DVWA 1U88A 5HQPA 1A24A 1X5DA 1YZXA 1ZYNA 4N30A 5D9XA 1T1VA 4EE0A 1B9XC 5CP1A 3TOUA 4EL1A 2LRNA 1BAYA 4HSCX 2L4CA 2LUSA 2YOIA 1GSFA 3C73A 2GQMA 3KXOA 2HZFA 5ECMB 3EU4A 2K8SA 2D2ZA 3DXBA 2HRFA 3FZ9A 1CQGA 4YAVA 3ERGA 3IXRA 2R5GA 4GTUA 2F8FA 2QGVA 3P90A 2NVLA 3CRUA 3UL3A 2R4VA 6GSSA 3QCPA 5D93A 3P2AA 1SK0A 2GGTA 1ACVA 1GH2A 3L9UA 2AB6A 4V1Ap 4E8HA 1SK1A 3GKXA 3M9JA 3VWVA 3HDCA 4X43A 1GSQA 3HYPA 2FA8A 3ED3A 4BVXA 4EF0A 4KAEA 1HNBA 3TRXA 2E2GA 3L0HA 1EV4A 4LLRA 2VCQA 5ELGA 2HZEA 5HFIA 3VWWA 4XIHA 3H79A 4ZL8A 1SL0B 3MNGA 4HS1A 1KEBA 3KMNA 4IW9A 5EL8A 1TDIA 1BQ7A 2PN8A 4GXZA 6GSYA
chains in the Genus database with same CATH topology
2V6KA 2RUEA 1E2YA 2H8LA 1MDIA 2P0GA 2YPMA 4MABA 2L6DA 2OBKA 5IPHA 4L0WA 4Q5QA 5AIXA 4EUYA 4AF2A 5COHA 3FZ5A 1K3LA 3S9FA 4J57E 3G7YA 3KP9A 3RPPA 14GSA 1T00A 2IPAA 1FB0A 4YQMA 4MA9A 1NW2A 3E9JB 3HD5A 1O85A 1FHEA 2OACA 4MP4A 4WEYA 2OE1A 2J9HA 1OC9B 3N9JA 3GKMA 4POMA 4L8EA 2HSMA 3GTUB 5LD0A 4WF4A 5GAND 2GDRA 4TR4A 1TRSA 5A4WA 1QUWA 3Q74A 4ID0A 4BVYB 2P31A 3EC3A 5DALB 2H6XA 2A2SA 3GA4A 3CYNA 3HXSA 2YWNA 1F6MC 1XWCA 1U87A 1EGOA 1FB6A 1JHBA 2C4JA 2E0QA 2DJKA 3VI5A 1O6JA 2QSIA 2HT9A 3A2VA 5H5QA 1XZOA 2EIOA 4BWSA 2VIMA 3TJGA 2WB9A 2H1BA 5G2ZA 4FYBA 3D4TA 3GX8A 4MNNA 1MDJA 1JLWA 1ST9A 2VUPA 3F3QA 1XPVA 2KOKA 4FH8A 3I43A 2IJYA 3C7MA 2XBQA 3ZREA 4OMVA 1XFLA 1PX7A 1WPIA 4POKA 5J5NA 1HD2A 2DIYA 4MH3A 2DJ1A 2AUVA 5B7CA 4Z7XA 3DGQA 2OE0A 5KOXA 1O73A 3EMXA 4AJ7A 2IMKA 2JSZA 4KH7A 1SD8A 2L5OA 5ECNB 1JZOA 3EVIA 5JCUA 1TTZA 2OJLA 2VD1A 2CV4A 3H1NA 1X0RA 4IP1A 3F63A 2LQOA 3HCZA 1A0FA 1V2AA 2GQLA 4F82A 1DBYA 4DEJA 2YV9A 2VCXA 2GVPA 3GL3A 4JR6A 4DSRA 2VL2C 1B9YC 2R0CA 4ML1A 3E3EA 1X9MB 3PR8A 1XVQA 2DLXA 1ZGNA 2C0EA 3BJ5A 4A5PA 3DWVA 1EZKA 4BL7B 5IOXA 3GFKA 4EXJA 2I1UA 4WR5A 1OKTA 1FW1A 5DCGA 8GSSA 2HXKA 3ZMLA 2F9SA 3A3TA 4V1Ag 4MH2A 2JZTA 3WD6A 1Y6EA 2UZ8A 4JRRA 1Z9HA 4I6XA 4J2FA 4CY6A 3EWLA 2FWFA 3GHAA 2K9FA 1YY7A 2YZUA 1EP7A 2GZPA 2PGTA 4K6XA 3HVVA 4PX1A 5JWOB 5HFGA 4K0GA 4NMUA 3C1SA 1XOBA 2IWTA 3VI7A 4OWYA 4IN0A 4N10A 5CRWA 5ECLB 1PA3A 3FYGA 3QAGA 2HLSA 4NV5A 4HQSA 3HZ8A 1ABAA 1LJRA 3KIJA 1VF4A 1SJZA 3FZAA 1OC9A 3W6GA 3GTUA 1YF0A 5ECIB 3G7IA 1AQWA 2Z9SA 3M9KA 2YV7A 1ILOA 4LMWA 3GUSA 1JZWA 1AIUA 5CAXA 1FOHA 1GTBA 1N8JA 5DALA 3NOFA 3RHBA 2TRCP 4NHWA 2V32A 4PXOA 2FA4A 5G1KA 2O89A 1W89A 1B48A 4JU5A 1PX6A 3K8NA 4KDUA 1BEDA 2OKAA 2NTOA 4O5QA 1OE7A 2YJHA 1UC7A 2H70A 2YANA 2QKEA 3CSJA 2NBSA 3MYDA 4ZB6A 3DKSA 1O7UA 1QMVA 3KP8A 3CBUA 3IOSA 4JR4A 3HVSA 2GSRA 5DQYA 1LBKA 4KCAA 4OO4A 4X1UA 3ZIJA 2YWOA 1AC1A 2A4HA 5ELAA 1BX9A 1HQOA 2B5EA 2QA2A 3LXZA 2QC7A 1KTEA 3LG6A 3GMFA 4MZCA 2CZ2A 2WFCA 1DE1A 2WRTA 1G7OA 4TR0A 4IHUA 2BTOT 4K7OA 4OD7A 1Z7PA 4KB3A 1DUGA 1Z7RA 2IMEA 1B8XA 3APQA 4PQ1A 1HNAA 1NHOA 5GSSA 2FNOA 3VLNA 2LEGA 2PUKC 5D9VA 5E4WA 1V9WA 4D73B 2R3XA 4EDYA 3IHQA 1GTAA 1OC8A 5B6NA 2RM5A 5CRDA 1F3BA 3GX0A 4I5QA 1T8EB 3F4RA 5AIVA 4AGSA 4GLTA 4WF5A 1EP8A 1UA5A 3O3TA 1A8YA 4X0XA 4FIWA 4L5OA 1GTUA 1BJXA 2X64A 1J9BA 2R6KA 3FY7A 1KNGA 3C8EA 2BMXA 4TXVA 3GSSA 2C0GA 3L78A 2C3QA 5C00A 3ZMKA 1DSBA 3ZITA 3DIEA 2VCWA 3LGCA 6GSTA 5KEJA 4ACSA 1PL2A 2ON7A 3IR4A 2IFQB 5DVBA 5J4UA 1UN2A 4I97A 5F06A 2LSTA 4KCEA 3R2QA 4XTSA 1MTCA 1X5CA 1U3AA 2CAQA 1PKWA 4KE3A 4V2LA 4KA0A 1XW6A 2VL3A 4G9HA 1THOA 4Z2UA 1XWGA 3IAM2 2VCVA 1W4VA 4HZ2A 2MMNA 3V1WA 2PVOC 1NM3A 5DCHA 3IV4A 4GSNA 1F2EA 1ZMAA 4POBA 2PPTA 3A2XA 4EKZA 2VLVA 1SK2A 5IO2A 1GSDA 5JCGA 1K0DA 1S3CA 3ZFBA 4MJAA 3HA9A 5J9BA 3DRNA 4K2XA 4QL9A 2H0HA 3KTLA 9GSSA 6GSXA 2AV4A 2H74A 4E8EA 4PNGA 2C0FA 2VM2A 2MMZA 2RIIA 2GZYA 1YF1A 1AUCA 4GQCA 2FUG2 4XRDA 4O7HA 5BMUA 4WXTA 1XW5A 4K0NA 4GF0A 3CTFA 3TKQA 4BA7A 1FO5A 3VWXA 4HU9A 4K5RA 3G9BA 2MMAA 4NHZA 1T4YA 1OAZA 2EC4A 5G30A 4MLYA 2KUCA 1QFNA 1TXXA 1WE0A 3IK9A 1K0MA 3ME8A 4IS0A 4CHSA 4YKFA 4WKWA 1ZYPA 3ZRDA 3DVXA 1SL2B 1WIKA 2OADA 1JZRA 1AQVA 3TGZA 1ZYQB 2FGXA 4RUVA 4Z2TA 2M80A 3M1GA 5L71A 3G7JA 1U6TA 1ML6A 3CMIA 1GWCA 4G19A 2LKUA 2R0GA 1QQ2A 3TRQA 2DSAA 2L59A 4Z2RA 5D96A 1VGLA 2X49A 4K1FA 4KX4A 1R4WA 1XOAA 3KZQA 1EGRA 2MYGA 3F9UA 2ES7A 4IVFA 2HSHA 4MF5A 4TR1B 1A8LA 5JWQB 1T4ZA 2YJ7A 2IMFA 1PRXA 4N0VA 5H5RA 4PUFC 4YAPA 4F2IA 4POLA 2CZ3A 5EY6A 6GSWA 4D73A 1TP9A 4JEDA 2G0FA 3RHCA 1WWJA 4ZB8A 1M9BA 2FD3A 4GSTA 5G1LA 1V98A 5KN3A 3TRPA 2CT6A 2I9HA 1K3OA 3VWUA 5CRHA 5JWRB 2H66A 4FO5A 3BD2A 2M46A 4P3YB 2HI7A 1A2JA 2NPBA 20GSA 3D4MA 2F3MA 3R3EA 4NV2A 7GSSA 2WZ9A 4MPFA 3PH9A 3GRXA 1PD21 4PQIA 4ULXA 3WYWA 18GSA 4IQ1A 4LL1B 1FVKA 5ECOB 1PMTA 3I6AA 2IFQA 3IHGA 1TW9A 22GSA 2HYXA 4IGJA 1YJ6A 1AQXA 1URMA 2DBCA 5CREA 4ZIJA 4K7IA 4WR4A 1TK8B 1O8XA 5EPFA 5CNWA 1OYJA 2AJQB 4H86A 4L0UA 5HR2A 3GSTA 3M0FA 3ZL5A 2L5LA 1PKZA 1Z3EA 1THXA 4FYCA 3LXTA 3UJ1A 1Z5YE 3PPUA 1F3AA 6GSVA 2K18A 4GSSA 2R37A 5AGYA 3VK9A 1J08A 5ENUA 3GKKA 4GQFA 1AAZA 3LJRA 5FWGA 1EEMA 3GURA 5IMZA 1TRVA 5GSTA 2HRNA 4QL7A 2PBJA 1KBNA 2WCIA 3M3MA 2KP2A 2TIRA 1PL1A 4KNDA 1OC3A 2ALBA 2FCHA 3GV1A 5ECRB 4EIQA 1GL8A 2CVKA 3H8QA 5F8BA 2IL3A 4Q5RA 5AN1A 1Z6NA 4ZILA 2HFDA 4Q5FA 4KUNA 4ZBAA 3F4TA 5AISA 4YH2A 5B8AA 4F0CA 2C1YA 2CVDA 2X99A 2DIZA 3IBHA 1EOHA 1NSWA 4DSQA 3J7Yb 1GSYA 2I3YA 1X9WB 1GNEA 1G6WA 2VLTA 2JADA 5IOWA 2B7JA 2B5YA 2JU5A 1QK8A 1QGVA 4G2EA 1GNWA 4OFNA 4OFMA 1GUHA 3IA1A 2PU9C 1SU9A 3E0UA 3FKFA 5F0GA 1K0AA 2X4AA 4OCFA 4ECBA 1GUKA 1V58A 4TR1A 1MDKA 4EIPA 2VCTA 3IPZA 4HJ2A 1I9DA 2LNSA 3LSZA 2RUFA 2H72A 1OE8A 2TRXA 2IN3A 1YEXA 3ME7A 3HJPA 3ZYWA 2WDUA 3P8WA 2GS3A 4MJEA 2LJAA 5CRGA 2XHFA 2I4AA 4HDEA 3L9SA 4HUAA 4K9ZA 2O7KA 2X8GA 2C0DA 2F8AA 4IJ3A 2K6VA 2CVBA 3Q18A 1NHYA 3UARA 3CSHA 3HJOA 5KOWA 1TKDB 2N5AA 2CQ9A 2KLXA 2VL9A 3ZLPA 2DKHA 5IMDA 2A2RA 1E6BA 4PTSA 3WT1A 4IELA 5CO3A 4ZL9A 3PGTA 3FRCA 1WMJA 1TI1A 3J7Yk 2YP6A 3W8SA 2X8HA 4XCSA 3TKPA 4PUAA 4CY8A 4HU7A 1PQNA 2LTKA 3L9VA 4KDXA 4MJCA 3VURA 4XS4B 3KJYA 1FG4A 2H1AA 4NAXA 1GSSA 3RDWA 3TKSE 5J9CA 2MBSA 2OA7A 3L4NA 2H1DA 5G5FA 1K0NA 1FOVA 3O6TA 2MMOA 3QDNA 4OCEA 1GULA 1YKAA 1DE2A 5F07A 1AW9A 3HHVA 1GRXA 13GSA 1J0FA 2GT5A 1CQHA 5LNKe 3KMOA 1GP1A 2L6CA 1WOUA 3IC8A 4FYUA 4O5UA 4DSSB 2XPDA 4XS6A 2IMIA 2H01A 2RM6A 3FW2A 4ZB9A 12GSA 3QAWA 3GN3A 3VFIA 4LL4B 4YKGA 3KEBA 2X8CA 2LJRA 1RK4A 3DYRA 2LJKA 4O92A 2I81A 4PNFA 4YQUA 2XBIA 3GH9A 3LW9A 1HYUA 2C80A 3IC4A 4KF9A 3H4KA 4K8MA 1HNCA 3WT2A 1GTIA 2YWIA 17GSA 5DAKB 3BBYA 4PURA 5KN2A 4OFTA 4HJMA 4Q5NA 3WGXA 3EE2A 1LU4A 3BCIA 1A2MA 2LRCA 3MWHA 3ZVJA 1TU8A 3C71A 3D6IA 3IRAA 3CRTA 2DJ3A 1TRUA 3VPQA 2CX3A 3D22A 3FR3A 5FHIA 2LNTA 3OR5A 2L57A 1XWBA 3EURA 3MDKA 3CXGA 1QXHA 3EPTA 4ZL7A 4FQUA 1K0CA 1YQ1A 1V40A 3U6VA 3TCOA 2HSYA 4TXOB 1SKRB 4ZBDA 4EC0A 3BOAA 5J41A 2YNXA 16GSA 1GSEA 3ISOA 5IMFA 3TKSA 2CA8A 2KHPA 1EEJA 4MMMA 1G7DA 5ECQB 1TOFA 3TUEA 1OVNA 5INYA 1K0OA 2GSQA 2G2QA 2AYTA 3FMWA 2VAFA 2A2PA 3TKRA 4V2NA 5B6MA 4IBPA 3SBCA 3O76A 1ZZYA 5D8IA 3GKNA 3QOUA 2V1MA 1S3DA 4HQZA 1N2AA 3EMPA 4HI7A 1TK5B 4USSA 3MIXA 3UVTA 1XW9A 4CDOA 2B6MA 4BWQA 1V57A 2M72A 5G31A 1VF2A 1JLVA 3FR6A 4F03A 3FK8A 2FLSA 2B7KA 2LRTA 1GSUA 2CX4A 3IAS2 5HR1A 1WP0A 1YEPA 2H30A 4HEA2 2QA1A 2PMTA 4TRXA 3FEUA 1XBSA 2MBTA 5F05A 2PERA 5GZZB 1K0BA 4WBRD 4MJBA 3HZ4A 2N5BA 4XS4A 3LQ7A 4RI7A 2LQQA 2PVQA 3WGEA 2JZSA 1S3AA 2E7PA 3Q6OA 4TN8A 4BPYA 1MD4A 2IMDA 1VF3A 3N5OA 3F0IA 3QFAC 3KTBA 1IYIA 4O5RA 1A2LA 3GNJA 4I8BA 1SENA 1ERWA 1TJDA 4GRFA 3ZZXA 2C3NA 4WETA 3CTGA 2GQKA 2HRAA 3KH9A 1T3BA 1R7HA 2DMMA 2WJUA 1B4PA 2B3SA 1K3YA 2JL4A 3A5WA 3UMAA 4G0LA 4DSSA 2GLRA 3ZTLA 2FWHA 3RBTA 3FHKA 4QQ7A 3NIVA 4HOJA 3C1RA 4EO3A 2LS5A 2HRKA 1XCCA 4G0KA 4MDCA 1Q98A 4TW5A 4GCIA 5HR0A 2YWMA 3GIXA 4JBBA 2REMA 4N11A 2MZCA 1Q4JA 3FZ4A 1BG5A 1FAAA 3PINA 4TVEA 2O87A 3ZFLA 3JCML 2DJ2A 4ZBBA 1R5AA 3TDGA 3LYKA 5DAKA 4ECIA 1ERVA 3Q19A 4ICYA 4IKHA 4KSMA 3KCMA 3UIWA 5CYYA 3FR9A 3ZIVA 2O8VB 3KD0A 5ID2B 2DJJA 4ML6A 4V2MA 3GYKA 2J23A 4LMVA 2ZUPA 1SL1B 2E2MA 3TJKA 5BRTA 5KN0A 2EIRA 4K7NA 2OE3A 3IK7A 4G0IA 4JE1A 4RQXA 1X5EA 2GSSA 3LYPA 1VRSD 2FWEA 4EVMA 2H6ZA 1XXUA 4RQRA 5IMCA 1PN9A 1ON4A 2K8VA 2O85A 1TK0B 4TXOA 1JZDA 3LEFA 3KM6A 1SJIA 1ZL9A 3TB2A 5EVOA 2WS2A 2FHEA 3HY2A 1F9MA 1C72A 5IIZA 4MPGA 3F4SA 2V6OA 3AY8A 1OKDA 3U5RE 3UBLA 1A0RP 10GSA 3IE3A 1Y25A 4OO5A 5HR3A 3P7XA 3QD9A 2B5XA 2VD0A 4TOPA 2P5RA 2P5QA 5IMVA 3IDVA 4K5SA 5IQYA 3D5JA 3I69A 4X4JA 3ERWA 4DVCA 5FT3A 1SKSB 2DMLA 4PQHA 5A4VA 2RLIA 3HVXA 5DDLA 4KW6A 3UBKA 4MZWA 3TJBA 5A5KA 2DJ0A 5ECHB 4WBJA 1ZCPA 4CW9A 2M66A 3LORA 1T7PB 5IM9A 5JCWA 3QPMA 5KN1A 1GUMA 3MSZA 2IIYA 1EWXA 5IO0A 2KP1A 1M2BA 2BJXA 11GSA 2EIQA 3APSA 5E59A 3RAZA 5IMAA 4EDZA 1GLPA 1H75A 3DD3A 4L5LA 2VOCA 2B1LA 5B8BA 3UOMA 3LWAA 4XHMA 1VF1A 2HE3A 4AJ6A 2WULA 2H73A 5GAPD 3GL5A 4J56E 4MZBA 2JACA 4F9ZA 2DC5A 3M8NA 1G7EA 4ECJA 4I2TA 3UAPA 2VM1A 2XC2A 3QAVA 5HFKA 1TI3A 3UVHA 2L4QA 1EOGA 2YZHA 1PSQA 4JZQA 5ECSA 4HZ4A 1FVJA 4AJ8A 1WJKA 1YDKA 1JFUA 3KH7A 3DMLA 1WRYA 1TRWA 5H5SA 1SYXA 4F0BA 2YN1A 3WGDA 1R26A 1M2DA 1M2AA 2N5FA 3EU3A 2A4VA 1MD3A 2VCZA 2VL2A 2H0IA 4N0ZA 1F37A 1IYHA 3DEXA 1G0TA 2CAIA 1AXDA 4XS1A 2GT6A 4MCUA 3ZVJD 2YCDA 1R5PA 3GH6A 1YKCA 1BYEA 2FY6A 2B1KA 4BVYA 1EV9A 1G6YA 2GSTA 4KGIA 1M99A 1SKWB 3F3RA 5A4UA 2HNLA 5ID2A 3BCKA 3F6FA 2C8UA 3EINA 4MF6A 2H71A 3ERFA 3KGKA 1PGTA 4BVXB 4MF7A 2ZCTA 2H1GA 2HZEB 5G5EA 5J3RA 4IJIA 3US3A 1M7TA 5ECKB 2AAWA 2DKIA 3LFLA 3D0ZA 1GLQA 1XIYA 5DJMA 1USBA 4MK3A 2H76A 2FWGA 3D21A 3VPTA 4NPBA 1ERTA 1O81A 3NZNA 4LA1A 2ZNMA 3SWLA 3CSIA 1O8WA 5DQSA 2VLUA 6GSUA 1M9AA 3RPNA 1A23A 1ERUA 2H75A 2C3TA 3TJFA 1XWKA 1UVZA 3QFBC 1M0UA 1SD9A 2GZZA 4ECCA 2JSYA 1TU7A 3H93A 2GTUA 2R2JA 5D73A 3QMXA 2R0PA 4I2UA 4TKYA 2LV3A 4KSOA 5D9TA 5C04A 2OBIA 4GWRA 19GSA 1H4OA 4PGTA 2JZRA 1ZOFA 3A5IA 3TKSC 4KDYA 2ON5A 1RQMA 5D9WA 2VO4A 4ILFA 2V2GA 3F6DA 3W8JA 5LCZA 3EYTA 1XWAA 3APOA 3MAKA 1B4QA 4RI6A 3HJMA 3TJJA 3A2WA 4IQAA 4XRAA 3TOTA 4YQVA 1SYRA 4TR3A 2NDOA 5DBQA 1I5GA 4NXIA 1SJ6A 5ECPB 1U3IA 2F51A 1PN0A 1X9SB 4BL7A 4G10A 1MEKA 3UEMA 5ABRA 3QR6A 4ZXGA 2PWJA 3F8UA 3I9V2 2XPEA 4O32A 2H0GA 2AHEA 4ISDA 2H19A 2WGRA 5DJLA 4K2DA 1ZYEA 5IPGA 1XVWA 1RW1A 2V41A 3HKRA 2H6YA 4IP6A 1Z6MA 4NWYA 3DVWA 1U88A 5HQPA 1A24A 1X5DA 1YZXA 1ZYNA 4N30A 5D9XA 1T1VA 4EE0A 1B9XC 5CP1A 3TOUA 4EL1A 2LRNA 1BAYA 2L4CA 2LUSA 2YOIA 1GSFA 3C73A 2GQMA 3KXOA 2HZFA 5ECMB 3EU4A 2K8SA 2D2ZA 3DXBA 2HRFA 3FZ9A 1CQGA 4YAVA 3ERGA 3IXRA 2R5GA 4GTUA 2F8FA 2QGVA 3P90A 2NVLA 3CRUA 3UL3A 2R4VA 6GSSA 3QCPA 5D93A 3P2AA 1SK0A 2GGTA 1ACVA 1GH2A 3L9UA 2AB6A 4V1Ap 4E8HA 1SK1A 3GKXA 3M9JA 3VWVA 3HDCA 4X43A 1GSQA 3HYPA 2FA8A 3ED3A 4BVXA 4EF0A 4KAEA 1HNBA 3TRXA 2E2GA 3L0HA 1EV4A 4LLRA 2VCQA 5ELGA 2HZEA 5HFIA 3VWWA 4XIHA 3H79A 4ZL8A 1SL0B 3MNGA 4HS1A 1KEBA 3KMNA 4IW9A 5EL8A 1TDIA 1BQ7A 2PN8A 4GXZA 6GSYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V6K A;  2RUE A;  1E2Y A;  2H8L A;  1MDI A;  2P0G A;  2YPM A;  4MAB A;  2L6D A;  2OBK A;  5IPH A;  4L0W A;  4Q5Q A;  5AIX A;  4EUY A;  4AF2 A;  5COH A;  3FZ5 A;  1K3L A;  3S9F A;  4J57 E;  3G7Y A;  3KP9 A;  3RPP A;  14GS A;  1T00 A;  2IPA A;  1FB0 A;  4YQM A;  4MA9 A;  1NW2 A;  3E9J B;  3HD5 A;  1O85 A;  1FHE A;  2OAC A;  4MP4 A;  4WEY A;  2OE1 A;  2J9H A;  1OC9 B;  3N9J A;  3GKM A;  4POM A;  4L8E A;  3GTU B;  5LD0 A;  4WF4 A;  5GAN D;  2GDR A;  4TR4 A;  1TRS A;  5A4W A;  1QUW A;  3Q74 A;  4ID0 A;  2P31 A;  3EC3 A;  5DAL B;  2H6X A;  2A2S A;  3GA4 A;  3CYN A;  3HXS A;  2YWN A;  1F6M C;  1XWC A;  1U87 A;  1EGO A;  1FB6 A;  1JHB A;  2C4J A;  2E0Q A;  2DJK A;  3VI5 A;  1O6J A;  2QSI A;  2HT9 A;  3A2V A;  5H5Q A;  1XZO A;  2EIO A;  4BWS A;  2VIM A;  3TJG A;  2WB9 A;  2H1B A;  5G2Z A;  4FYB A;  3D4T A;  3GX8 A;  1MDJ A;  1JLW A;  1ST9 A;  2VUP A;  3F3Q A;  1XPV A;  2KOK A;  4FH8 A;  3I43 A;  2IJY A;  3C7M A;  2XBQ A;  3ZRE A;  4OMV A;  1XFL A;  1PX7 A;  1WPI A;  4POK A;  5J5N A;  1HD2 A;  2DIY A;  4MH3 A;  2DJ1 A;  2AUV A;  5B7C A;  4Z7X A;  3DGQ A;  2OE0 A;  1O73 A;  3EMX A;  4AJ7 A;  2IMK A;  2JSZ A;  4KH7 A;  1SD8 A;  2L5O A;  5ECN B;  1JZO A;  3EVI A;  5JCU A;  1TTZ A;  2OJL A;  2VD1 A;  2CV4 A;  3H1N A;  1X0R A;  4IP1 A;  3F63 A;  2LQO A;  3HCZ A;  1A0F A;  1V2A A;  2GQL A;  4F82 A;  1DBY A;  4DEJ A;  2YV9 A;  2VCX A;  2GVP A;  3GL3 A;  4JR6 A;  4DSR A;  2VL2 C;  1B9Y C;  4ML1 A;  3E3E A;  1X9M B;  3PR8 A;  1XVQ A;  2DLX A;  1ZGN A;  2C0E A;  3BJ5 A;  3DWV A;  1EZK A;  5IOX A;  3GFK A;  4EXJ A;  2I1U A;  4WR5 A;  1OKT A;  1FW1 A;  5DCG A;  8GSS A;  2HXK A;  3ZML A;  2F9S A;  3A3T A;  4V1A g;  4MH2 A;  2JZT A;  3WD6 A;  1Y6E A;  4JRR A;  1Z9H A;  4I6X A;  4J2F A;  3EWL A;  2FWF A;  3GHA A;  2K9F A;  1YY7 A;  2YZU A;  1EP7 A;  2GZP A;  2PGT A;  4K6X A;  3HVV A;  4PX1 A;  5JWO B;  5HFG A;  4K0G A;  4NMU A;  3C1S A;  1XOB A;  2IWT A;  3VI7 A;  4OWY A;  4IN0 A;  4N10 A;  5CRW A;  5ECL B;  1PA3 A;  3FYG A;  3QAG A;  2HLS A;  4NV5 A;  4HQS A;  3HZ8 A;  1ABA A;  1LJR A;  3KIJ A;  1VF4 A;  1SJZ A;  3FZA A;  1OC9 A;  3W6G A;  3GTU A;  1YF0 A;  5ECI B;  3G7I A;  1AQW A;  2Z9S A;  3M9K A;  2YV7 A;  1ILO A;  4LMW A;  3GUS A;  1JZW A;  1AIU A;  5CAX A;  1GTB A;  1N8J A;  5DAL A;  3NOF A;  3RHB A;  2TRC P;  4NHW A;  2V32 A;  4PXO A;  2FA4 A;  5G1K A;  2O89 A;  1W89 A;  1B48 A;  4JU5 A;  1PX6 A;  3K8N A;  4KDU A;  1BED A;  2OKA A;  2NTO A;  1OE7 A;  2YJH A;  1UC7 A;  2H70 A;  2YAN A;  2QKE A;  3CSJ A;  2NBS A;  4ZB6 A;  3DKS A;  1O7U A;  1QMV A;  3KP8 A;  3CBU A;  3IOS A;  4JR4 A;  3HVS A;  2GSR A;  5DQY A;  1LBK A;  4KCA A;  4OO4 A;  4X1U A;  3ZIJ A;  2YWO A;  1AC1 A;  5ELA A;  1BX9 A;  1HQO A;  2B5E A;  3LXZ A;  2QC7 A;  1KTE A;  3LG6 A;  3GMF A;  4MZC A;  2CZ2 A;  2WFC A;  1DE1 A;  2WRT A;  1G7O A;  4TR0 A;  4IHU A;  2BTO T;  4K7O A;  4OD7 A;  1Z7P A;  4KB3 A;  1DUG A;  1Z7R A;  2IME A;  1B8X A;  3APQ A;  4PQ1 A;  1HNA A;  1NHO A;  5GSS A;  2FNO A;  3VLN A;  2LEG A;  2PUK C;  5D9V A;  5E4W A;  1V9W A;  4D73 B;  2R3X A;  4EDY A;  3IHQ A;  1GTA A;  1OC8 A;  5B6N A;  2RM5 A;  5CRD A;  1F3B A;  3GX0 A;  4I5Q A;  1T8E B;  3F4R A;  5AIV A;  4AGS A;  4GLT A;  4WF5 A;  1EP8 A;  1UA5 A;  3O3T A;  1A8Y A;  4X0X A;  4FIW A;  4L5O A;  1GTU A;  1BJX A;  2X64 A;  1J9B A;  2R6K A;  3FY7 A;  1KNG A;  3C8E A;  2BMX A;  4TXV A;  3GSS A;  2C0G A;  3L78 A;  2C3Q A;  5C00 A;  3ZMK A;  1DSB A;  3ZIT A;  3DIE A;  2VCW A;  3LGC A;  6GST A;  5KEJ A;  4ACS A;  1PL2 A;  2ON7 A;  3IR4 A;  2IFQ B;  5DVB A;  5J4U A;  1UN2 A;  4I97 A;  5F06 A;  2LST A;  4KCE A;  3R2Q A;  4XTS A;  1MTC A;  1X5C A;  1U3A A;  2CAQ A;  1PKW A;  4KE3 A;  4V2L A;  4KA0 A;  1XW6 A;  2VL3 A;  4G9H A;  1THO A;  1XWG A;  3IAM 2;  2VCV A;  1W4V A;  4HZ2 A;  2MMN A;  3V1W A;  2PVO C;  1NM3 A;  5DCH A;  3IV4 A;  4GSN A;  1F2E A;  1ZMA A;  4POB A;  2PPT A;  3A2X A;  4EKZ A;  2VLV A;  1SK2 A;  5IO2 A;  1GSD A;  5JCG A;  1K0D A;  1S3C A;  3ZFB A;  4MJA A;  3HA9 A;  5J9B A;  3DRN A;  4QL9 A;  2H0H A;  3KTL A;  9GSS A;  6GSX A;  2AV4 A;  2H74 A;  4E8E A;  4PNG A;  2C0F A;  2VM2 A;  2MMZ A;  2RII A;  2GZY A;  1YF1 A;  1AUC A;  4GQC A;  2FUG 2;  4XRD A;  4O7H A;  4WXT A;  1XW5 A;  4K0N A;  4GF0 A;  3CTF A;  3TKQ A;  4BA7 A;  1FO5 A;  3VWX A;  4HU9 A;  3G9B A;  2MMA A;  4NHZ A;  1T4Y A;  1OAZ A;  2EC4 A;  5G30 A;  4MLY A;  2KUC A;  1QFN A;  1TXX A;  1WE0 A;  3IK9 A;  1K0M A;  3ME8 A;  4IS0 A;  4CHS A;  4WKW A;  3ZRD A;  3DVX A;  1SL2 B;  1WIK A;  2OAD A;  1JZR A;  1AQV A;  3TGZ A;  1ZYQ B;  2FGX A;  4RUV A;  2M80 A;  3M1G A;  5L71 A;  3G7J A;  1U6T A;  1ML6 A;  3CMI A;  1GWC A;  4G19 A;  2LKU A;  1QQ2 A;  3TRQ A;  2DSA A;  2L59 A;  5D96 A;  1VGL A;  4K1F A;  4KX4 A;  1R4W A;  1XOA A;  3KZQ A;  1EGR A;  2MYG A;  3F9U A;  2ES7 A;  4IVF A;  2HSH A;  4MF5 A;  4TR1 B;  1A8L A;  5JWQ B;  1T4Z A;  2YJ7 A;  2IMF A;  1PRX A;  4N0V A;  5H5R A;  4PUF C;  4YAP A;  4F2I A;  4POL A;  2CZ3 A;  5EY6 A;  6GSW A;  4D73 A;  1TP9 A;  4JED A;  2G0F A;  3RHC A;  1WWJ A;  4ZB8 A;  1M9B A;  2FD3 A;  4GST A;  5G1L A;  1V98 A;  5KN3 A;  3TRP A;  2CT6 A;  2I9H A;  1K3O A;  3VWU A;  5CRH A;  5JWR B;  2H66 A;  4FO5 A;  3BD2 A;  2M46 A;  4P3Y B;  2HI7 A;  1A2J A;  2NPB A;  20GS A;  3D4M A;  2F3M A;  4NV2 A;  7GSS A;  2WZ9 A;  4MPF A;  3PH9 A;  3GRX A;  1PD2 1;  4PQI A;  4ULX A;  3WYW A;  18GS A;  4IQ1 A;  4LL1 B;  5ECO B;  1FVK A;  1PMT A;  3I6A A;  2IFQ A;  1TW9 A;  22GS A;  2HYX A;  4IGJ A;  1YJ6 A;  1AQX A;  1URM A;  2DBC A;  5CRE A;  4ZIJ A;  4K7I A;  4WR4 A;  1TK8 B;  1O8X A;  5EPF A;  5CNW A;  1OYJ A;  2AJQ B;  4H86 A;  4L0U A;  5HR2 A;  3GST A;  3M0F A;  3ZL5 A;  2L5L A;  1PKZ A;  1Z3E A;  1THX A;  4FYC A;  3LXT A;  3UJ1 A;  1Z5Y E;  1F3A A;  6GSV A;  2K18 A;  4GSS A;  2R37 A;  5AGY A;  3VK9 A;  1J08 A;  5ENU A;  3GKK A;  4GQF A;  1AAZ A;  3LJR A;  5FWG A;  1EEM A;  3GUR A;  5IMZ A;  1TRV A;  5GST A;  2HRN A;  4QL7 A;  2PBJ A;  1KBN A;  2WCI A;  3M3M A;  2KP2 A;  2TIR A;  1PL1 A;  4KND A;  1OC3 A;  2ALB A;  2FCH A;  3GV1 A;  5ECR B;  1GL8 A;  2CVK A;  3H8Q A;  5F8B A;  2IL3 A;  4Q5R A;  5AN1 A;  1Z6N A;  4ZIL A;  2HFD A;  4Q5F A;  4KUN A;  4ZBA A;  3F4T A;  5AIS A;  4YH2 A;  5B8A A;  4F0C A;  2C1Y A;  2CVD A;  2X99 A;  2DIZ A;  3IBH A;  1EOH A;  1NSW A;  4DSQ A;  3J7Y b;  1GSY A;  2I3Y A;  1X9W B;  1GNE A;  1G6W A;  2VLT A;  2JAD A;  5IOW A;  2B7J A;  2B5Y A;  2JU5 A;  1QK8 A;  1QGV A;  4G2E A;  1GNW A;  4OFN A;  4OFM A;  1GUH A;  3IA1 A;  2PU9 C;  1SU9 A;  3E0U A;  3FKF A;  5F0G A;  1K0A A;  4OCF A;  4ECB A;  1GUK A;  1V58 A;  4TR1 A;  1MDK A;  2VCT A;  3IPZ A;  4HJ2 A;  1I9D A;  2LNS A;  3LSZ A;  2RUF A;  2H72 A;  1OE8 A;  2TRX A;  2IN3 A;  1YEX A;  3ME7 A;  3HJP A;  3ZYW A;  2WDU A;  3P8W A;  2GS3 A;  4MJE A;  2LJA A;  5CRG A;  2XHF A;  2I4A A;  4HDE A;  3L9S A;  4HUA A;  4K9Z A;  2O7K A;  2X8G A;  2C0D A;  2F8A A;  4IJ3 A;  2K6V A;  2CVB A;  3Q18 A;  1NHY A;  3UAR A;  3CSH A;  3HJO A;  1TKD B;  2N5A A;  2CQ9 A;  2KLX A;  2VL9 A;  3ZLP A;  5IMD A;  2A2R A;  1E6B A;  3WT1 A;  4IEL A;  5CO3 A;  4ZL9 A;  3PGT A;  3FRC A;  1WMJ A;  1TI1 A;  3J7Y k;  2YP6 A;  3W8S A;  2X8H A;  4XCS A;  3TKP A;  4PUA A;  4HU7 A;  1PQN A;  2LTK A;  3L9V A;  4KDX A;  4MJC A;  3VUR A;  4XS4 B;  3KJY A;  1FG4 A;  2H1A A;  4NAX A;  1GSS A;  3RDW A;  3TKS E;  5J9C A;  2MBS A;  2OA7 A;  3L4N A;  2H1D A;  5G5F A;  1K0N A;  1FOV A;  3O6T A;  2MMO A;  3QDN A;  4OCE A;  1GUL A;  1YKA A;  1DE2 A;  5F07 A;  1AW9 A;  3HHV A;  1GRX A;  13GS A;  1J0F A;  2GT5 A;  1CQH A;  5LNK e;  3KMO A;  1GP1 A;  2L6C A;  1WOU A;  4FYU A;  4DSS B;  2XPD A;  4XS6 A;  2IMI A;  2H01 A;  2RM6 A;  3FW2 A;  4ZB9 A;  12GS A;  3QAW A;  3GN3 A;  3VFI A;  4LL4 B;  3KEB A;  2X8C A;  2LJR A;  1RK4 A;  3DYR A;  2LJK A;  4O92 A;  2I81 A;  4PNF A;  4YQU A;  2XBI A;  3GH9 A;  1HYU A;  2C80 A;  3IC4 A;  3H4K A;  4K8M A;  1HNC A;  3WT2 A;  1GTI A;  2YWI A;  17GS A;  5DAK B;  3BBY A;  4PUR A;  5KN2 A;  4OFT A;  4HJM A;  4Q5N A;  3WGX A;  3EE2 A;  1LU4 A;  3BCI A;  1A2M A;  2LRC A;  3MWH A;  3ZVJ A;  1TU8 A;  3C71 A;  3D6I A;  3IRA A;  3CRT A;  2DJ3 A;  1TRU A;  3VPQ A;  2CX3 A;  3D22 A;  3FR3 A;  5FHI A;  2LNT A;  3OR5 A;  2L57 A;  1XWB A;  3EUR A;  3MDK A;  3CXG A;  1QXH A;  4ZL7 A;  1K0C A;  1YQ1 A;  1V40 A;  3U6V A;  3TCO A;  2HSY A;  4TXO B;  1SKR B;  4ZBD A;  4EC0 A;  3BOA A;  5J41 A;  2YNX A;  16GS A;  1GSE A;  3ISO A;  5IMF A;  3TKS A;  2CA8 A;  2KHP A;  1EEJ A;  4MMM A;  1G7D A;  5ECQ B;  1TOF A;  3TUE A;  1OVN A;  5INY A;  1K0O A;  2GSQ A;  2G2Q A;  2AYT A;  2VAF A;  3TKR A;  4V2N A;  5B6M A;  4IBP A;  3SBC A;  3O76 A;  1ZZY A;  5D8I A;  3GKN A;  3QOU A;  2V1M A;  1S3D A;  4HQZ A;  1N2A A;  3EMP A;  4HI7 A;  1TK5 B;  3UVT A;  1XW9 A;  4CDO A;  2B6M A;  4BWQ A;  1V57 A;  2M72 A;  5G31 A;  1VF2 A;  1JLV A;  3FR6 A;  4F03 A;  3FK8 A;  2FLS A;  2B7K A;  2LRT A;  1GSU A;  2CX4 A;  3IAS 2;  5HR1 A;  1WP0 A;  1YEP A;  2H30 A;  4HEA 2;  2PMT A;  4TRX A;  3FEU A;  1XBS A;  2MBT A;  5F05 A;  2PER A;  5GZZ B;  1K0B A;  4WBR D;  4MJB A;  3HZ4 A;  2N5B A;  4XS4 A;  3LQ7 A;  4RI7 A;  2LQQ A;  2PVQ A;  3WGE A;  2JZS A;  1S3A A;  2E7P A;  3Q6O A;  4TN8 A;  4BPY A;  1MD4 A;  2IMD A;  1VF3 A;  3N5O A;  3F0I A;  3QFA C;  3KTB A;  1IYI A;  4O5R A;  1A2L A;  3GNJ A;  4I8B A;  1SEN A;  1ERW A;  1TJD A;  4GRF A;  3ZZX A;  2C3N A;  4WET A;  3CTG A;  2GQK A;  3KH9 A;  1T3B A;  1R7H A;  2DMM A;  2WJU A;  1B4P A;  2B3S A;  1K3Y A;  2JL4 A;  3A5W A;  3UMA A;  4DSS A;  2GLR A;  3ZTL A;  2FWH A;  3RBT A;  3FHK A;  4QQ7 A;  3NIV A;  4HOJ A;  3C1R A;  4EO3 A;  2LS5 A;  1XCC A;  4MDC A;  1Q98 A;  4TW5 A;  4GCI A;  5HR0 A;  2YWM A;  3GIX A;  4JBB A;  2REM A;  4N11 A;  2MZC A;  1Q4J A;  3FZ4 A;  1BG5 A;  1FAA A;  3PIN A;  4TVE A;  2O87 A;  3ZFL A;  3JCM L;  2DJ2 A;  4ZBB A;  1R5A A;  3TDG A;  3LYK A;  5DAK A;  4ECI A;  1ERV A;  3Q19 A;  4IKH A;  4KSM A;  3KCM A;  3UIW A;  5CYY A;  3FR9 A;  3ZIV A;  2O8V B;  3KD0 A;  5ID2 B;  2DJJ A;  4ML6 A;  4V2M A;  3GYK A;  2J23 A;  4LMV A;  2ZUP A;  1SL1 B;  2E2M A;  3TJK A;  5KN0 A;  2EIR A;  4K7N A;  2OE3 A;  3IK7 A;  4JE1 A;  4RQX A;  1X5E A;  2GSS A;  3LYP A;  1VRS D;  2FWE A;  4EVM A;  2H6Z A;  1XXU A;  4RQR A;  5IMC A;  1PN9 A;  1ON4 A;  2K8V A;  2O85 A;  1TK0 B;  4TXO A;  1JZD A;  3LEF A;  3KM6 A;  1SJI A;  1ZL9 A;  3TB2 A;  5EVO A;  2WS2 A;  2FHE A;  3HY2 A;  1F9M A;  1C72 A;  5IIZ A;  4MPG A;  3F4S A;  2V6O A;  3AY8 A;  1OKD A;  3U5R E;  3UBL A;  1A0R P;  10GS A;  3IE3 A;  1Y25 A;  4OO5 A;  5HR3 A;  3P7X A;  3QD9 A;  2B5X A;  2VD0 A;  4TOP A;  2P5R A;  2P5Q A;  5IMV A;  3IDV A;  5IQY A;  3D5J A;  3I69 A;  3ERW A;  4DVC A;  5FT3 A;  1SKS B;  2DML A;  4PQH A;  5A4V A;  2RLI A;  3HVX A;  5DDL A;  4KW6 A;  3UBK A;  4MZW A;  3TJB A;  5A5K A;  2DJ0 A;  5ECH B;  4WBJ A;  1ZCP A;  4CW9 A;  2M66 A;  3LOR A;  1T7P B;  5IM9 A;  5JCW A;  3QPM A;  5KN1 A;  1GUM A;  3MSZ A;  2IIY A;  1EWX A;  5IO0 A;  2KP1 A;  1M2B A;  2BJX A;  11GS A;  2EIQ A;  3APS A;  5E59 A;  3RAZ A;  5IMA A;  4EDZ A;  1GLP A;  1H75 A;  3DD3 A;  4L5L A;  2VOC A;  2B1L A;  5B8B A;  3UOM A;  3LWA A;  4XHM A;  1VF1 A;  2HE3 A;  4AJ6 A;  2WUL A;  2H73 A;  5GAP D;  3GL5 A;  4J56 E;  4MZB A;  2JAC A;  4F9Z A;  2DC5 A;  3M8N A;  1G7E A;  4ECJ A;  4I2T A;  3UAP A;  2VM1 A;  2XC2 A;  3QAV A;  5HFK A;  1TI3 A;  3UVH A;  2L4Q A;  1EOG A;  2YZH A;  1PSQ A;  4JZQ A;  5ECS A;  4HZ4 A;  1FVJ A;  4AJ8 A;  1WJK A;  1YDK A;  1JFU A;  3KH7 A;  3DML A;  1WRY A;  1TRW A;  5H5S A;  1SYX A;  4F0B A;  2YN1 A;  3WGD A;  1R26 A;  1M2D A;  1M2A A;  2N5F A;  3EU3 A;  2A4V A;  1MD3 A;  2VCZ A;  2VL2 A;  2H0I A;  4N0Z A;  1F37 A;  1IYH A;  3DEX A;  1G0T A;  2CAI A;  1AXD A;  4XS1 A;  2GT6 A;  4MCU A;  3ZVJ D;  2YCD A;  1R5P A;  3GH6 A;  1YKC A;  1BYE A;  2FY6 A;  2B1K A;  4BVY A;  1EV9 A;  1G6Y A;  2GST A;  4KGI A;  1M99 A;  1SKW B;  3F3R A;  5A4U A;  2HNL A;  5ID2 A;  3BCK A;  3F6F A;  2C8U A;  3EIN A;  4MF6 A;  2H71 A;  3ERF A;  3KGK A;  1PGT A;  4MF7 A;  2ZCT A;  2H1G A;  2HZE B;  5G5E A;  5J3R A;  4IJI A;  3US3 A;  1M7T A;  5ECK B;  2AAW A;  3LFL A;  3D0Z A;  1GLQ A;  1XIY A;  5DJM A;  1USB A;  4MK3 A;  2H76 A;  2FWG A;  3D21 A;  3VPT A;  4NPB A;  1ERT A;  1O81 A;  3NZN A;  4LA1 A;  2ZNM A;  3SWL A;  3CSI A;  1O8W A;  5DQS A;  2VLU A;  6GSU A;  1M9A A;  3RPN A;  1A23 A;  1ERU A;  2H75 A;  2C3T A;  3TJF A;  1XWK A;  1UVZ A;  3QFB C;  1M0U A;  1SD9 A;  2GZZ A;  4ECC A;  2JSY A;  1TU7 A;  3H93 A;  2GTU A;  2R2J A;  5D73 A;  3QMX A;  4I2U A;  4TKY A;  2LV3 A;  4KSO A;  5D9T A;  5C04 A;  2OBI A;  4GWR A;  19GS A;  1H4O A;  4PGT A;  2JZR A;  1ZOF A;  3TKS C;  4KDY A;  2ON5 A;  1RQM A;  5D9W A;  2VO4 A;  4ILF A;  2V2G A;  3F6D A;  3W8J A;  5LCZ A;  3EYT A;  1XWA A;  3APO A;  3MAK A;  1B4Q A;  4RI6 A;  3HJM A;  3TJJ A;  3A2W A;  4IQA A;  4XRA A;  3TOT A;  4YQV A;  1SYR A;  4TR3 A;  2NDO A;  5DBQ A;  1I5G A;  4NXI A;  1SJ6 A;  5ECP B;  1U3I A;  2F51 A;  1X9S B;  4BL7 A;  4G10 A;  1MEK A;  3UEM A;  5ABR A;  3QR6 A;  4ZXG A;  2PWJ A;  3F8U A;  3I9V 2;  2XPE A;  4O32 A;  2H0G A;  2AHE A;  4ISD A;  2H19 A;  2WGR A;  5DJL A;  4K2D A;  1ZYE A;  5IPG A;  1XVW A;  1RW1 A;  2V41 A;  3HKR A;  2H6Y A;  4IP6 A;  1Z6M A;  4NWY A;  3DVW A;  1U88 A;  5HQP A;  1A24 A;  1X5D A;  1YZX A;  4N30 A;  5D9X A;  1T1V A;  4EE0 A;  1B9X C;  5CP1 A;  3TOU A;  4EL1 A;  2LRN A;  1BAY A;  2L4C A;  2LUS A;  2YOI A;  1GSF A;  3C73 A;  2GQM A;  3KXO A;  5ECM B;  2HZF A;  3EU4 A;  2K8S A;  2D2Z A;  3DXB A;  2HRF A;  3FZ9 A;  1CQG A;  4YAV A;  3ERG A;  3IXR A;  2R5G A;  4GTU A;  2F8F A;  2QGV A;  3P90 A;  2NVL A;  3CRU A;  3UL3 A;  2R4V A;  6GSS A;  3QCP A;  5D93 A;  3P2A A;  1SK0 A;  2GGT A;  1ACV A;  1GH2 A;  3L9U A;  2AB6 A;  4V1A p;  4E8H A;  1SK1 A;  3GKX A;  3M9J A;  3VWV A;  3HDC A;  4X43 A;  1GSQ A;  3HYP A;  2FA8 A;  3ED3 A;  4BVX A;  4EF0 A;  4KAE A;  1HNB A;  3TRX A;  2E2G A;  3L0H A;  1EV4 A;  4LLR A;  2VCQ A;  5ELG A;  2HZE A;  5HFI A;  3VWW A;  4XIH A;  3H79 A;  4ZL8 A;  1SL0 B;  3MNG A;  4HS1 A;  1KEB A;  3KMN A;  4IW9 A;  5EL8 A;  1TDI A;  1BQ7 A;  2PN8 A;  4GXZ A;  6GSY A; 
#chains in the Genus database with same CATH topology
 2V6K A;  2RUE A;  1E2Y A;  2H8L A;  1MDI A;  2P0G A;  2YPM A;  4MAB A;  2L6D A;  2OBK A;  5IPH A;  4L0W A;  4Q5Q A;  5AIX A;  4EUY A;  4AF2 A;  5COH A;  3FZ5 A;  1K3L A;  3S9F A;  4J57 E;  3G7Y A;  3KP9 A;  3RPP A;  14GS A;  1T00 A;  2IPA A;  1FB0 A;  4YQM A;  4MA9 A;  1NW2 A;  3E9J B;  3HD5 A;  1O85 A;  1FHE A;  3HVN A;  2OAC A;  4MP4 A;  4WEY A;  2OE1 A;  2J9H A;  1OC9 B;  3N9J A;  3GKM A;  4POM A;  4L8E A;  2HSM A;  3GTU B;  5LD0 A;  4WF4 A;  5GAN D;  2GDR A;  4TR4 A;  1TRS A;  5A4W A;  1QUW A;  3Q74 A;  4ID0 A;  4BVY B;  2P31 A;  3EC3 A;  5DAL B;  2H6X A;  2A2S A;  3GA4 A;  3CYN A;  3HXS A;  2YWN A;  1F6M C;  1XWC A;  1U87 A;  1EGO A;  1FB6 A;  1JHB A;  2C4J A;  2E0Q A;  2DJK A;  3VI5 A;  1O6J A;  2QSI A;  2HT9 A;  3A2V A;  5H5Q A;  1XZO A;  2EIO A;  4BWS A;  2VIM A;  3TJG A;  2WB9 A;  2H1B A;  5G2Z A;  4FYB A;  3D4T A;  3GX8 A;  4MNN A;  1MDJ A;  1JLW A;  1ST9 A;  2VUP A;  3F3Q A;  1XPV A;  2KOK A;  4FH8 A;  3I43 A;  2IJY A;  3C7M A;  2XBQ A;  3ZRE A;  4OMV A;  1XFL A;  1PX7 A;  1WPI A;  4POK A;  5J5N A;  1HD2 A;  2DIY A;  4MH3 A;  2DJ1 A;  2AUV A;  5B7C A;  4Z7X A;  3DGQ A;  2OE0 A;  5KOX A;  1O73 A;  3EMX A;  4AJ7 A;  2IMK A;  2JSZ A;  4KH7 A;  1SD8 A;  2L5O A;  5ECN B;  1JZO A;  3EVI A;  5JCU A;  1TTZ A;  2OJL A;  2VD1 A;  2CV4 A;  3H1N A;  1X0R A;  4IP1 A;  3F63 A;  2LQO A;  3HCZ A;  1A0F A;  1V2A A;  2GQL A;  4F82 A;  1DBY A;  4DEJ A;  2YV9 A;  2VCX A;  2GVP A;  3GL3 A;  4JR6 A;  4DSR A;  2VL2 C;  1B9Y C;  2R0C A;  4ML1 A;  3E3E A;  1X9M B;  3PR8 A;  1XVQ A;  2DLX A;  1ZGN A;  2C0E A;  3BJ5 A;  4A5P A;  3DWV A;  1EZK A;  4BL7 B;  5IOX A;  3GFK A;  4EXJ A;  2I1U A;  4WR5 A;  1OKT A;  1FW1 A;  5DCG A;  8GSS A;  2HXK A;  3ZML A;  2F9S A;  3A3T A;  4V1A g;  4MH2 A;  2JZT A;  3WD6 A;  1Y6E A;  2UZ8 A;  4JRR A;  1Z9H A;  4I6X A;  4J2F A;  4CY6 A;  3EWL A;  2FWF A;  3GHA A;  2K9F A;  1YY7 A;  2YZU A;  1EP7 A;  2GZP A;  2PGT A;  4K6X A;  3HVV A;  4PX1 A;  5JWO B;  5HFG A;  4K0G A;  4NMU A;  3C1S A;  1XOB A;  2IWT A;  3VI7 A;  4OWY A;  4IN0 A;  4N10 A;  5CRW A;  5ECL B;  1PA3 A;  3FYG A;  3QAG A;  2HLS A;  4NV5 A;  4HQS A;  3HZ8 A;  1ABA A;  1LJR A;  3KIJ A;  1VF4 A;  1SJZ A;  3FZA A;  1OC9 A;  3W6G A;  3GTU A;  1YF0 A;  5ECI B;  3G7I A;  1AQW A;  2Z9S A;  3M9K A;  2YV7 A;  1ILO A;  4LMW A;  3GUS A;  1JZW A;  1AIU A;  5CAX A;  1FOH A;  1GTB A;  1N8J A;  5DAL A;  3NOF A;  3RHB A;  2TRC P;  4NHW A;  2V32 A;  4PXO A;  2FA4 A;  5G1K A;  2O89 A;  1W89 A;  1B48 A;  4JU5 A;  1PX6 A;  3K8N A;  4KDU A;  1BED A;  2OKA A;  2NTO A;  4O5Q A;  1OE7 A;  2YJH A;  1UC7 A;  2H70 A;  2YAN A;  2QKE A;  3CSJ A;  2NBS A;  3MYD A;  4ZB6 A;  3DKS A;  1O7U A;  1QMV A;  3KP8 A;  3CBU A;  3IOS A;  4JR4 A;  3HVS A;  2GSR A;  5DQY A;  1LBK A;  4KCA A;  4OO4 A;  4X1U A;  3ZIJ A;  2YWO A;  1AC1 A;  2A4H A;  5ELA A;  1BX9 A;  1HQO A;  2B5E A;  2QA2 A;  3LXZ A;  2QC7 A;  1KTE A;  3LG6 A;  3GMF A;  4MZC A;  2CZ2 A;  2WFC A;  1DE1 A;  2WRT A;  1G7O A;  4TR0 A;  4IHU A;  2BTO T;  4K7O A;  4OD7 A;  1Z7P A;  4KB3 A;  1DUG A;  1Z7R A;  2IME A;  1B8X A;  3APQ A;  4PQ1 A;  1HNA A;  1NHO A;  5GSS A;  2FNO A;  3VLN A;  2LEG A;  2PUK C;  5D9V A;  5E4W A;  1V9W A;  4D73 B;  2R3X A;  4EDY A;  3IHQ A;  1GTA A;  1OC8 A;  5B6N A;  2RM5 A;  5CRD A;  1F3B A;  3GX0 A;  4I5Q A;  1T8E B;  3F4R A;  5AIV A;  4AGS A;  4GLT A;  4WF5 A;  1EP8 A;  1UA5 A;  3O3T A;  1A8Y A;  4X0X A;  4FIW A;  4L5O A;  1GTU A;  1BJX A;  2X64 A;  1J9B A;  2R6K A;  3FY7 A;  1KNG A;  3C8E A;  2BMX A;  4TXV A;  3GSS A;  2C0G A;  3L78 A;  2C3Q A;  5C00 A;  3ZMK A;  1DSB A;  3ZIT A;  3DIE A;  2VCW A;  3LGC A;  6GST A;  5KEJ A;  4ACS A;  1PL2 A;  2ON7 A;  3IR4 A;  2IFQ B;  5DVB A;  5J4U A;  1UN2 A;  4I97 A;  5F06 A;  2LST A;  4KCE A;  3R2Q A;  4XTS A;  1MTC A;  1X5C A;  1U3A A;  2CAQ A;  1PKW A;  4KE3 A;  4V2L A;  4KA0 A;  1XW6 A;  2VL3 A;  4G9H A;  1THO A;  4Z2U A;  1XWG A;  3IAM 2;  2VCV A;  1W4V A;  4HZ2 A;  2MMN A;  3V1W A;  2PVO C;  1NM3 A;  5DCH A;  3IV4 A;  4GSN A;  1F2E A;  1ZMA A;  4POB A;  2PPT A;  3A2X A;  4EKZ A;  2VLV A;  1SK2 A;  5IO2 A;  1GSD A;  5JCG A;  1K0D A;  1S3C A;  3ZFB A;  4MJA A;  3HA9 A;  5J9B A;  3DRN A;  4K2X A;  4QL9 A;  2H0H A;  3KTL A;  9GSS A;  6GSX A;  2AV4 A;  2H74 A;  4E8E A;  4PNG A;  2C0F A;  2VM2 A;  2MMZ A;  2RII A;  2GZY A;  1YF1 A;  1AUC A;  4GQC A;  2FUG 2;  4XRD A;  4O7H A;  5BMU A;  4WXT A;  1XW5 A;  4K0N A;  4GF0 A;  3CTF A;  3TKQ A;  4BA7 A;  1FO5 A;  3VWX A;  4HU9 A;  4K5R A;  3G9B A;  2MMA A;  4NHZ A;  1T4Y A;  1OAZ A;  2EC4 A;  5G30 A;  4MLY A;  2KUC A;  1QFN A;  1TXX A;  1WE0 A;  3IK9 A;  1K0M A;  3ME8 A;  4IS0 A;  4CHS A;  4YKF A;  4WKW A;  1ZYP A;  3ZRD A;  3DVX A;  1SL2 B;  1WIK A;  2OAD A;  1JZR A;  1AQV A;  3TGZ A;  1ZYQ B;  2FGX A;  4RUV A;  4Z2T A;  2M80 A;  3M1G A;  5L71 A;  3G7J A;  1U6T A;  1ML6 A;  3CMI A;  1GWC A;  4G19 A;  2LKU A;  2R0G A;  1QQ2 A;  3TRQ A;  2DSA A;  2L59 A;  4Z2R A;  5D96 A;  1VGL A;  2X49 A;  4K1F A;  4KX4 A;  1R4W A;  1XOA A;  3KZQ A;  1EGR A;  2MYG A;  3F9U A;  2ES7 A;  4IVF A;  2HSH A;  4MF5 A;  4TR1 B;  1A8L A;  5JWQ B;  1T4Z A;  2YJ7 A;  2IMF A;  1PRX A;  4N0V A;  5H5R A;  4PUF C;  4YAP A;  4F2I A;  4POL A;  2CZ3 A;  5EY6 A;  6GSW A;  4D73 A;  1TP9 A;  4JED A;  2G0F A;  3RHC A;  1WWJ A;  4ZB8 A;  1M9B A;  2FD3 A;  4GST A;  5G1L A;  1V98 A;  5KN3 A;  3TRP A;  2CT6 A;  2I9H A;  1K3O A;  3VWU A;  5CRH A;  4BIK A;  5JWR B;  2H66 A;  4FO5 A;  3BD2 A;  2M46 A;  4P3Y B;  2HI7 A;  1A2J A;  2NPB A;  20GS A;  3D4M A;  2F3M A;  3R3E A;  4NV2 A;  7GSS A;  2WZ9 A;  4MPF A;  3PH9 A;  3GRX A;  1PD2 1;  4PQI A;  4ULX A;  3WYW A;  18GS A;  4IQ1 A;  4LL1 B;  1FVK A;  5ECO B;  1PMT A;  3I6A A;  2IFQ A;  3IHG A;  1TW9 A;  22GS A;  2HYX A;  4IGJ A;  1YJ6 A;  1AQX A;  1URM A;  2DBC A;  5CRE A;  4ZIJ A;  4K7I A;  4WR4 A;  1TK8 B;  1O8X A;  5EPF A;  5CNW A;  1OYJ A;  2AJQ B;  4H86 A;  4L0U A;  5HR2 A;  3GST A;  3M0F A;  3ZL5 A;  2L5L A;  1PKZ A;  1Z3E A;  1THX A;  4FYC A;  3LXT A;  3UJ1 A;  1Z5Y E;  3PPU A;  1F3A A;  6GSV A;  2K18 A;  4GSS A;  2R37 A;  5AGY A;  3VK9 A;  1J08 A;  5ENU A;  3GKK A;  4GQF A;  1AAZ A;  3LJR A;  5FWG A;  1EEM A;  3GUR A;  5IMZ A;  1TRV A;  5GST A;  2HRN A;  4QL7 A;  2PBJ A;  1KBN A;  2WCI A;  3M3M A;  2KP2 A;  2TIR A;  1PL1 A;  4KND A;  1OC3 A;  2ALB A;  2FCH A;  3GV1 A;  5ECR B;  4EIQ A;  1GL8 A;  1S3R A;  2CVK A;  3H8Q A;  5F8B A;  2IL3 A;  4Q5R A;  5AN1 A;  1Z6N A;  4ZIL A;  2HFD A;  4Q5F A;  4KUN A;  4ZBA A;  3F4T A;  5AIS A;  4YH2 A;  5B8A A;  4F0C A;  2C1Y A;  2CVD A;  3CQF A;  2X99 A;  2DIZ A;  3IBH A;  1EOH A;  1NSW A;  4DSQ A;  3J7Y b;  1GSY A;  2I3Y A;  1X9W B;  1GNE A;  1G6W A;  2VLT A;  2JAD A;  5IOW A;  2B7J A;  2B5Y A;  2JU5 A;  1QK8 A;  1QGV A;  4G2E A;  1GNW A;  4OFN A;  4OFM A;  1GUH A;  3IA1 A;  2PU9 C;  1SU9 A;  3E0U A;  3FKF A;  5F0G A;  1K0A A;  2X4A A;  4OCF A;  4ECB A;  1GUK A;  1V58 A;  4TR1 A;  1MDK A;  4EIP A;  2VCT A;  3IPZ A;  4HJ2 A;  1I9D A;  2LNS A;  3LSZ A;  2RUF A;  2H72 A;  1OE8 A;  2TRX A;  2IN3 A;  1YEX A;  3ME7 A;  3HJP A;  3ZYW A;  2WDU A;  3P8W A;  2GS3 A;  4MJE A;  2LJA A;  5CRG A;  2XHF A;  2I4A A;  4HDE A;  3L9S A;  4HUA A;  4K9Z A;  2O7K A;  2X8G A;  2C0D A;  2F8A A;  4IJ3 A;  2K6V A;  2CVB A;  3Q18 A;  1NHY A;  3UAR A;  3CSH A;  3HJO A;  5KOW A;  1TKD B;  2N5A A;  2CQ9 A;  2KLX A;  2VL9 A;  3ZLP A;  2DKH A;  5IMD A;  2A2R A;  1E6B A;  4PTS A;  3WT1 A;  4IEL A;  5CO3 A;  4ZL9 A;  3PGT A;  3FRC A;  1WMJ A;  1TI1 A;  3J7Y k;  2YP6 A;  3W8S A;  2X8H A;  4XCS A;  3TKP A;  4PUA A;  4CY8 A;  4HU7 A;  1PQN A;  2LTK A;  3L9V A;  4KDX A;  4MJC A;  3VUR A;  4XS4 B;  3KJY A;  1FG4 A;  2H1A A;  4NAX A;  1GSS A;  3RDW A;  3TKS E;  5J9C A;  2MBS A;  2OA7 A;  3L4N A;  2H1D A;  5G5F A;  1K0N A;  1FOV A;  3O6T A;  2MMO A;  3QDN A;  4OCE A;  1GUL A;  1YKA A;  1DE2 A;  5F07 A;  1AW9 A;  3HHV A;  1GRX A;  13GS A;  1J0F A;  2GT5 A;  1CQH A;  5LNK e;  3KMO A;  1GP1 A;  2L6C A;  1WOU A;  3IC8 A;  4FYU A;  4O5U A;  4DSS B;  2XPD A;  4XS6 A;  2IMI A;  2H01 A;  2RM6 A;  3FW2 A;  4ZB9 A;  12GS A;  3QAW A;  3GN3 A;  3VFI A;  4LL4 B;  4YKG A;  3KEB A;  2X8C A;  2LJR A;  1RK4 A;  3DYR A;  2LJK A;  4O92 A;  2I81 A;  4PNF A;  4YQU A;  2XBI A;  3GH9 A;  3LW9 A;  1HYU A;  2C80 A;  3IC4 A;  4KF9 A;  3H4K A;  4K8M A;  1HNC A;  3WT2 A;  1GTI A;  2YWI A;  17GS A;  5DAK B;  3BBY A;  4PUR A;  5KN2 A;  4OFT A;  4HJM A;  4Q5N A;  3WGX A;  3EE2 A;  1LU4 A;  3BCI A;  1A2M A;  2LRC A;  3MWH A;  3ZVJ A;  1TU8 A;  3C71 A;  3D6I A;  3IRA A;  3CRT A;  2DJ3 A;  1TRU A;  3VPQ A;  2CX3 A;  3D22 A;  3FR3 A;  5FHI A;  2LNT A;  3OR5 A;  2L57 A;  1XWB A;  3EUR A;  3MDK A;  3CXG A;  1QXH A;  3EPT A;  4ZL7 A;  4FQU A;  1K0C A;  1YQ1 A;  1V40 A;  3U6V A;  3TCO A;  2HSY A;  1M3J A;  4TXO B;  1SKR B;  4ZBD A;  4EC0 A;  3BOA A;  5J41 A;  2YNX A;  16GS A;  1GSE A;  3ISO A;  5IMF A;  3TKS A;  2CA8 A;  2KHP A;  1EEJ A;  4MMM A;  1G7D A;  5ECQ B;  1TOF A;  3TUE A;  1OVN A;  5INY A;  1K0O A;  2GSQ A;  2G2Q A;  2AYT A;  3FMW A;  2VAF A;  2A2P A;  3TKR A;  4V2N A;  5B6M A;  4IBP A;  3SBC A;  1XG8 A;  3O76 A;  1ZZY A;  5D8I A;  3GKN A;  3QOU A;  2V1M A;  1S3D A;  4HQZ A;  1N2A A;  3EMP A;  4HI7 A;  1TK5 B;  4USS A;  3MIX A;  3UVT A;  1XW9 A;  4CDO A;  2B6M A;  4BWQ A;  1V57 A;  2M72 A;  5G31 A;  1VF2 A;  1JLV A;  3FR6 A;  4F03 A;  3FK8 A;  2FLS A;  2B7K A;  2LRT A;  1GSU A;  2CX4 A;  3IAS 2;  5HR1 A;  1WP0 A;  1YEP A;  2H30 A;  4HEA 2;  2QA1 A;  2PMT A;  4TRX A;  3FEU A;  1XBS A;  2MBT A;  5F05 A;  2PER A;  5GZZ B;  1K0B A;  4WBR D;  4MJB A;  3HZ4 A;  2N5B A;  4XS4 A;  3LQ7 A;  4RI7 A;  2LQQ A;  2PVQ A;  3WGE A;  2JZS A;  1S3A A;  2E7P A;  3Q6O A;  4TN8 A;  4BPY A;  1MD4 A;  2IMD A;  1VF3 A;  3N5O A;  3F0I A;  3QFA C;  3KTB A;  1IYI A;  4O5R A;  1A2L A;  3GNJ A;  4I8B A;  1SEN A;  1ERW A;  1TJD A;  4GRF A;  3ZZX A;  2C3N A;  4WET A;  3CTG A;  2GQK A;  2HRA A;  3KH9 A;  1T3B A;  1R7H A;  2DMM A;  2WJU A;  1B4P A;  2B3S A;  1K3Y A;  2JL4 A;  3A5W A;  3UMA A;  4G0L A;  4DSS A;  2GLR A;  3ZTL A;  2FWH A;  3RBT A;  3FHK A;  4QQ7 A;  3NIV A;  4HOJ A;  3C1R A;  4EO3 A;  2LS5 A;  2HRK A;  1XCC A;  4G0K A;  4MDC A;  1Q98 A;  4TW5 A;  4GCI A;  5HR0 A;  2YWM A;  3GIX A;  4JBB A;  2REM A;  4N11 A;  2MZC A;  1Q4J A;  3FZ4 A;  1BG5 A;  1FAA A;  3PIN A;  4TVE A;  2O87 A;  3ZFL A;  3JCM L;  2DJ2 A;  4ZBB A;  1R5A A;  3TDG A;  3LYK A;  5DAK A;  4ECI A;  1ERV A;  3Q19 A;  4ICY A;  4IKH A;  4KSM A;  3KCM A;  3UIW A;  5CYY A;  3FR9 A;  3ZIV A;  2O8V B;  3KD0 A;  5ID2 B;  2DJJ A;  4ML6 A;  4V2M A;  3GYK A;  2J23 A;  4LMV A;  2ZUP A;  1SL1 B;  2E2M A;  3TJK A;  5BRT A;  5KN0 A;  2EIR A;  4K7N A;  2OE3 A;  3IK7 A;  4G0I A;  4JE1 A;  4RQX A;  1X5E A;  2GSS A;  3LYP A;  1VRS D;  2FWE A;  4EVM A;  2H6Z A;  1XXU A;  4RQR A;  5IMC A;  1PN9 A;  1ON4 A;  2K8V A;  2O85 A;  1TK0 B;  4TXO A;  1JZD A;  3LEF A;  3KM6 A;  1SJI A;  1ZL9 A;  3TB2 A;  5EVO A;  2WS2 A;  2FHE A;  3HY2 A;  1F9M A;  1C72 A;  5IIZ A;  4MPG A;  3F4S A;  2V6O A;  3AY8 A;  1OKD A;  3U5R E;  3UBL A;  1A0R P;  10GS A;  3IE3 A;  1Y25 A;  4OO5 A;  5HR3 A;  3P7X A;  3QD9 A;  2B5X A;  2VD0 A;  4TOP A;  2P5R A;  2P5Q A;  5IMV A;  3IDV A;  4K5S A;  5IQY A;  3D5J A;  3I69 A;  4X4J A;  3ERW A;  4DVC A;  5FT3 A;  1SKS B;  2DML A;  4PQH A;  5A4V A;  2RLI A;  3HVX A;  5DDL A;  4KW6 A;  3UBK A;  4MZW A;  3TJB A;  5A5K A;  2DJ0 A;  5ECH B;  4WBJ A;  1ZCP A;  4CW9 A;  2M66 A;  3LOR A;  1T7P B;  5IM9 A;  5JCW A;  3QPM A;  5KN1 A;  1GUM A;  3MSZ A;  2IIY A;  1EWX A;  5IO0 A;  2KP1 A;  1M2B A;  2BJX A;  11GS A;  2EIQ A;  3APS A;  5E59 A;  3RAZ A;  5IMA A;  4EDZ A;  1GLP A;  1H75 A;  3DD3 A;  4L5L A;  2VOC A;  2B1L A;  5B8B A;  3UOM A;  3LWA A;  4XHM A;  1VF1 A;  2HE3 A;  4AJ6 A;  2WUL A;  2H73 A;  5GAP D;  3GL5 A;  4J56 E;  4MZB A;  2JAC A;  4F9Z A;  2DC5 A;  3M8N A;  1G7E A;  4ECJ A;  4I2T A;  3UAP A;  2VM1 A;  2XC2 A;  3QAV A;  5HFK A;  1TI3 A;  3UVH A;  2L4Q A;  1EOG A;  2YZH A;  1PSQ A;  4JZQ A;  5ECS A;  4HZ4 A;  1FVJ A;  4AJ8 A;  1WJK A;  1YDK A;  1JFU A;  3KH7 A;  3DML A;  1WRY A;  1TRW A;  5H5S A;  1SYX A;  4F0B A;  2YN1 A;  3WGD A;  1R26 A;  1M2D A;  1M2A A;  2N5F A;  3EU3 A;  2A4V A;  1MD3 A;  2VCZ A;  2VL2 A;  2H0I A;  4N0Z A;  1F37 A;  1IYH A;  3DEX A;  1G0T A;  2CAI A;  1M3I A;  1AXD A;  4XS1 A;  2GT6 A;  4MCU A;  3ZVJ D;  2YCD A;  1R5P A;  3GH6 A;  1YKC A;  1BYE A;  2FY6 A;  2B1K A;  4BVY A;  1EV9 A;  1G6Y A;  2GST A;  4KGI A;  1M99 A;  1SKW B;  3F3R A;  5A4U A;  2HNL A;  5ID2 A;  3BCK A;  3F6F A;  2C8U A;  3EIN A;  4MF6 A;  2H71 A;  3ERF A;  3KGK A;  1PGT A;  4BVX B;  4MF7 A;  2ZCT A;  2H1G A;  2HZE B;  5G5E A;  5J3R A;  4IJI A;  3US3 A;  1M7T A;  5ECK B;  2AAW A;  2DKI A;  3LFL A;  3D0Z A;  1GLQ A;  1XIY A;  5DJM A;  1USB A;  1PFO A;  4MK3 A;  2H76 A;  2FWG A;  3D21 A;  3VPT A;  4NPB A;  1ERT A;  1O81 A;  3NZN A;  4LA1 A;  2ZNM A;  3SWL A;  3CSI A;  1O8W A;  5DQS A;  2VLU A;  6GSU A;  1M9A A;  3RPN A;  1A23 A;  1ERU A;  2H75 A;  2C3T A;  3TJF A;  1XWK A;  1UVZ A;  3QFB C;  1M0U A;  1SD9 A;  2GZZ A;  4ECC A;  2JSY A;  1TU7 A;  3H93 A;  2GTU A;  2R2J A;  5D73 A;  3QMX A;  2R0P A;  4I2U A;  4TKY A;  2LV3 A;  4KSO A;  5D9T A;  5C04 A;  2OBI A;  4GWR A;  19GS A;  1H4O A;  4PGT A;  2JZR A;  1ZOF A;  3A5I A;  3TKS C;  4KDY A;  2ON5 A;  1RQM A;  5D9W A;  2VO4 A;  4ILF A;  2V2G A;  3F6D A;  3W8J A;  5LCZ A;  3EYT A;  1XWA A;  3APO A;  3MAK A;  1B4Q A;  4RI6 A;  3HJM A;  3TJJ A;  3A2W A;  4IQA A;  4XRA A;  3TOT A;  4YQV A;  1SYR A;  4TR3 A;  2NDO A;  5DBQ A;  1I5G A;  4NXI A;  1SJ6 A;  5ECP B;  1U3I A;  2F51 A;  1PN0 A;  1X9S B;  4BL7 A;  4G10 A;  1MEK A;  3UEM A;  5ABR A;  3QR6 A;  4ZXG A;  2PWJ A;  3F8U A;  3I9V 2;  2XPE A;  4O32 A;  2H0G A;  2AHE A;  4ISD A;  2H19 A;  2WGR A;  5DJL A;  4K2D A;  1ZYE A;  5IPG A;  1XVW A;  1RW1 A;  2V41 A;  3HKR A;  2H6Y A;  4IP6 A;  1Z6M A;  4NWY A;  3DVW A;  1U88 A;  5HQP A;  1A24 A;  1X5D A;  1YZX A;  1ZYN A;  4N30 A;  5D9X A;  1T1V A;  4EE0 A;  1B9X C;  5CP1 A;  3TOU A;  4EL1 A;  2LRN A;  1BAY A;  4HSC X;  2L4C A;  2LUS A;  2YOI A;  1GSF A;  3C73 A;  2GQM A;  3KXO A;  2HZF A;  5ECM B;  3EU4 A;  2K8S A;  2D2Z A;  3DXB A;  2HRF A;  3FZ9 A;  1CQG A;  4YAV A;  3ERG A;  3IXR A;  2R5G A;  4GTU A;  2F8F A;  2QGV A;  3P90 A;  2NVL A;  3CRU A;  3UL3 A;  2R4V A;  6GSS A;  3QCP A;  5D93 A;  3P2A A;  1SK0 A;  2GGT A;  1ACV A;  1GH2 A;  3L9U A;  2AB6 A;  4V1A p;  4E8H A;  1SK1 A;  3GKX A;  3M9J A;  3VWV A;  3HDC A;  4X43 A;  1GSQ A;  3HYP A;  2FA8 A;  3ED3 A;  4BVX A;  4EF0 A;  4KAE A;  1HNB A;  3TRX A;  2E2G A;  3L0H A;  1EV4 A;  4LLR A;  2VCQ A;  5ELG A;  2HZE A;  5HFI A;  3VWW A;  4XIH A;  3H79 A;  4ZL8 A;  1SL0 B;  3MNG A;  4HS1 A;  1KEB A;  3KMN A;  4IW9 A;  5EL8 A;  1TDI A;  1BQ7 A;  2PN8 A;  4GXZ A;  6GSY A; 
#chains in the Genus database with same CATH homology
 2V6K A;  2RUE A;  1E2Y A;  2H8L A;  1MDI A;  2P0G A;  2YPM A;  4MAB A;  2L6D A;  2OBK A;  5IPH A;  4L0W A;  4Q5Q A;  5AIX A;  4EUY A;  4AF2 A;  5COH A;  3FZ5 A;  1K3L A;  3S9F A;  4J57 E;  3G7Y A;  3KP9 A;  3RPP A;  14GS A;  1T00 A;  2IPA A;  1FB0 A;  4YQM A;  4MA9 A;  1NW2 A;  3E9J B;  3HD5 A;  1O85 A;  1FHE A;  2OAC A;  4MP4 A;  4WEY A;  2OE1 A;  2J9H A;  1OC9 B;  3N9J A;  3GKM A;  4POM A;  4L8E A;  2HSM A;  3GTU B;  5LD0 A;  4WF4 A;  5GAN D;  2GDR A;  4TR4 A;  1TRS A;  5A4W A;  1QUW A;  3Q74 A;  4ID0 A;  4BVY B;  2P31 A;  3EC3 A;  5DAL B;  2H6X A;  2A2S A;  3GA4 A;  3CYN A;  3HXS A;  2YWN A;  1F6M C;  1XWC A;  1U87 A;  1EGO A;  1FB6 A;  1JHB A;  2C4J A;  2E0Q A;  2DJK A;  3VI5 A;  1O6J A;  2QSI A;  2HT9 A;  3A2V A;  5H5Q A;  1XZO A;  2EIO A;  4BWS A;  2VIM A;  3TJG A;  2WB9 A;  2H1B A;  5G2Z A;  4FYB A;  3D4T A;  3GX8 A;  4MNN A;  1MDJ A;  1JLW A;  1ST9 A;  2VUP A;  3F3Q A;  1XPV A;  2KOK A;  4FH8 A;  3I43 A;  2IJY A;  3C7M A;  2XBQ A;  3ZRE A;  4OMV A;  1XFL A;  1PX7 A;  1WPI A;  4POK A;  5J5N A;  1HD2 A;  2DIY A;  4MH3 A;  2DJ1 A;  2AUV A;  5B7C A;  4Z7X A;  3DGQ A;  2OE0 A;  5KOX A;  1O73 A;  3EMX A;  4AJ7 A;  2IMK A;  2JSZ A;  4KH7 A;  1SD8 A;  2L5O A;  5ECN B;  1JZO A;  3EVI A;  5JCU A;  1TTZ A;  2OJL A;  2VD1 A;  2CV4 A;  3H1N A;  1X0R A;  4IP1 A;  3F63 A;  2LQO A;  3HCZ A;  1A0F A;  1V2A A;  2GQL A;  4F82 A;  1DBY A;  4DEJ A;  2YV9 A;  2VCX A;  2GVP A;  3GL3 A;  4JR6 A;  4DSR A;  2VL2 C;  1B9Y C;  2R0C A;  4ML1 A;  3E3E A;  1X9M B;  3PR8 A;  1XVQ A;  2DLX A;  1ZGN A;  2C0E A;  3BJ5 A;  4A5P A;  3DWV A;  1EZK A;  4BL7 B;  5IOX A;  3GFK A;  4EXJ A;  2I1U A;  4WR5 A;  1OKT A;  1FW1 A;  5DCG A;  8GSS A;  2HXK A;  3ZML A;  2F9S A;  3A3T A;  4V1A g;  4MH2 A;  2JZT A;  3WD6 A;  1Y6E A;  2UZ8 A;  4JRR A;  1Z9H A;  4I6X A;  4J2F A;  4CY6 A;  3EWL A;  2FWF A;  3GHA A;  2K9F A;  1YY7 A;  2YZU A;  1EP7 A;  2GZP A;  2PGT A;  4K6X A;  3HVV A;  4PX1 A;  5JWO B;  5HFG A;  4K0G A;  4NMU A;  3C1S A;  1XOB A;  2IWT A;  3VI7 A;  4OWY A;  4IN0 A;  4N10 A;  5CRW A;  5ECL B;  1PA3 A;  3FYG A;  3QAG A;  2HLS A;  4NV5 A;  4HQS A;  3HZ8 A;  1ABA A;  1LJR A;  3KIJ A;  1VF4 A;  1SJZ A;  3FZA A;  1OC9 A;  3W6G A;  3GTU A;  1YF0 A;  5ECI B;  3G7I A;  1AQW A;  2Z9S A;  3M9K A;  2YV7 A;  1ILO A;  4LMW A;  3GUS A;  1JZW A;  1AIU A;  5CAX A;  1FOH A;  1GTB A;  1N8J A;  5DAL A;  3NOF A;  3RHB A;  2TRC P;  4NHW A;  2V32 A;  4PXO A;  2FA4 A;  5G1K A;  2O89 A;  1W89 A;  1B48 A;  4JU5 A;  1PX6 A;  3K8N A;  4KDU A;  1BED A;  2OKA A;  2NTO A;  4O5Q A;  1OE7 A;  2YJH A;  1UC7 A;  2H70 A;  2YAN A;  2QKE A;  3CSJ A;  2NBS A;  3MYD A;  4ZB6 A;  3DKS A;  1O7U A;  1QMV A;  3KP8 A;  3CBU A;  3IOS A;  4JR4 A;  3HVS A;  2GSR A;  5DQY A;  1LBK A;  4KCA A;  4OO4 A;  4X1U A;  3ZIJ A;  2YWO A;  1AC1 A;  2A4H A;  5ELA A;  1BX9 A;  1HQO A;  2B5E A;  2QA2 A;  3LXZ A;  2QC7 A;  1KTE A;  3LG6 A;  3GMF A;  4MZC A;  2CZ2 A;  2WFC A;  1DE1 A;  2WRT A;  1G7O A;  4TR0 A;  4IHU A;  2BTO T;  4K7O A;  4OD7 A;  1Z7P A;  4KB3 A;  1DUG A;  1Z7R A;  2IME A;  1B8X A;  3APQ A;  4PQ1 A;  1HNA A;  1NHO A;  5GSS A;  2FNO A;  3VLN A;  2LEG A;  2PUK C;  5D9V A;  5E4W A;  1V9W A;  4D73 B;  2R3X A;  4EDY A;  3IHQ A;  1GTA A;  1OC8 A;  5B6N A;  2RM5 A;  5CRD A;  1F3B A;  3GX0 A;  4I5Q A;  1T8E B;  3F4R A;  5AIV A;  4AGS A;  4GLT A;  4WF5 A;  1EP8 A;  1UA5 A;  3O3T A;  1A8Y A;  4X0X A;  4FIW A;  4L5O A;  1GTU A;  1BJX A;  2X64 A;  1J9B A;  2R6K A;  3FY7 A;  1KNG A;  3C8E A;  2BMX A;  4TXV A;  3GSS A;  2C0G A;  3L78 A;  2C3Q A;  5C00 A;  3ZMK A;  1DSB A;  3ZIT A;  3DIE A;  2VCW A;  3LGC A;  6GST A;  5KEJ A;  4ACS A;  1PL2 A;  2ON7 A;  3IR4 A;  2IFQ B;  5DVB A;  5J4U A;  1UN2 A;  4I97 A;  5F06 A;  2LST A;  4KCE A;  3R2Q A;  4XTS A;  1MTC A;  1X5C A;  1U3A A;  2CAQ A;  1PKW A;  4KE3 A;  4V2L A;  4KA0 A;  1XW6 A;  2VL3 A;  4G9H A;  1THO A;  4Z2U A;  1XWG A;  3IAM 2;  2VCV A;  1W4V A;  4HZ2 A;  2MMN A;  3V1W A;  2PVO C;  1NM3 A;  5DCH A;  3IV4 A;  4GSN A;  1F2E A;  1ZMA A;  4POB A;  2PPT A;  3A2X A;  4EKZ A;  2VLV A;  1SK2 A;  5IO2 A;  1GSD A;  5JCG A;  1K0D A;  1S3C A;  3ZFB A;  4MJA A;  3HA9 A;  5J9B A;  3DRN A;  4K2X A;  4QL9 A;  2H0H A;  3KTL A;  9GSS A;  6GSX A;  2AV4 A;  2H74 A;  4E8E A;  4PNG A;  2C0F A;  2VM2 A;  2MMZ A;  2RII A;  2GZY A;  1YF1 A;  1AUC A;  4GQC A;  2FUG 2;  4XRD A;  4O7H A;  5BMU A;  4WXT A;  1XW5 A;  4K0N A;  4GF0 A;  3CTF A;  3TKQ A;  4BA7 A;  1FO5 A;  3VWX A;  4HU9 A;  4K5R A;  3G9B A;  2MMA A;  4NHZ A;  1T4Y A;  1OAZ A;  2EC4 A;  5G30 A;  4MLY A;  2KUC A;  1QFN A;  1TXX A;  1WE0 A;  3IK9 A;  1K0M A;  3ME8 A;  4IS0 A;  4CHS A;  4YKF A;  4WKW A;  1ZYP A;  3ZRD A;  3DVX A;  1SL2 B;  1WIK A;  2OAD A;  1JZR A;  1AQV A;  3TGZ A;  1ZYQ B;  2FGX A;  4RUV A;  4Z2T A;  2M80 A;  3M1G A;  5L71 A;  3G7J A;  1U6T A;  1ML6 A;  3CMI A;  1GWC A;  4G19 A;  2LKU A;  2R0G A;  1QQ2 A;  3TRQ A;  2DSA A;  2L59 A;  4Z2R A;  5D96 A;  1VGL A;  2X49 A;  4K1F A;  4KX4 A;  1R4W A;  1XOA A;  3KZQ A;  1EGR A;  2MYG A;  3F9U A;  2ES7 A;  4IVF A;  2HSH A;  4MF5 A;  4TR1 B;  1A8L A;  5JWQ B;  1T4Z A;  2YJ7 A;  2IMF A;  1PRX A;  4N0V A;  5H5R A;  4PUF C;  4YAP A;  4F2I A;  4POL A;  2CZ3 A;  5EY6 A;  6GSW A;  4D73 A;  1TP9 A;  4JED A;  2G0F A;  3RHC A;  1WWJ A;  4ZB8 A;  1M9B A;  2FD3 A;  4GST A;  5G1L A;  1V98 A;  5KN3 A;  3TRP A;  2CT6 A;  2I9H A;  1K3O A;  3VWU A;  5CRH A;  5JWR B;  2H66 A;  4FO5 A;  3BD2 A;  2M46 A;  4P3Y B;  2HI7 A;  1A2J A;  2NPB A;  20GS A;  3D4M A;  2F3M A;  3R3E A;  4NV2 A;  7GSS A;  2WZ9 A;  4MPF A;  3PH9 A;  3GRX A;  1PD2 1;  4PQI A;  4ULX A;  3WYW A;  18GS A;  4IQ1 A;  4LL1 B;  1FVK A;  5ECO B;  1PMT A;  3I6A A;  2IFQ A;  3IHG A;  1TW9 A;  22GS A;  2HYX A;  4IGJ A;  1YJ6 A;  1AQX A;  1URM A;  2DBC A;  5CRE A;  4ZIJ A;  4K7I A;  4WR4 A;  1TK8 B;  1O8X A;  5EPF A;  5CNW A;  1OYJ A;  2AJQ B;  4H86 A;  4L0U A;  5HR2 A;  3GST A;  3M0F A;  3ZL5 A;  2L5L A;  1PKZ A;  1Z3E A;  1THX A;  4FYC A;  3LXT A;  3UJ1 A;  1Z5Y E;  3PPU A;  1F3A A;  6GSV A;  2K18 A;  4GSS A;  2R37 A;  5AGY A;  3VK9 A;  1J08 A;  5ENU A;  3GKK A;  4GQF A;  1AAZ A;  3LJR A;  5FWG A;  1EEM A;  3GUR A;  5IMZ A;  1TRV A;  5GST A;  2HRN A;  4QL7 A;  2PBJ A;  1KBN A;  2WCI A;  3M3M A;  2KP2 A;  2TIR A;  1PL1 A;  4KND A;  1OC3 A;  2ALB A;  2FCH A;  3GV1 A;  5ECR B;  4EIQ A;  1GL8 A;  2CVK A;  3H8Q A;  5F8B A;  2IL3 A;  4Q5R A;  5AN1 A;  1Z6N A;  4ZIL A;  2HFD A;  4Q5F A;  4KUN A;  4ZBA A;  3F4T A;  5AIS A;  4YH2 A;  5B8A A;  4F0C A;  2C1Y A;  2CVD A;  2X99 A;  2DIZ A;  3IBH A;  1EOH A;  1NSW A;  4DSQ A;  3J7Y b;  1GSY A;  2I3Y A;  1X9W B;  1GNE A;  1G6W A;  2VLT A;  2JAD A;  5IOW A;  2B7J A;  2B5Y A;  2JU5 A;  1QK8 A;  1QGV A;  4G2E A;  1GNW A;  4OFN A;  4OFM A;  1GUH A;  3IA1 A;  2PU9 C;  1SU9 A;  3E0U A;  3FKF A;  5F0G A;  1K0A A;  2X4A A;  4OCF A;  4ECB A;  1GUK A;  1V58 A;  4TR1 A;  1MDK A;  4EIP A;  2VCT A;  3IPZ A;  4HJ2 A;  1I9D A;  2LNS A;  3LSZ A;  2RUF A;  2H72 A;  1OE8 A;  2TRX A;  2IN3 A;  1YEX A;  3ME7 A;  3HJP A;  3ZYW A;  2WDU A;  3P8W A;  2GS3 A;  4MJE A;  2LJA A;  5CRG A;  2XHF A;  2I4A A;  4HDE A;  3L9S A;  4HUA A;  4K9Z A;  2O7K A;  2X8G A;  2C0D A;  2F8A A;  4IJ3 A;  2K6V A;  2CVB A;  3Q18 A;  1NHY A;  3UAR A;  3CSH A;  3HJO A;  5KOW A;  1TKD B;  2N5A A;  2CQ9 A;  2KLX A;  2VL9 A;  3ZLP A;  2DKH A;  5IMD A;  2A2R A;  1E6B A;  4PTS A;  3WT1 A;  4IEL A;  5CO3 A;  4ZL9 A;  3PGT A;  3FRC A;  1WMJ A;  1TI1 A;  3J7Y k;  2YP6 A;  3W8S A;  2X8H A;  4XCS A;  3TKP A;  4PUA A;  4CY8 A;  4HU7 A;  1PQN A;  2LTK A;  3L9V A;  4KDX A;  4MJC A;  3VUR A;  4XS4 B;  3KJY A;  1FG4 A;  2H1A A;  4NAX A;  1GSS A;  3RDW A;  3TKS E;  5J9C A;  2MBS A;  2OA7 A;  3L4N A;  2H1D A;  5G5F A;  1K0N A;  1FOV A;  3O6T A;  2MMO A;  3QDN A;  4OCE A;  1GUL A;  1YKA A;  1DE2 A;  5F07 A;  1AW9 A;  3HHV A;  1GRX A;  13GS A;  1J0F A;  2GT5 A;  1CQH A;  5LNK e;  3KMO A;  1GP1 A;  2L6C A;  1WOU A;  3IC8 A;  4FYU A;  4O5U A;  4DSS B;  2XPD A;  4XS6 A;  2IMI A;  2H01 A;  2RM6 A;  3FW2 A;  4ZB9 A;  12GS A;  3QAW A;  3GN3 A;  3VFI A;  4LL4 B;  4YKG A;  3KEB A;  2X8C A;  2LJR A;  1RK4 A;  3DYR A;  2LJK A;  4O92 A;  2I81 A;  4PNF A;  4YQU A;  2XBI A;  3GH9 A;  3LW9 A;  1HYU A;  2C80 A;  3IC4 A;  4KF9 A;  3H4K A;  4K8M A;  1HNC A;  3WT2 A;  1GTI A;  2YWI A;  17GS A;  5DAK B;  3BBY A;  4PUR A;  5KN2 A;  4OFT A;  4HJM A;  4Q5N A;  3WGX A;  3EE2 A;  1LU4 A;  3BCI A;  1A2M A;  2LRC A;  3MWH A;  3ZVJ A;  1TU8 A;  3C71 A;  3D6I A;  3IRA A;  3CRT A;  2DJ3 A;  1TRU A;  3VPQ A;  2CX3 A;  3D22 A;  3FR3 A;  5FHI A;  2LNT A;  3OR5 A;  2L57 A;  1XWB A;  3EUR A;  3MDK A;  3CXG A;  1QXH A;  3EPT A;  4ZL7 A;  4FQU A;  1K0C A;  1YQ1 A;  1V40 A;  3U6V A;  3TCO A;  2HSY A;  4TXO B;  1SKR B;  4ZBD A;  4EC0 A;  3BOA A;  5J41 A;  2YNX A;  16GS A;  1GSE A;  3ISO A;  5IMF A;  3TKS A;  2CA8 A;  2KHP A;  1EEJ A;  4MMM A;  1G7D A;  5ECQ B;  1TOF A;  3TUE A;  1OVN A;  5INY A;  1K0O A;  2GSQ A;  2G2Q A;  2AYT A;  3FMW A;  2VAF A;  2A2P A;  3TKR A;  4V2N A;  5B6M A;  4IBP A;  3SBC A;  3O76 A;  1ZZY A;  5D8I A;  3GKN A;  3QOU A;  2V1M A;  1S3D A;  4HQZ A;  1N2A A;  3EMP A;  4HI7 A;  1TK5 B;  4USS A;  3MIX A;  3UVT A;  1XW9 A;  4CDO A;  2B6M A;  4BWQ A;  1V57 A;  2M72 A;  5G31 A;  1VF2 A;  1JLV A;  3FR6 A;  4F03 A;  3FK8 A;  2FLS A;  2B7K A;  2LRT A;  1GSU A;  2CX4 A;  3IAS 2;  5HR1 A;  1WP0 A;  1YEP A;  2H30 A;  4HEA 2;  2QA1 A;  2PMT A;  4TRX A;  3FEU A;  1XBS A;  2MBT A;  5F05 A;  2PER A;  5GZZ B;  1K0B A;  4WBR D;  4MJB A;  3HZ4 A;  2N5B A;  4XS4 A;  3LQ7 A;  4RI7 A;  2LQQ A;  2PVQ A;  3WGE A;  2JZS A;  1S3A A;  2E7P A;  3Q6O A;  4TN8 A;  4BPY A;  1MD4 A;  2IMD A;  1VF3 A;  3N5O A;  3F0I A;  3QFA C;  3KTB A;  1IYI A;  4O5R A;  1A2L A;  3GNJ A;  4I8B A;  1SEN A;  1ERW A;  1TJD A;  4GRF A;  3ZZX A;  2C3N A;  4WET A;  3CTG A;  2GQK A;  2HRA A;  3KH9 A;  1T3B A;  1R7H A;  2DMM A;  2WJU A;  1B4P A;  2B3S A;  1K3Y A;  2JL4 A;  3A5W A;  3UMA A;  4G0L A;  4DSS A;  2GLR A;  3ZTL A;  2FWH A;  3RBT A;  3FHK A;  4QQ7 A;  3NIV A;  4HOJ A;  3C1R A;  4EO3 A;  2LS5 A;  2HRK A;  1XCC A;  4G0K A;  4MDC A;  1Q98 A;  4TW5 A;  4GCI A;  5HR0 A;  2YWM A;  3GIX A;  4JBB A;  2REM A;  4N11 A;  2MZC A;  1Q4J A;  3FZ4 A;  1BG5 A;  1FAA A;  3PIN A;  4TVE A;  2O87 A;  3ZFL A;  3JCM L;  2DJ2 A;  4ZBB A;  1R5A A;  3TDG A;  3LYK A;  5DAK A;  4ECI A;  1ERV A;  3Q19 A;  4ICY A;  4IKH A;  4KSM A;  3KCM A;  3UIW A;  5CYY A;  3FR9 A;  3ZIV A;  2O8V B;  3KD0 A;  5ID2 B;  2DJJ A;  4ML6 A;  4V2M A;  3GYK A;  2J23 A;  4LMV A;  2ZUP A;  1SL1 B;  2E2M A;  3TJK A;  5BRT A;  5KN0 A;  2EIR A;  4K7N A;  2OE3 A;  3IK7 A;  4G0I A;  4JE1 A;  4RQX A;  1X5E A;  2GSS A;  3LYP A;  1VRS D;  2FWE A;  4EVM A;  2H6Z A;  1XXU A;  4RQR A;  5IMC A;  1PN9 A;  1ON4 A;  2K8V A;  2O85 A;  1TK0 B;  4TXO A;  1JZD A;  3LEF A;  3KM6 A;  1SJI A;  1ZL9 A;  3TB2 A;  5EVO A;  2WS2 A;  2FHE A;  3HY2 A;  1F9M A;  1C72 A;  5IIZ A;  4MPG A;  3F4S A;  2V6O A;  3AY8 A;  1OKD A;  3U5R E;  3UBL A;  1A0R P;  10GS A;  3IE3 A;  1Y25 A;  4OO5 A;  5HR3 A;  3P7X A;  3QD9 A;  2B5X A;  2VD0 A;  4TOP A;  2P5R A;  2P5Q A;  5IMV A;  3IDV A;  4K5S A;  5IQY A;  3D5J A;  3I69 A;  4X4J A;  3ERW A;  4DVC A;  5FT3 A;  1SKS B;  2DML A;  4PQH A;  5A4V A;  2RLI A;  3HVX A;  5DDL A;  4KW6 A;  3UBK A;  4MZW A;  3TJB A;  5A5K A;  2DJ0 A;  5ECH B;  4WBJ A;  1ZCP A;  4CW9 A;  2M66 A;  3LOR A;  1T7P B;  5IM9 A;  5JCW A;  3QPM A;  5KN1 A;  1GUM A;  3MSZ A;  2IIY A;  1EWX A;  5IO0 A;  2KP1 A;  1M2B A;  2BJX A;  11GS A;  2EIQ A;  3APS A;  5E59 A;  3RAZ A;  5IMA A;  4EDZ A;  1GLP A;  1H75 A;  3DD3 A;  4L5L A;  2VOC A;  2B1L A;  5B8B A;  3UOM A;  3LWA A;  4XHM A;  1VF1 A;  2HE3 A;  4AJ6 A;  2WUL A;  2H73 A;  5GAP D;  3GL5 A;  4J56 E;  4MZB A;  2JAC A;  4F9Z A;  2DC5 A;  3M8N A;  1G7E A;  4ECJ A;  4I2T A;  3UAP A;  2VM1 A;  2XC2 A;  3QAV A;  5HFK A;  1TI3 A;  3UVH A;  2L4Q A;  1EOG A;  2YZH A;  1PSQ A;  4JZQ A;  5ECS A;  4HZ4 A;  1FVJ A;  4AJ8 A;  1WJK A;  1YDK A;  1JFU A;  3KH7 A;  3DML A;  1WRY A;  1TRW A;  5H5S A;  1SYX A;  4F0B A;  2YN1 A;  3WGD A;  1R26 A;  1M2D A;  1M2A A;  2N5F A;  3EU3 A;  2A4V A;  1MD3 A;  2VCZ A;  2VL2 A;  2H0I A;  4N0Z A;  1F37 A;  1IYH A;  3DEX A;  1G0T A;  2CAI A;  1AXD A;  4XS1 A;  2GT6 A;  4MCU A;  3ZVJ D;  2YCD A;  1R5P A;  3GH6 A;  1YKC A;  1BYE A;  2FY6 A;  2B1K A;  4BVY A;  1EV9 A;  1G6Y A;  2GST A;  4KGI A;  1M99 A;  1SKW B;  3F3R A;  5A4U A;  2HNL A;  5ID2 A;  3BCK A;  3F6F A;  2C8U A;  3EIN A;  4MF6 A;  2H71 A;  3ERF A;  3KGK A;  1PGT A;  4BVX B;  4MF7 A;  2ZCT A;  2H1G A;  2HZE B;  5G5E A;  5J3R A;  4IJI A;  3US3 A;  1M7T A;  5ECK B;  2AAW A;  2DKI A;  3LFL A;  3D0Z A;  1GLQ A;  1XIY A;  5DJM A;  1USB A;  4MK3 A;  2H76 A;  2FWG A;  3D21 A;  3VPT A;  4NPB A;  1ERT A;  1O81 A;  3NZN A;  4LA1 A;  2ZNM A;  3SWL A;  3CSI A;  1O8W A;  5DQS A;  2VLU A;  6GSU A;  1M9A A;  3RPN A;  1A23 A;  1ERU A;  2H75 A;  2C3T A;  3TJF A;  1XWK A;  1UVZ A;  3QFB C;  1M0U A;  1SD9 A;  2GZZ A;  4ECC A;  2JSY A;  1TU7 A;  3H93 A;  2GTU A;  2R2J A;  5D73 A;  3QMX A;  2R0P A;  4I2U A;  4TKY A;  2LV3 A;  4KSO A;  5D9T A;  5C04 A;  2OBI A;  4GWR A;  19GS A;  1H4O A;  4PGT A;  2JZR A;  1ZOF A;  3A5I A;  3TKS C;  4KDY A;  2ON5 A;  1RQM A;  5D9W A;  2VO4 A;  4ILF A;  2V2G A;  3F6D A;  3W8J A;  5LCZ A;  3EYT A;  1XWA A;  3APO A;  3MAK A;  1B4Q A;  4RI6 A;  3HJM A;  3TJJ A;  3A2W A;  4IQA A;  4XRA A;  3TOT A;  4YQV A;  1SYR A;  4TR3 A;  2NDO A;  5DBQ A;  1I5G A;  4NXI A;  1SJ6 A;  5ECP B;  1U3I A;  2F51 A;  1PN0 A;  1X9S B;  4BL7 A;  4G10 A;  1MEK A;  3UEM A;  5ABR A;  3QR6 A;  4ZXG A;  2PWJ A;  3F8U A;  3I9V 2;  2XPE A;  4O32 A;  2H0G A;  2AHE A;  4ISD A;  2H19 A;  2WGR A;  5DJL A;  4K2D A;  1ZYE A;  5IPG A;  1XVW A;  1RW1 A;  2V41 A;  3HKR A;  2H6Y A;  4IP6 A;  1Z6M A;  4NWY A;  3DVW A;  1U88 A;  5HQP A;  1A24 A;  1X5D A;  1YZX A;  1ZYN A;  4N30 A;  5D9X A;  1T1V A;  4EE0 A;  1B9X C;  5CP1 A;  3TOU A;  4EL1 A;  2LRN A;  1BAY A;  2L4C A;  2LUS A;  2YOI A;  1GSF A;  3C73 A;  2GQM A;  3KXO A;  2HZF A;  5ECM B;  3EU4 A;  2K8S A;  2D2Z A;  3DXB A;  2HRF A;  3FZ9 A;  1CQG A;  4YAV A;  3ERG A;  3IXR A;  2R5G A;  4GTU A;  2F8F A;  2QGV A;  3P90 A;  2NVL A;  3CRU A;  3UL3 A;  2R4V A;  6GSS A;  3QCP A;  5D93 A;  3P2A A;  1SK0 A;  2GGT A;  1ACV A;  1GH2 A;  3L9U A;  2AB6 A;  4V1A p;  4E8H A;  1SK1 A;  3GKX A;  3M9J A;  3VWV A;  3HDC A;  4X43 A;  1GSQ A;  3HYP A;  2FA8 A;  3ED3 A;  4BVX A;  4EF0 A;  4KAE A;  1HNB A;  3TRX A;  2E2G A;  3L0H A;  1EV4 A;  4LLR A;  2VCQ A;  5ELG A;  2HZE A;  5HFI A;  3VWW A;  4XIH A;  3H79 A;  4ZL8 A;  1SL0 B;  3MNG A;  4HS1 A;  1KEB A;  3KMN A;  4IW9 A;  5EL8 A;  1TDI A;  1BQ7 A;  2PN8 A;  4GXZ A;  6GSY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...