1OVNA

Crystal structure and functional analysis of drosophila wind-- a pdi-related protein
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
229
structure length
229
Chain Sequence
CTGCVDLDELSFEKTVERFPYSVVKFDIAYPYGEKHEAFTAFSKSAHKATKDLLIATVGVKDYGELENKALGDRYKVDDKNFPSIFLFKGNADEYVQLPSHVDVTLDNLKAFVSANTPLYIGRDGCIKEFNEVLKNYANIPDAEQLKLIEKLQAKQEQLTDPEQQQNARAYLIYMRKIHEVGYDFLEEETKRLLRLKAGKVTEAKKEELLRKLNILEVFRVHKVTKTAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Windbeutel
publication title Crystal structure and functional analysis of Drosophila Wind, a protein-disulfide isomerase-related protein.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Chaperone
total genus 76
structure length 229
sequence length 229
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07749 ERp29 Endoplasmic reticulum protein ERp29, C-terminal domain
A PF07912 ERp29_N ERp29, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1150.12 Mainly Alpha Up-down Bundle Endoplasmic reticulum protein erp29 Endoplasmic reticulum resident protein 29, C-terminal domain 1ovnA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1ovnA01
1EOHA 2H1AA 4TOPA 1K0MA 3IE3A 1SK2A 1PL2A 5A4WA 2QKEA 3LORA 1PSQA 5DJLA 2AHEA 2A2SA 2FUG2 2PMTA 3ERGA 4N0VA 1ZOFA 2QC7A 5GAND 4TXOB 3QFBC 2FLSA 4MP4A 4GCIA 3A2VA 1O8WA 2CT6A 2VM2A 1R5PA 4ECBA 2BTOT 1ZL9A 3HY2A 1TU7A 2L5OA 4V2NA 3VPTA 4P3YB 4MJEA 1XOBA 1FB0A 3IR4A 2G2QA 4BA7A 4I5QA 4ECCA 2H01A 2H73A 2EC4A 1GSSA 4YH2A 1M9BA 2YPMA 5GAPD 4FYBA 3O6TA 1A0RP 3GL5A 1YJ6A 1M2BA 2YV7A 3C1SA 1M7TA 4FO5A 3CTGA 3GSTA 1SKSB 3IXRA 3UVHA 2YCDA 5J9CA 4ZL8A 2WDUA 1R26A 3GYKA 2HI7A 3GURA 3BD2A 4FIWA 3UL3A 20GSA 4MJAA 4POMA 5DQYA 3EINA 5CAXA 2V6KA 4ZL7A 1MEKA 3I9V2 4ID0A 2B3SA 2H8LA 1GSDA 2ON5A 3AY8A 2H76A 2LV3A 1ACVA 1KBNA 3GNJA 3GFKA 1GSQA 5IMZA 2ZNMA 1DBYA 2IIYA 2K8VA 3C8EA 1PQNA 2LRNA 4EF0A 1GSEA 3F3RA 4KA0A 2DJJA 2WRTA 1GTAA 2V6OA 4OFMA 5G31A 2MYGA 3KEBA 5COHA 3RHBA 1V98A 3WGEA 5JCUA 2GSTA 4GQFA 3U5RE 5KEJA 2ZUPA 3QMXA 5ECIB 4HQZA 3FZAA 2EIOA 1X9SB 4DSRA 5DQSA 3TRQA 1J9BA 3RHCA 4ZB9A 3TRXA 2GGTA 1HQOA 4IHUA 3IHQA 4OMVA 3VWUA 4HJ2A 2NTOA 3ZVJA 2PWJA 4MK3A 4NPBA 3IOSA 1O6JA 1Z3EA 2GZPA 2LJKA 3M3MA 1O85A 4V1Ag 3VURA 2G0FA 4TR3A 3GIXA 1XZOA 2GQKA 2VL2C 1X9MB 2CX3A 3N5OA 3CSHA 4YAPA 1USBA 1QMVA 4HZ2A 2BMXA 2I1UA 2YWOA 2X99A 3PH9A 1Z6MA 5ECPB 2C0EA 3HHVA 3FRCA 2P5QA 3E9JB 2CQ9A 2DJ3A 2XPDA 2JL4A 3RPNA 2H6YA 4G19A 2PBJA 4OCFA 1R4WA 3K8NA 4EXJA 2CVBA 1YKAA 2EIQA 3GH9A 4ML1A 5DALB 3MWHA 5ECNB 4ULXA 3KP8A 1EOGA 1NW2A 4PX1A 4J56E 1ERTA 1BX9A 19GSA 1R7HA 3TDGA 3FEUA 5EPFA 4MMMA 3Q18A 1AUCA 3LXTA 2H0GA 2X8CA 1G7OA 2YP6A 2ZCTA 3C73A 3IC4A 2B1KA 3C71A 1GTIA 2H19A 2YJ7A 1MD3A 5G1KA 1A0FA 3IAM2 4NWYA 3FKFA 1T4ZA 3HVSA 3J7Yk 4LMWA 2YNXA 4AJ8A 5F05A 4HS1A 1TRSA 3I43A 2GT5A 1G7EA 1EP7A 1QQ2A 1SENA 2GT6A 4PURA 3ZL5A 1W4VA 1GP1A 5DVBA 1X5EA 3ISOA 1A2MA 2KP2A 2FY6A 5KN1A 3D4TA 2WCIA 2FHEA 3GUSA 1ON4A 3GSSA 2IL3A 5JWOB 2IMEA 4JEDA 3IBHA 3PR8A 1WRYA 4I97A 1DE2A 4IN0A 4MZBA 1TXXA 3ZREA 1OKTA 1OKDA 22GSA 1MD4A 2C3QA 1PA3A 3F3QA 5D9TA 5B7CA 2PVQA 4H86A 1B48A 1TRWA 1YQ1A 5ECRB 3HJMA 3UBKA 2HZEA 4O5RA 2DJ2A 2GS3A 1C72A 5IO0A 1B9XC 3G7YA 2YJHA 2V41A 5IOWA 4MZWA 3TUEA 1PRXA 2WS2A 4J57E 5FWGA 2H75A 4L5LA 4QL9A 3HVXA 2MMOA 3GRXA 3DVXA 4YAVA 3WT2A 3D0ZA 3TRPA 2IMFA 3FZ4A 1TRVA 3TJKA 3GV1A 4KAEA 4CW9A 5IMVA 1V57A 4KDYA 3A3TA 3FW2A 5F0GA 2DIZA 1SD8A 3CBUA 1EWXA 4ISDA 4LMVA 3GTUA 3UOMA 5DDLA 2QSIA 5GSTA 10GSA 4PQHA 5ECSA 5D9XA 1GULA 4O32A 1PX6A 6GSUA 1IYIA 3RBTA 3TKSC 1SYXA 2IMIA 3ME8A 2DMLA 2WJUA 12GSA 2IFQB 5DAKB 5CRDA 2H1GA 4Z7XA 2HSYA 4BVYA 4ECJA 2TRCP 2R3XA 3BJ5A 5IQYA 4PXOA 1OVNA 2OJLA 4MZCA 1B9YC 3DEXA 2R2JA 2Z9SA 2OBKA 1U88A 7GSSA 1EV9A 2YZHA 2MMAA 1AW9A 3CSJA 5CRHA 2L6CA 3LWAA 3DRNA 2HXKA 3H8QA 4IW9A 1O8XA 1PD21 1Z5YE 1Q98A 3RPPA 1SJZA 2C3NA 3QAWA 5ECOB 1EGOA 1AQWA 5A5KA 3G7JA 1LBKA 5C04A 5KN0A 1J0FA 4AJ7A 2M46A 4E8HA 1GL8A 5J3RA 2NDOA 3A5WA 2PGTA 3KXOA 3HDCA 5G2ZA 3VI5A 1ZYQB 2K9FA 1TOFA 1DE1A 5CRWA 4TXVA 4KUNA 2WFCA 3HJOA 1DSBA 2KOKA 5JCWA 1TP9A 3IRAA 1YDKA 1SK1A 3ZMLA 3O3TA 1ZZYA 1X5DA 4EDZA 2C1YA 5CREA 1T00A 4FYUA 1G7DA 3APSA 3KZQA 3GA4A 3LQ7A 2B5YA 2I3YA 3ZFBA 1AQVA 4D73B 3QAVA 2N5FA 1VF2A 5D9VA 2L59A 4G2EA 5LCZA 4F0BA 1F37A 1AC1A 2MBSA 2HT9A 1HNAA 1ML6A 4K1FA 3JCML 1JZOA 3RDWA 1WPIA 2IN3A 1K0NA 1YEXA 1XBSA 6GSYA 5F06A 2VCTA 3TCOA 4MCUA 4PQIA 3EE2A 2DMMA 2YANA 4HOJA 2JZSA 3IDVA 1NHYA 2HRNA 14GSA 3DYRA 3MSZA 3TB2A 4TXOA 4ZIJA 3NZNA 3EC3A 3D21A 5G5EA 1TDIA 1TKDB 3E3EA 1FHEA 4JU5A 5HFGA 3CRTA 3IK9A 4IGJA 4XS1A 3UIWA 4GF0A 4IP1A 1XW9A 4IKHA 1VRSD 1CQGA 4POBA 2JZRA 3EMPA 3LJRA 1Z7PA 4O92A 2N5AA 1ERVA 5F8BA 2P5RA 1J08A 1GSYA 4HZ4A 5B6NA 2JSYA 3VI7A 3CSIA 2H30A 1HYUA 5HR2A 3GKNA 4EC0A 2C0GA 2L6DA 2RUEA 3D22A 1EZKA 2O8VB 3FR9A 1JZRA 5DBQA 1F2EA 5CYYA 3UMAA 5F07A 1GUKA 1O7UA 3GX8A 1F3AA 3F9UA 3F8UA 3FY7A 4ZBAA 4NAXA 2VCVA 1SK0A 1ZGNA 2GSRA 1NM3A 3L9SA 2I4AA 1NHOA 2C80A 2A2RA 3DKSA 3DXBA 2L57A 3KMNA 1M2DA 3KTLA 2VL2A 5D8IA 2CV4A 1K0AA 2FWFA 3LEFA 1U6TA 5ECHB 2H0IA 1GUHA 4ZILA 1K0DA 1XPVA 1BG5A 1OC3A 4Q5QA 1TI3A 1KNGA 3EWLA 3KMOA 4CDOA 5IMAA 3F4TA 1UVZA 1ERWA 1K3OA 2O85A 3SBCA 1I5GA 1B8XA 4GQCA 4XS4B 3SWLA 1LJRA 5CNWA 1Y25A 2CVDA 1CQHA 2WB9A 4LLRA 1FO5A 4MF7A 5ID2B 1XWBA 4EUYA 1BQ7A 1WMJA 3KH9A 2J9HA 4K7IA 4OFTA 4ZBDA 1QXHA 3CYNA 4JBBA 5B8BA 4MF5A 4F2IA 4X0XA 4ZB6A 2XHFA 3PGTA 2H74A 2MMNA 4ML6A 2H1DA 4DSSB 2KUCA 3LG6A 2XC2A 4N10A 4NV5A 3ERWA 3H79A 2CVKA 3LXZA 2VAFA 2F9SA 2B6MA 4LA1A 2VIMA 1XW6A 1YEPA 4DVCA 2ES7A 2LRCA 1T4YA 5HFKA 1A8YA 1ST9A 3TJBA 1GRXA 3KGKA 4HEA2 5H5SA 1Y6EA 2X8GA 3ZFLA 4K0GA 5EL8A 3UARA 3VPQA 2QGVA 4TVEA 4WF4A 2VO4A 5IMCA 4ZXGA 3FR3A 2NBSA 4X43A 4GTUA 2XBIA 2NPBA 1TRUA 3GKKA 1ZCPA 4IQ1A 5J5NA 3TOUA 2C0FA 3MAKA 3BBYA 1A2JA 4YQMA 2IMKA 4G9HA 2OE1A 3LSZA 1FG4A 5DALA 2H71A 4HU7A 2TRXA 1G6WA 5GSSA 3ED3A 2MZCA 1XOAA 4L0UA 4I8BA 2B7JA 4XS6A 2JACA 2CZ2A 3C7MA 5J41A 1XWKA 1UC7A 1S3CA 5EY6A 3LYKA 6GSTA 3ZVJD 1SL2B 1THOA 4KW6A 2TIRA 4TR0A 4TR1B 2HZFA 2GQLA 3ZTLA 4IELA 4MPGA 4OD7A 1GNWA 1XVWA 3F63A 3UAPA 2R5GA 4EVMA 1PGTA 1EP8A 4POLA 3HKRA 3BCKA 4FH8A 3QPMA 4EO3A 2V2GA 2WGRA 4ZB8A 2JADA 1M2AA 4LL4B 2CX4A 2LS5A 3LGCA 4CHSA 2LUSA 4GRFA 3EU3A 1XIYA 1K3YA 2KHPA 2HYXA 4NMUA 4WEYA 4O7HA 2C0DA 2O7KA 1Q4JA 2B1LA 3ZLPA 1THXA 4K9ZA 1TI1A 4MF6A 2XBQA 4TR4A 5J4UA 3F6FA 1SJIA 1FVKA 1K0BA 3NOFA 1ILOA 5D93A 3TJGA 3R2QA 1K0CA 4KH7A 4NV2A 2VLTA 4BWQA 1XXUA 1OC8A 1WIKA 2E2GA 3MNGA 4V2LA 3W6GA 5ENUA 1OYJA 3TKPA 2DIYA 2LNTA 2HNLA 4LL1B 1SL0B 1TTZA 1U3AA 4JRRA 3WGDA 2GSQA 3GHAA 1IYHA 2R6KA 2H70A 4OWYA 5ECKB 1V2AA 4QQ7A 5DCGA 3DWVA 2GLRA 5A4VA 4BPYA 2EIRA 1XCCA 3J7Yb 2L5LA 4KCAA 2RM6A 2X64A 4PNGA 2WULA 2GZYA 3GKXA 1TK0B 5A4UA 4GWRA 5LD0A 4I2TA 1K0OA 3L4NA 3F4SA 1BEDA 3CTFA 4F82A 2IFQA 2PU9C 5DAKA 1Z7RA 1G6YA 3FHKA 2KLXA 3P7XA 3ME7A 5C00A 2RIIA 1T8EB 4JE1A 2NVLA 3M0FA 2VLUA 5ECMB 1UN2A 2GQMA 1N8JA 4WF5A 2OADA 1EV4A 1EEMA 3WD6A 1M9AA 5IPHA 3M8NA 3IA1A 3VWVA 2F3MA 4IVFA 1GLPA 3IK7A 2CA8A 3CRUA 5HQPA 4MPFA 1O81A 3FK8A 4F0CA 1WE0A 1LU4A 3QCPA 3DVWA 2P31A 3UBLA 4HJMA 3UEMA 1PL1A 1B4QA 5IM9A 5D9WA 5ABRA 2WZ9A 1XWCA 4MJCA 3NIVA 5H5QA 2BJXA 4MABA 4KE3A 4MLYA 1OC9B 2RM5A 2IJYA 2MMZA 5E4WA 2C4JA 2N5BA 5AISA 6GSXA 3EURA 1JLWA 1OE7A 2H1BA 3EVIA 3ZZXA 3O76A 3TGZA 4YQVA 1RK4A 3QDNA 3PINA 4WXTA 4EE0A 1DUGA 5E59A 5ECQB 4PUAA 4X1UA 3ZYWA 6GSWA 5B8AA 4GSSA 4K7OA 2YZUA 4AJ6A 2AUVA 1A8LA 2HFDA 3L78A 1OE8A 1S3AA 2V32A 3QR6A 4WR4A 4AGSA 1GTUA 3M9JA 2AV4A 4NHWA 4D73A 2L4CA 4WETA 1U87A 4PGTA 2VD0A 4WKWA 5LNKe 4NXIA 1BAYA 5G30A 4GSNA 1FOVA 1XW5A 3DMLA 4JR4A 4EDYA 4IBPA 3H93A 3EYTA 1QUWA 1H75A 1T1VA 4AF2A 4EKZA 2X8HA 4XRDA 2AJQB 2PERA 3P90A 1F3BA 3W8SA 1FB6A 5DCHA 1YKCA 3KP9A 2DBCA 5AN1A 5HR0A 3UVTA 2FCHA 1M99A 5JCGA 2VCZA 5FT3A 1A23A 4ZL9A 3HA9A 1PN9A 3HVVA 13GSA 2A4VA 4I6XA 2FGXA 3ZMKA 2YOIA 1VF3A 2OBIA 1H4OA 3L9UA 4TW5A 1PKZA 1W89A 1JZDA 4KSMA 1V40A 2H6XA 2LNSA 3F4RA 4MA9A 2R37A 4HDEA 3HYPA 4HUAA 1E6BA 4OO5A 4BVXA 2LSTA 3FYGA 5G1LA 3WYWA 1UA5A 3I69A 1O73A 3LFLA 3TKRA 3QD9A 5CO3A 1BJXA 4Q5RA 3BCIA 4ILFA 2VLVA 1NSWA 2GZZA 1HNCA 6GSVA 1AQXA 4FYCA 1T3BA 1JHBA 2B7KA 1VF1A 2C8UA 2VM1A 2YN1A 1ZYEA 3F0IA 4GLTA 8GSSA 17GSA 4XTSA 4DEJA 2HE3A 3E0UA 2LEGA 1AXDA 2K18A 1F6MC 4OCEA 2XPEA 3KIJA 4GSTA 3A2XA 4K7NA 2L4QA 3EU4A 2AAWA 2M80A 2DC5A 3ZRDA 4TN8A 2PUKC 3WT1A 1E2YA 2REMA 4KSOA 4GXZA 2VL3A 1Z6NA 1OAZA 4JZQA 2MBTA 4N0ZA 3ZITA 2F51A 2LRTA 5D73A 1KTEA 1SL1B 4XS4A 4K6XA 4MH3A 5ID2A 3ZIVA 2M66A 3KCMA 4ACSA 4TKYA 5KN2A 1WP0A 5KN3A 2M72A 3CXGA 4N11A 1SU9A 3GH6A 2HSHA 3ZIJA 3VWXA 4RUVA 2YWNA 1M0UA 9GSSA 4XIHA 2PN8A 4QL7A 4RI7A 4DSSA 4L8EA 1A2LA 5DJMA 1YZXA 3VK9A 2OKAA 6GSSA 4V1Ap 3P2AA 2PPTA 1JFUA 4IQAA 2LKUA 2YWIA 2OACA 2HLSA 1JLVA 2YWMA 4KCEA 1XVQA 3KD0A 2DSAA 4K8MA 5ELAA 3WGXA 3M9KA 4OO4A 4RI6A 5G5FA 3GMFA 3H4KA 3QOUA 1F9MA 2H66A 3DGQA 1TJDA 3Q74A 4KNDA 5IMDA 3H1NA 3TJJA 1JZWA 2LTKA 2F8AA 2GSSA 3IPZA 3RAZA 4KDUA 2ALBA 1ERUA 2LQQA 2F8FA 2HRFA 4HI7A 1V58A 3S9FA 2E7PA 4IJIA 3IV4A 2K8SA 1GTBA 1HD2A 3LYPA 1MDJA 4MJBA 4PUFC 1U3IA 2OE0A 2VCQA 3V1WA 5HR1A 5HFIA 2AB6A 1MTCA 4YQUA 3A2WA 3G7IA 18GSA 2VD1A 3APOA 1TU8A 3HD5A 1N2AA 4TR1A 2FA8A 5EVOA 2YV9A 2LJRA 3KM6A 2AYTA 4L0WA 4KDXA 1PX7A 4PNFA 3ERFA 1XFLA 4DSQA 4KX4A 4TRXA 2OA7A 4V2MA 3I6AA 3EMXA 5D96A 2OE3A 16GSA 2GVPA 1VGLA 1MDKA 1EEJA 2FD3A 3TKSA 1TW9A 4J2FA 2DJ1A 2DLXA 2B5XA 2IMDA 3N9JA 4MDCA 4HU9A 1SJ6A 4F03A 1X5CA 2HZEB 1VF4A 2LQOA 1ABAA 3TKQA 1YF0A 1FAAA 1WOUA 1WWJA 1YF1A 3DIEA 2I81A 3Q19A 1V9WA 2P0GA 1EGRA 1K3LA 3GN3A 3KH7A 4BWSA 3OR5A 2V1MA 4BL7A 1GWCA 1KEBA 1AIUA 5L71A 1AAZA 2CAIA 4KB3A 5ELGA 5GZZB 1SKWB 1PKWA 2J23A 4WR5A 5JWRB 4Q5FA 3D5JA 3HXSA 2K6VA 3UJ1A 11GSA 2VCWA 1TK5B 3KJYA 3FZ5A 5IMFA 1B4PA 4IP6A 1RQMA 4IJ3A 1G0TA 3HZ8A 3D6IA 3APQA 2I9HA 4ZBBA 4XCSA 1ZMAA 2VOCA 1HNBA 1WJKA 4XRAA 3GTUB 3L9VA 3VFIA 3FZ9A 4EL1A 3GX0A 4RQXA 2GTUA 4F9ZA 2IPAA 1SKRB 3VWWA 5IOXA 1X9WB 3GL3A 3TOTA 3BOAA 3QAGA 3GKMA 3TKSE 3QFAC 1GH2A 3U6VA 1FVJA 5CP1A 4L5OA 5ECLB 3FR6A 4ECIA 2C3TA 1GSUA 5CRGA 1PMTA 2DJ0A 3F6DA 4K2DA 5IPGA 1A24A 5B6MA 2FWEA 3W8JA 5IO2A 1SD9A 3MDKA 4OFNA 3HCZA 3KTBA 2H6ZA 1QK8A 5AIXA 3M1GA 3TJFA 1R5AA 1GLQA 4JR6A 2DJKA 4WBJA 4RQRA 3HJPA 2CZ3A 2FWHA 5HR3A 2JSZA 2PVOC 4HQSA 3P8WA 1URMA 2FWGA 1Z9HA 3DD3A 4NHZA 1X0RA 1OC9A 3Q6OA 3IAS2 2E0QA 2R4VA 4POKA 2O87A 1I9DA 1GNEA 4I2UA 2H0HA 5FHIA 4PQ1A 5J9BA 2GDRA 2LJAA 2ON7A 4Q5NA 4G10A 2D2ZA 5AIVA 4XHMA 2VCXA 2JZTA 5JWQB 1QGVA 1YY7A 2B5EA 1RW1A 2RUFA 4K0NA 4MH2A 1S3DA 1FW1A 2VUPA 5AGYA 3G9BA 1QFNA 2O89A 5H5RA 4N30A 2IWTA 1SYRA 4E8EA 3CMIA 3L0HA 2VL9A 1GUMA 3C1RA 2FNOA 4IS0A 2RLIA 3US3A 2KP1A 1XWGA 1XWAA 2H72A 2JU5A 2CAQA 4WBRD 2E2MA 3D4MA 2FA4A 4KGIA 5IIZA 1BYEA 3HZ4A 3VLNA 1T7PB 1GSFA 5INYA 1TK8B 1MDIA
chains in the Genus database with same CATH superfamily
1EOHA 2H1AA 4TOPA 1K0MA 3IE3A 1SK2A 1PL2A 4G0KA 5A4WA 2QKEA 3LORA 1PSQA 5DJLA 2AHEA 2A2SA 2FUG2 2PMTA 3ERGA 4N0VA 1ZOFA 2QC7A 5GAND 4TXOB 3QFBC 2FLSA 4MP4A 4GCIA 3A2VA 1O8WA 2CT6A 2VM2A 1R5PA 4ECBA 2BTOT 1ZL9A 3HY2A 1TU7A 2L5OA 1S3RA 4V2NA 3VPTA 4P3YB 4MJEA 1XOBA 1FB0A 3IR4A 2G2QA 4BA7A 4I5QA 4ECCA 2H01A 2H73A 2EC4A 1GSSA 4YH2A 1M9BA 2YPMA 5GAPD 4FYBA 3O6TA 1A0RP 3GL5A 1YJ6A 1M2BA 2YV7A 3C1SA 1M7TA 4FO5A 3CTGA 4BIKA 3GSTA 1SKSB 3IXRA 3UVHA 4EIPA 2YCDA 5J9CA 4ZL8A 2WDUA 4O5UA 1R26A 3GYKA 2HI7A 3GURA 3BD2A 4FIWA 3UL3A 20GSA 4MJAA 4POMA 5DQYA 3EINA 5CAXA 2V6KA 4ZL7A 1MEKA 3I9V2 4ID0A 2B3SA 2H8LA 1GSDA 2ON5A 3A5IA 3AY8A 2H76A 2LV3A 1ACVA 1KBNA 3GNJA 3GFKA 1GSQA 5IMZA 2ZNMA 1DBYA 2IIYA 2K8VA 3C8EA 1PQNA 2LRNA 4EF0A 1GSEA 3F3RA 4KA0A 2DJJA 2X49A 2WRTA 1GTAA 2V6OA 4OFMA 5G31A 2MYGA 3KEBA 5COHA 3RHBA 1V98A 3WGEA 5JCUA 2GSTA 4GQFA 3U5RE 5KEJA 2ZUPA 3QMXA 5ECIB 4HQZA 3FZAA 2EIOA 1X9SB 4DSRA 5DQSA 3TRQA 1J9BA 3RHCA 4ZB9A 3TRXA 2GGTA 1HQOA 4IHUA 3IHQA 4OMVA 3VWUA 4HJ2A 2NTOA 3ZVJA 2PWJA 4MK3A 4NPBA 3IOSA 1O6JA 1Z3EA 2GZPA 2LJKA 3M3MA 1O85A 4V1Ag 3VURA 2G0FA 4TR3A 3GIXA 1XZOA 2GQKA 2VL2C 1X9MB 2CX3A 3N5OA 3CSHA 4YAPA 1USBA 3FMWA 1QMVA 4HZ2A 2BMXA 2I1UA 2YWOA 2X99A 3PH9A 1Z6MA 5ECPB 2C0EA 3HHVA 3FRCA 2P5QA 3E9JB 2CQ9A 2DJ3A 2XPDA 2JL4A 3RPNA 2H6YA 4G19A 2PBJA 4OCFA 1R4WA 3K8NA 4EXJA 2CVBA 1YKAA 2EIQA 3GH9A 4ML1A 5DALB 3MWHA 5ECNB 4ULXA 3KP8A 1EOGA 1NW2A 4PX1A 4J56E 1ERTA 1BX9A 19GSA 1R7HA 3TDGA 3FEUA 5EPFA 4MMMA 3Q18A 1AUCA 4A5PA 2QA1A 3LXTA 2H0GA 4G0IA 2X8CA 1G7OA 2YP6A 2ZCTA 3C73A 3IC4A 2B1KA 4YKFA 3C71A 4CY8A 1GTIA 2H19A 2YJ7A 1MD3A 5G1KA 1A0FA 3IAM2 4NWYA 3FKFA 1T4ZA 3HVSA 3J7Yk 4LMWA 2YNXA 4AJ8A 5F05A 4HS1A 1TRSA 3I43A 2GT5A 1G7EA 1EP7A 1QQ2A 1SENA 2GT6A 4PURA 3ZL5A 1W4VA 1GP1A 5DVBA 1X5EA 3ISOA 1A2MA 2KP2A 2FY6A 4X4JA 5KN1A 3D4TA 2WCIA 2FHEA 3GUSA 1ON4A 3GSSA 2IL3A 5JWOB 2IMEA 4JEDA 3IBHA 3PR8A 1WRYA 4I97A 1DE2A 4IN0A 4MZBA 1TXXA 3ZREA 1OKTA 1OKDA 22GSA 1MD4A 2C3QA 1PA3A 3F3QA 5D9TA 5B7CA 2PVQA 4H86A 1B48A 1PN0A 1TRWA 1YQ1A 5ECRB 3HJMA 3UBKA 2DKHA 2HZEA 4O5RA 2DJ2A 2GS3A 1C72A 5IO0A 1B9XC 3G7YA 2YJHA 2V41A 5IOWA 4MZWA 3TUEA 1PRXA 2WS2A 4J57E 5FWGA 2H75A 4L5LA 4QL9A 3HVXA 2MMOA 4KF9A 3GRXA 3DVXA 4YAVA 3WT2A 3D0ZA 3TRPA 2IMFA 3FZ4A 1TRVA 3TJKA 3GV1A 4KAEA 4CW9A 5IMVA 1V57A 4KDYA 3A3TA 3FW2A 5F0GA 2DIZA 1SD8A 5BMUA 3CBUA 1EWXA 1PFOA 4ISDA 4LMVA 3GTUA 3UOMA 5DDLA 2QSIA 5GSTA 10GSA 4PQHA 5ECSA 5D9XA 1GULA 4O32A 1PX6A 6GSUA 1IYIA 4CY6A 3RBTA 3TKSC 1SYXA 2IMIA 3ME8A 2DMLA 2WJUA 12GSA 2IFQB 5DAKB 5CRDA 2H1GA 4Z7XA 2HSYA 4BVYA 4ECJA 2TRCP 2R3XA 3BJ5A 5IQYA 4PXOA 1OVNA 2OJLA 4MZCA 1B9YC 3DEXA 2R2JA 2Z9SA 2OBKA 1U88A 7GSSA 1EV9A 2YZHA 2MMAA 1AW9A 3CSJA 5CRHA 2L6CA 3LWAA 3DRNA 2HXKA 3H8QA 4IW9A 1O8XA 1PD21 1Z5YE 1Q98A 3RPPA 1SJZA 2C3NA 3QAWA 5ECOB 1EGOA 1AQWA 5A5KA 3G7JA 1LBKA 5C04A 5KN0A 1J0FA 4AJ7A 2M46A 4E8HA 1GL8A 5J3RA 2NDOA 3A5WA 2PGTA 3KXOA 3HDCA 5G2ZA 3VI5A 1ZYQB 2K9FA 1TOFA 1DE1A 5CRWA 2DKIA 4TXVA 4KUNA 2WFCA 3HJOA 1DSBA 2KOKA 5JCWA 1TP9A 3IRAA 1YDKA 1SK1A 3ZMLA 3O3TA 1ZZYA 1X5DA 4EDZA 2C1YA 5CREA 1T00A 4FYUA 1G7DA 3APSA 3KZQA 3GA4A 3LQ7A 2B5YA 2I3YA 3ZFBA 4HSCX 1AQVA 4D73B 3QAVA 2N5FA 1VF2A 5D9VA 2L59A 4G2EA 3R3EA 5LCZA 4F0BA 1F37A 1AC1A 2MBSA 2HT9A 1HNAA 2A4HA 1ML6A 4K1FA 3JCML 1JZOA 3RDWA 1WPIA 2IN3A 1K0NA 1YEXA 1XBSA 6GSYA 5F06A 2VCTA 3TCOA 4MCUA 4PQIA 3EE2A 2DMMA 2YANA 4HOJA 2JZSA 3IDVA 1NHYA 2HRNA 14GSA 3DYRA 3MSZA 3TB2A 4TXOA 4ZIJA 3NZNA 3EC3A 3D21A 5G5EA 1TDIA 1TKDB 3E3EA 1FHEA 4JU5A 5HFGA 3CRTA 3IK9A 4IGJA 2QA2A 4XS1A 3UIWA 2X4AA 4GF0A 4IP1A 1XW9A 4IKHA 1VRSD 1CQGA 2R0PA 4POBA 2JZRA 3EMPA 3LJRA 1Z7PA 4O92A 2N5AA 1ERVA 5F8BA 2P5RA 1J08A 1GSYA 4HZ4A 5B6NA 2JSYA 3VI7A 3CSIA 4BVXB 2H30A 1HYUA 5HR2A 3GKNA 4EC0A 2C0GA 2L6DA 2RUEA 3D22A 1EZKA 2O8VB 3FR9A 1JZRA 5DBQA 1F2EA 5CYYA 3UMAA 5F07A 1GUKA 4Z2RA 2HSMA 1O7UA 3GX8A 1F3AA 3F9UA 3F8UA 3FY7A 4ZBAA 4NAXA 2VCVA 1SK0A 1ZGNA 2GSRA 1NM3A 3L9SA 2I4AA 1NHOA 2C80A 2A2RA 3DKSA 3DXBA 2L57A 3KMNA 1M2DA 3KTLA 2VL2A 5D8IA 2CV4A 1K0AA 2FWFA 3LEFA 1U6TA 5ECHB 2H0IA 1GUHA 4ZILA 1K0DA 1XPVA 1BG5A 1OC3A 4Q5QA 1TI3A 1KNGA 3EWLA 3KMOA 4CDOA 5IMAA 3F4TA 1UVZA 1ERWA 1K3OA 2O85A 3SBCA 1I5GA 1B8XA 4GQCA 4XS4B 3SWLA 1LJRA 5CNWA 1Y25A 2CVDA 1CQHA 2WB9A 4LLRA 1FO5A 4MF7A 5ID2B 1XWBA 4EUYA 1BQ7A 1WMJA 5KOWA 3KH9A 2J9HA 4K7IA 4OFTA 4ZBDA 1QXHA 3CYNA 4JBBA 5B8BA 4MF5A 4F2IA 4X0XA 4ZB6A 2XHFA 3PGTA 2H74A 2MMNA 4ML6A 2H1DA 4DSSB 2KUCA 3LG6A 2XC2A 2A2PA 4N10A 3IC8A 4NV5A 3ERWA 3H79A 2CVKA 3LXZA 2VAFA 2F9SA 2B6MA 4LA1A 2VIMA 1XW6A 1YEPA 4DVCA 2ES7A 2LRCA 1T4YA 5HFKA 1A8YA 1ST9A 3TJBA 1GRXA 3KGKA 4HEA2 5H5SA 4ICYA 1Y6EA 2X8GA 3ZFLA 4K0GA 5EL8A 3UARA 3VPQA 2QGVA 4TVEA 4WF4A 1M3IA 2VO4A 5IMCA 4ZXGA 3FR3A 2NBSA 4X43A 4GTUA 2XBIA 2NPBA 1TRUA 3GKKA 1ZCPA 4IQ1A 5J5NA 3TOUA 2C0FA 3MAKA 3BBYA 1A2JA 4YQMA 2IMKA 4K2XA 4G9HA 2OE1A 3LSZA 1FG4A 5DALA 2H71A 4HU7A 2TRXA 1G6WA 5GSSA 3ED3A 2MZCA 1XOAA 4L0UA 4I8BA 2B7JA 4XS6A 2JACA 2CZ2A 3C7MA 5J41A 1XWKA 1UC7A 1S3CA 5EY6A 3LYKA 6GSTA 3ZVJD 1SL2B 1THOA 4KW6A 2TIRA 4TR0A 4TR1B 2HZFA 2GQLA 3ZTLA 4IELA 4MPGA 4OD7A 1GNWA 1XVWA 3F63A 3UAPA 2R5GA 1M3JA 4EVMA 1PGTA 1EP8A 4POLA 3HKRA 3BCKA 4FH8A 3QPMA 4EO3A 2V2GA 2WGRA 4ZB8A 2JADA 1M2AA 3MIXA 4LL4B 2CX4A 2LS5A 3LGCA 4CHSA 2LUSA 4GRFA 3EU3A 1XIYA 1K3YA 2KHPA 2HYXA 4NMUA 4WEYA 4O7HA 2C0DA 2O7KA 1Q4JA 2B1LA 3ZLPA 1THXA 4K9ZA 1TI1A 4MF6A 2XBQA 4TR4A 5J4UA 3F6FA 1SJIA 1FVKA 1K0BA 3NOFA 1ILOA 4BL7B 5D93A 3TJGA 3R2QA 1K0CA 4KH7A 4NV2A 2VLTA 4BWQA 1XXUA 1OC8A 1WIKA 2E2GA 3MNGA 4V2LA 3W6GA 3CQFA 5ENUA 1OYJA 3TKPA 2DIYA 2LNTA 2HNLA 4LL1B 1SL0B 1TTZA 1U3AA 4JRRA 3WGDA 2GSQA 3GHAA 1IYHA 2R6KA 2H70A 4OWYA 5ECKB 1V2AA 4QQ7A 5DCGA 3DWVA 2GLRA 5A4VA 4BPYA 2EIRA 1XCCA 3J7Yb 2L5LA 4KCAA 2RM6A 2X64A 4PNGA 2WULA 2GZYA 3GKXA 1TK0B 5A4UA 4GWRA 5LD0A 4I2TA 1K0OA 3L4NA 3F4SA 1BEDA 4G0LA 3CTFA 4F82A 2IFQA 2PU9C 5DAKA 1Z7RA 1G6YA 3FHKA 2KLXA 3P7XA 3ME7A 5C00A 2RIIA 1T8EB 4JE1A 2NVLA 3M0FA 2VLUA 5ECMB 1UN2A 2GQMA 1N8JA 4WF5A 2OADA 1EV4A 1EEMA 3WD6A 1M9AA 5IPHA 3M8NA 3IA1A 3VWVA 2F3MA 4IVFA 1GLPA 3IK7A 4PTSA 2CA8A 3CRUA 5HQPA 4MPFA 1O81A 3FK8A 4F0CA 1WE0A 1LU4A 3QCPA 3DVWA 2P31A 3MYDA 3UBLA 4HJMA 3UEMA 1PL1A 1B4QA 5IM9A 5D9WA 5ABRA 2WZ9A 1XWCA 4MJCA 3NIVA 5H5QA 2BJXA 4MABA 4KE3A 4USSA 4MLYA 1OC9B 2RM5A 2IJYA 2HRAA 2MMZA 5E4WA 2C4JA 2N5BA 5AISA 6GSXA 3EURA 1JLWA 1OE7A 2H1BA 3EVIA 4YKGA 3ZZXA 3O76A 3TGZA 4YQVA 1RK4A 3QDNA 3PINA 4WXTA 4EE0A 1DUGA 5E59A 5ECQB 3LW9A 4PUAA 4X1UA 3ZYWA 6GSWA 5B8AA 4GSSA 4K7OA 2YZUA 2UZ8A 1ZYPA 4AJ6A 4FQUA 2AUVA 1A8LA 2HFDA 3L78A 2R0CA 1OE8A 1S3AA 2V32A 3QR6A 4K5SA 4WR4A 4AGSA 1GTUA 3M9JA 2AV4A 4NHWA 4D73A 1ZYNA 2L4CA 4WETA 1U87A 4PGTA 2VD0A 4WKWA 5LNKe 1XG8A 4NXIA 1BAYA 5G30A 4GSNA 1FOVA 3PPUA 1XW5A 3DMLA 4JR4A 4EDYA 4IBPA 3H93A 3EYTA 1QUWA 1H75A 1T1VA 4AF2A 4EKZA 2X8HA 4XRDA 2AJQB 2PERA 3P90A 1F3BA 3W8SA 1FB6A 5DCHA 1YKCA 3KP9A 2DBCA 5AN1A 5HR0A 3UVTA 2FCHA 1M99A 5JCGA 2VCZA 1FOHA 5FT3A 1A23A 4ZL9A 3HA9A 5KOXA 1PN9A 3HVVA 13GSA 2A4VA 4I6XA 2FGXA 3ZMKA 2YOIA 1VF3A 2OBIA 1H4OA 4Z2UA 3L9UA 4TW5A 1PKZA 1W89A 1JZDA 4KSMA 1V40A 2H6XA 2LNSA 3F4RA 4MA9A 2R37A 4HDEA 3HYPA 4HUAA 1E6BA 4OO5A 4BVXA 2LSTA 3FYGA 5G1LA 3WYWA 1UA5A 3I69A 1O73A 3LFLA 3TKRA 3QD9A 5CO3A 1BJXA 4Q5RA 3BCIA 4ILFA 2VLVA 1NSWA 2GZZA 1HNCA 4O5QA 6GSVA 1AQXA 4FYCA 1T3BA 1JHBA 2B7KA 1VF1A 2C8UA 3HVNA 2VM1A 2YN1A 1ZYEA 3F0IA 4GLTA 8GSSA 17GSA 4XTSA 4DEJA 2HE3A 3E0UA 2LEGA 1AXDA 2K18A 1F6MC 4OCEA 2XPEA 3KIJA 4GSTA 3A2XA 4K7NA 2L4QA 3EU4A 2AAWA 2M80A 2DC5A 3ZRDA 4TN8A 2PUKC 3WT1A 1E2YA 2REMA 4KSOA 4GXZA 2VL3A 1Z6NA 1OAZA 4JZQA 2MBTA 4N0ZA 3ZITA 2F51A 2LRTA 5D73A 1KTEA 1SL1B 4XS4A 4K6XA 4MH3A 5ID2A 3ZIVA 2M66A 3KCMA 4ACSA 4TKYA 5KN2A 1WP0A 5KN3A 2M72A 3CXGA 4N11A 1SU9A 3GH6A 2HSHA 3ZIJA 3VWXA 4RUVA 2YWNA 1M0UA 9GSSA 4XIHA 2PN8A 4QL7A 4RI7A 4DSSA 4L8EA 1A2LA 5DJMA 1YZXA 3VK9A 2OKAA 2HRKA 6GSSA 4V1Ap 3P2AA 2PPTA 1JFUA 4IQAA 2LKUA 2YWIA 2OACA 2HLSA 1JLVA 2YWMA 4KCEA 1XVQA 3KD0A 2DSAA 4K8MA 5ELAA 3WGXA 3M9KA 4OO4A 4RI6A 5G5FA 3GMFA 3H4KA 3QOUA 1F9MA 2H66A 3DGQA 1TJDA 3Q74A 4KNDA 5IMDA 3H1NA 3TJJA 1JZWA 2LTKA 2F8AA 2GSSA 3IPZA 3RAZA 4KDUA 2ALBA 1ERUA 2LQQA 2F8FA 2HRFA 4HI7A 1V58A 3S9FA 2E7PA 4IJIA 3IV4A 2K8SA 1GTBA 1HD2A 3LYPA 1MDJA 4MJBA 4PUFC 1U3IA 2OE0A 2VCQA 3V1WA 5HR1A 5HFIA 2AB6A 1MTCA 4YQUA 3EPTA 3A2WA 3G7IA 18GSA 2VD1A 3APOA 1TU8A 3HD5A 1N2AA 4TR1A 2FA8A 5EVOA 2YV9A 2LJRA 3KM6A 2AYTA 4L0WA 4KDXA 1PX7A 4PNFA 3ERFA 1XFLA 4DSQA 4KX4A 4TRXA 2OA7A 4V2MA 3I6AA 3EMXA 5D96A 2OE3A 16GSA 2GVPA 1VGLA 1MDKA 1EEJA 2FD3A 3TKSA 2R0GA 1TW9A 4J2FA 2DJ1A 2DLXA 2B5XA 2IMDA 3N9JA 4MDCA 4HU9A 1SJ6A 4F03A 1X5CA 2HZEB 1VF4A 2LQOA 1ABAA 3TKQA 1YF0A 1FAAA 1WOUA 1WWJA 1YF1A 3DIEA 2I81A 3Q19A 1V9WA 2P0GA 1EGRA 1K3LA 3GN3A 3KH7A 4BWSA 3OR5A 2V1MA 4BL7A 1GWCA 1KEBA 1AIUA 5L71A 1AAZA 2CAIA 4KB3A 5ELGA 5GZZB 1SKWB 1PKWA 2J23A 4WR5A 5JWRB 4Q5FA 3D5JA 3HXSA 2K6VA 3UJ1A 11GSA 2VCWA 1TK5B 3KJYA 3FZ5A 5IMFA 1B4PA 4IP6A 1RQMA 4IJ3A 1G0TA 3HZ8A 3D6IA 3APQA 2I9HA 4ZBBA 4XCSA 1ZMAA 2VOCA 1HNBA 1WJKA 4XRAA 3GTUB 3L9VA 3VFIA 3FZ9A 4EL1A 3GX0A 4RQXA 2GTUA 4F9ZA 2IPAA 1SKRB 3VWWA 5IOXA 1X9WB 3GL3A 3TOTA 3BOAA 3QAGA 3GKMA 3TKSE 3QFAC 1GH2A 3U6VA 1FVJA 5CP1A 4L5OA 5ECLB 3FR6A 4ECIA 2C3TA 4BVYB 1GSUA 5CRGA 1PMTA 2DJ0A 3F6DA 4K2DA 5IPGA 4EIQA 1A24A 5B6MA 2FWEA 3W8JA 5IO2A 1SD9A 3MDKA 4OFNA 3HCZA 3KTBA 2H6ZA 1QK8A 5AIXA 3M1GA 3TJFA 1R5AA 1GLQA 4JR6A 2DJKA 4WBJA 4RQRA 3HJPA 2CZ3A 2FWHA 5HR3A 2JSZA 2PVOC 4HQSA 3P8WA 1URMA 2FWGA 1Z9HA 3DD3A 4NHZA 1X0RA 4K5RA 1OC9A 3Q6OA 3IAS2 5BRTA 2E0QA 2R4VA 4POKA 2O87A 1I9DA 1GNEA 4I2UA 2H0HA 5FHIA 4PQ1A 5J9BA 3IHGA 2GDRA 2LJAA 2ON7A 4Q5NA 4G10A 2D2ZA 5AIVA 4Z2TA 4XHMA 2VCXA 2JZTA 5JWQB 1QGVA 1YY7A 2B5EA 1RW1A 2RUFA 4K0NA 4MH2A 1S3DA 1FW1A 2VUPA 5AGYA 3G9BA 1QFNA 2O89A 5H5RA 4N30A 2IWTA 1SYRA 4E8EA 3CMIA 3L0HA 2VL9A 1GUMA 3C1RA 2FNOA 4IS0A 2RLIA 3US3A 2KP1A 1XWGA 1XWAA 2H72A 2JU5A 2CAQA 4WBRD 2E2MA 3D4MA 2FA4A 4KGIA 5IIZA 1BYEA 3HZ4A 3VLNA 4MNNA 1T7PB 1GSFA 5INYA 1TK8B 1MDIA
chains in the Genus database with same CATH topology
1EOHA 2H1AA 4TOPA 1K0MA 3IE3A 1SK2A 1PL2A 4G0KA 5A4WA 2QKEA 3LORA 1PSQA 5DJLA 2AHEA 2A2SA 2FUG2 2PMTA 3ERGA 4N0VA 1ZOFA 2QC7A 5GAND 4TXOB 3QFBC 2FLSA 4MP4A 4GCIA 3A2VA 1O8WA 2CT6A 2VM2A 1R5PA 4ECBA 2BTOT 1ZL9A 3HY2A 1TU7A 2L5OA 4V2NA 3VPTA 4P3YB 4MJEA 1XOBA 1FB0A 3IR4A 2G2QA 4BA7A 4I5QA 4ECCA 2H01A 2H73A 2EC4A 1GSSA 4YH2A 1M9BA 2YPMA 5GAPD 4FYBA 3O6TA 1A0RP 3GL5A 1YJ6A 1M2BA 2YV7A 3C1SA 1M7TA 4FO5A 3CTGA 3GSTA 1SKSB 3IXRA 3UVHA 4EIPA 2YCDA 5J9CA 4ZL8A 2WDUA 4O5UA 1R26A 3GYKA 2HI7A 3GURA 3BD2A 4FIWA 3UL3A 20GSA 4MJAA 4POMA 5DQYA 3EINA 5CAXA 2V6KA 4ZL7A 1MEKA 3I9V2 4ID0A 2B3SA 2H8LA 1GSDA 2ON5A 3A5IA 3AY8A 2H76A 2LV3A 1ACVA 1KBNA 3GNJA 3GFKA 1GSQA 5IMZA 2ZNMA 1DBYA 2IIYA 2K8VA 3C8EA 1PQNA 2LRNA 4EF0A 1GSEA 3F3RA 4KA0A 2DJJA 2X49A 2WRTA 1GTAA 2V6OA 4OFMA 5G31A 2MYGA 3KEBA 5COHA 3RHBA 1V98A 3WGEA 5JCUA 2GSTA 4GQFA 3U5RE 5KEJA 2ZUPA 3QMXA 5ECIB 4HQZA 3FZAA 2EIOA 1X9SB 4DSRA 5DQSA 3TRQA 1J9BA 3RHCA 4ZB9A 3TRXA 2GGTA 1HQOA 4IHUA 3IHQA 4OMVA 3VWUA 4HJ2A 2NTOA 3ZVJA 2PWJA 4MK3A 4NPBA 3IOSA 1O6JA 1Z3EA 2GZPA 2LJKA 3M3MA 1O85A 4V1Ag 3VURA 2G0FA 4TR3A 3GIXA 1XZOA 2GQKA 2VL2C 1X9MB 2CX3A 3N5OA 3CSHA 4YAPA 1USBA 3FMWA 1QMVA 4HZ2A 2BMXA 2I1UA 2YWOA 2X99A 3PH9A 1Z6MA 5ECPB 2C0EA 3HHVA 3FRCA 2P5QA 3E9JB 2CQ9A 2DJ3A 2XPDA 2JL4A 3RPNA 2H6YA 4G19A 2PBJA 4OCFA 1R4WA 3K8NA 4EXJA 2CVBA 1YKAA 2EIQA 3GH9A 4ML1A 5DALB 3MWHA 5ECNB 4ULXA 3KP8A 1EOGA 1NW2A 4PX1A 4J56E 1ERTA 1BX9A 19GSA 1R7HA 3TDGA 3FEUA 5EPFA 4MMMA 3Q18A 1AUCA 4A5PA 2QA1A 3LXTA 2H0GA 4G0IA 2X8CA 1G7OA 2YP6A 2ZCTA 3C73A 3IC4A 2B1KA 4YKFA 3C71A 4CY8A 1GTIA 2H19A 2YJ7A 1MD3A 5G1KA 1A0FA 3IAM2 4NWYA 3FKFA 1T4ZA 3HVSA 3J7Yk 4LMWA 2YNXA 4AJ8A 5F05A 4HS1A 1TRSA 3I43A 2GT5A 1G7EA 1EP7A 1QQ2A 1SENA 2GT6A 4PURA 3ZL5A 1W4VA 1GP1A 5DVBA 1X5EA 3ISOA 1A2MA 2KP2A 2FY6A 4X4JA 5KN1A 3D4TA 2WCIA 2FHEA 3GUSA 1ON4A 3GSSA 2IL3A 5JWOB 2IMEA 4JEDA 3IBHA 3PR8A 1WRYA 4I97A 1DE2A 4IN0A 4MZBA 1TXXA 3ZREA 1OKTA 1OKDA 22GSA 1MD4A 2C3QA 1PA3A 3F3QA 5D9TA 5B7CA 2PVQA 4H86A 1B48A 1PN0A 1TRWA 1YQ1A 5ECRB 3HJMA 3UBKA 2DKHA 2HZEA 4O5RA 2DJ2A 2GS3A 1C72A 5IO0A 1B9XC 3G7YA 2YJHA 2V41A 5IOWA 4MZWA 3TUEA 1PRXA 2WS2A 4J57E 5FWGA 2H75A 4L5LA 4QL9A 3HVXA 2MMOA 4KF9A 3GRXA 3DVXA 4YAVA 3WT2A 3D0ZA 3TRPA 2IMFA 3FZ4A 1TRVA 3TJKA 3GV1A 4KAEA 4CW9A 5IMVA 1V57A 4KDYA 3A3TA 3FW2A 5F0GA 2DIZA 1SD8A 5BMUA 3CBUA 1EWXA 4ISDA 4LMVA 3GTUA 3UOMA 5DDLA 2QSIA 5GSTA 10GSA 4PQHA 5ECSA 5D9XA 1GULA 4O32A 1PX6A 6GSUA 1IYIA 4CY6A 3RBTA 3TKSC 1SYXA 2IMIA 3ME8A 2DMLA 2WJUA 12GSA 2IFQB 5DAKB 5CRDA 2H1GA 4Z7XA 2HSYA 4BVYA 4ECJA 2TRCP 2R3XA 3BJ5A 5IQYA 4PXOA 1OVNA 2OJLA 4MZCA 1B9YC 3DEXA 2R2JA 2Z9SA 2OBKA 1U88A 7GSSA 1EV9A 2YZHA 2MMAA 1AW9A 3CSJA 5CRHA 2L6CA 3LWAA 3DRNA 2HXKA 3H8QA 4IW9A 1O8XA 1PD21 1Z5YE 1Q98A 3RPPA 1SJZA 2C3NA 3QAWA 5ECOB 1EGOA 1AQWA 5A5KA 3G7JA 1LBKA 5C04A 5KN0A 1J0FA 4AJ7A 2M46A 4E8HA 1GL8A 5J3RA 2NDOA 3A5WA 2PGTA 3KXOA 3HDCA 5G2ZA 3VI5A 1ZYQB 2K9FA 1TOFA 1DE1A 5CRWA 2DKIA 4TXVA 4KUNA 2WFCA 3HJOA 1DSBA 2KOKA 5JCWA 1TP9A 3IRAA 1YDKA 1SK1A 3ZMLA 3O3TA 1ZZYA 1X5DA 4EDZA 2C1YA 5CREA 1T00A 4FYUA 1G7DA 3APSA 3KZQA 3GA4A 3LQ7A 2B5YA 2I3YA 3ZFBA 1AQVA 4D73B 3QAVA 2N5FA 1VF2A 5D9VA 2L59A 4G2EA 3R3EA 5LCZA 4F0BA 1F37A 1AC1A 2MBSA 2HT9A 1HNAA 2A4HA 1ML6A 4K1FA 3JCML 1JZOA 3RDWA 1WPIA 2IN3A 1K0NA 1YEXA 1XBSA 6GSYA 5F06A 2VCTA 3TCOA 4MCUA 4PQIA 3EE2A 2DMMA 2YANA 4HOJA 2JZSA 3IDVA 1NHYA 2HRNA 14GSA 3DYRA 3MSZA 3TB2A 4TXOA 4ZIJA 3NZNA 3EC3A 3D21A 5G5EA 1TDIA 1TKDB 3E3EA 1FHEA 4JU5A 5HFGA 3CRTA 3IK9A 4IGJA 2QA2A 4XS1A 3UIWA 2X4AA 4GF0A 4IP1A 1XW9A 4IKHA 1VRSD 1CQGA 2R0PA 4POBA 2JZRA 3EMPA 3LJRA 1Z7PA 4O92A 2N5AA 1ERVA 5F8BA 2P5RA 1J08A 1GSYA 4HZ4A 5B6NA 2JSYA 3VI7A 3CSIA 4BVXB 2H30A 1HYUA 5HR2A 3GKNA 4EC0A 2C0GA 2L6DA 2RUEA 3D22A 1EZKA 2O8VB 3FR9A 1JZRA 5DBQA 1F2EA 5CYYA 3UMAA 5F07A 1GUKA 4Z2RA 2HSMA 1O7UA 3GX8A 1F3AA 3F9UA 3F8UA 3FY7A 4ZBAA 4NAXA 2VCVA 1SK0A 1ZGNA 2GSRA 1NM3A 3L9SA 2I4AA 1NHOA 2C80A 2A2RA 3DKSA 3DXBA 2L57A 3KMNA 1M2DA 3KTLA 2VL2A 5D8IA 2CV4A 1K0AA 2FWFA 3LEFA 1U6TA 5ECHB 2H0IA 1GUHA 4ZILA 1K0DA 1XPVA 1BG5A 1OC3A 4Q5QA 1TI3A 1KNGA 3EWLA 3KMOA 4CDOA 5IMAA 3F4TA 1UVZA 1ERWA 1K3OA 2O85A 3SBCA 1I5GA 1B8XA 4GQCA 4XS4B 3SWLA 1LJRA 5CNWA 1Y25A 2CVDA 1CQHA 2WB9A 4LLRA 1FO5A 4MF7A 5ID2B 1XWBA 4EUYA 1BQ7A 1WMJA 5KOWA 3KH9A 2J9HA 4K7IA 4OFTA 4ZBDA 1QXHA 3CYNA 4JBBA 5B8BA 4MF5A 4F2IA 4X0XA 4ZB6A 2XHFA 3PGTA 2H74A 2MMNA 4ML6A 2H1DA 4DSSB 2KUCA 3LG6A 2XC2A 2A2PA 4N10A 3IC8A 4NV5A 3ERWA 3H79A 2CVKA 3LXZA 2VAFA 2F9SA 2B6MA 4LA1A 2VIMA 1XW6A 1YEPA 4DVCA 2ES7A 2LRCA 1T4YA 5HFKA 1A8YA 1ST9A 3TJBA 1GRXA 3KGKA 4HEA2 5H5SA 4ICYA 1Y6EA 2X8GA 3ZFLA 4K0GA 5EL8A 3UARA 3VPQA 2QGVA 4TVEA 4WF4A 2VO4A 5IMCA 4ZXGA 3FR3A 2NBSA 4X43A 4GTUA 2XBIA 2NPBA 1TRUA 3GKKA 1ZCPA 4IQ1A 5J5NA 3TOUA 2C0FA 3MAKA 3BBYA 1A2JA 4YQMA 2IMKA 4K2XA 4G9HA 2OE1A 3LSZA 1FG4A 5DALA 2H71A 4HU7A 2TRXA 1G6WA 5GSSA 3ED3A 2MZCA 1XOAA 4L0UA 4I8BA 2B7JA 4XS6A 2JACA 2CZ2A 3C7MA 5J41A 1XWKA 1UC7A 1S3CA 5EY6A 3LYKA 6GSTA 3ZVJD 1SL2B 1THOA 4KW6A 2TIRA 4TR0A 4TR1B 2HZFA 2GQLA 3ZTLA 4IELA 4MPGA 4OD7A 1GNWA 1XVWA 3F63A 3UAPA 2R5GA 4EVMA 1PGTA 1EP8A 4POLA 3HKRA 3BCKA 4FH8A 3QPMA 4EO3A 2V2GA 2WGRA 4ZB8A 2JADA 1M2AA 3MIXA 4LL4B 2CX4A 2LS5A 3LGCA 4CHSA 2LUSA 4GRFA 3EU3A 1XIYA 1K3YA 2KHPA 2HYXA 4NMUA 4WEYA 4O7HA 2C0DA 2O7KA 1Q4JA 2B1LA 3ZLPA 1THXA 4K9ZA 1TI1A 4MF6A 2XBQA 4TR4A 5J4UA 3F6FA 1SJIA 1FVKA 1K0BA 3NOFA 1ILOA 4BL7B 5D93A 3TJGA 3R2QA 1K0CA 4KH7A 4NV2A 2VLTA 4BWQA 1XXUA 1OC8A 1WIKA 2E2GA 3MNGA 4V2LA 3W6GA 5ENUA 1OYJA 3TKPA 2DIYA 2LNTA 2HNLA 4LL1B 1SL0B 1TTZA 1U3AA 4JRRA 3WGDA 2GSQA 3GHAA 1IYHA 2R6KA 2H70A 4OWYA 5ECKB 1V2AA 4QQ7A 5DCGA 3DWVA 2GLRA 5A4VA 4BPYA 2EIRA 1XCCA 3J7Yb 2L5LA 4KCAA 2RM6A 2X64A 4PNGA 2WULA 2GZYA 3GKXA 1TK0B 5A4UA 4GWRA 5LD0A 4I2TA 1K0OA 3L4NA 3F4SA 1BEDA 4G0LA 3CTFA 4F82A 2IFQA 2PU9C 5DAKA 1Z7RA 1G6YA 3FHKA 2KLXA 3P7XA 3ME7A 5C00A 2RIIA 1T8EB 4JE1A 2NVLA 3M0FA 2VLUA 5ECMB 1UN2A 2GQMA 1N8JA 4WF5A 2OADA 1EV4A 1EEMA 3WD6A 1M9AA 5IPHA 3M8NA 3IA1A 3VWVA 2F3MA 4IVFA 1GLPA 3IK7A 4PTSA 2CA8A 3CRUA 5HQPA 4MPFA 1O81A 3FK8A 4F0CA 1WE0A 1LU4A 3QCPA 3DVWA 2P31A 3MYDA 3UBLA 4HJMA 3UEMA 1PL1A 1B4QA 5IM9A 5D9WA 5ABRA 2WZ9A 1XWCA 4MJCA 3NIVA 5H5QA 2BJXA 4MABA 4KE3A 4USSA 4MLYA 1OC9B 2RM5A 2IJYA 2HRAA 2MMZA 5E4WA 2C4JA 2N5BA 5AISA 6GSXA 3EURA 1JLWA 1OE7A 2H1BA 3EVIA 4YKGA 3ZZXA 3O76A 3TGZA 4YQVA 1RK4A 3QDNA 3PINA 4WXTA 4EE0A 1DUGA 5E59A 5ECQB 3LW9A 4PUAA 4X1UA 3ZYWA 6GSWA 5B8AA 4GSSA 4K7OA 2YZUA 2UZ8A 1ZYPA 4AJ6A 4FQUA 2AUVA 1A8LA 2HFDA 3L78A 2R0CA 1OE8A 1S3AA 2V32A 3QR6A 4K5SA 4WR4A 4AGSA 1GTUA 3M9JA 2AV4A 4NHWA 4D73A 1ZYNA 2L4CA 4WETA 1U87A 4PGTA 2VD0A 4WKWA 5LNKe 4NXIA 1BAYA 5G30A 4GSNA 1FOVA 3PPUA 1XW5A 3DMLA 4JR4A 4EDYA 4IBPA 3H93A 3EYTA 1QUWA 1H75A 1T1VA 4AF2A 4EKZA 2X8HA 4XRDA 2AJQB 2PERA 3P90A 1F3BA 3W8SA 1FB6A 5DCHA 1YKCA 3KP9A 2DBCA 5AN1A 5HR0A 3UVTA 2FCHA 1M99A 5JCGA 2VCZA 1FOHA 5FT3A 1A23A 4ZL9A 3HA9A 5KOXA 1PN9A 3HVVA 13GSA 2A4VA 4I6XA 2FGXA 3ZMKA 2YOIA 1VF3A 2OBIA 1H4OA 4Z2UA 3L9UA 4TW5A 1PKZA 1W89A 1JZDA 4KSMA 1V40A 2H6XA 2LNSA 3F4RA 4MA9A 2R37A 4HDEA 3HYPA 4HUAA 1E6BA 4OO5A 4BVXA 2LSTA 3FYGA 5G1LA 3WYWA 1UA5A 3I69A 1O73A 3LFLA 3TKRA 3QD9A 5CO3A 1BJXA 4Q5RA 3BCIA 4ILFA 2VLVA 1NSWA 2GZZA 1HNCA 4O5QA 6GSVA 1AQXA 4FYCA 1T3BA 1JHBA 2B7KA 1VF1A 2C8UA 2VM1A 2YN1A 1ZYEA 3F0IA 4GLTA 8GSSA 17GSA 4XTSA 4DEJA 2HE3A 3E0UA 2LEGA 1AXDA 2K18A 1F6MC 4OCEA 2XPEA 3KIJA 4GSTA 3A2XA 4K7NA 2L4QA 3EU4A 2AAWA 2M80A 2DC5A 3ZRDA 4TN8A 2PUKC 3WT1A 1E2YA 2REMA 4KSOA 4GXZA 2VL3A 1Z6NA 1OAZA 4JZQA 2MBTA 4N0ZA 3ZITA 2F51A 2LRTA 5D73A 1KTEA 1SL1B 4XS4A 4K6XA 4MH3A 5ID2A 3ZIVA 2M66A 3KCMA 4ACSA 4TKYA 5KN2A 1WP0A 5KN3A 2M72A 3CXGA 4N11A 1SU9A 3GH6A 2HSHA 3ZIJA 3VWXA 4RUVA 2YWNA 1M0UA 9GSSA 4XIHA 2PN8A 4QL7A 4RI7A 4DSSA 4L8EA 1A2LA 5DJMA 1YZXA 3VK9A 2OKAA 2HRKA 6GSSA 4V1Ap 3P2AA 2PPTA 1JFUA 4IQAA 2LKUA 2YWIA 2OACA 2HLSA 1JLVA 2YWMA 4KCEA 1XVQA 3KD0A 2DSAA 4K8MA 5ELAA 3WGXA 3M9KA 4OO4A 4RI6A 5G5FA 3GMFA 3H4KA 3QOUA 1F9MA 2H66A 3DGQA 1TJDA 3Q74A 4KNDA 5IMDA 3H1NA 3TJJA 1JZWA 2LTKA 2F8AA 2GSSA 3IPZA 3RAZA 4KDUA 2ALBA 1ERUA 2LQQA 2F8FA 2HRFA 4HI7A 1V58A 3S9FA 2E7PA 4IJIA 3IV4A 2K8SA 1GTBA 1HD2A 3LYPA 1MDJA 4MJBA 4PUFC 1U3IA 2OE0A 2VCQA 3V1WA 5HR1A 5HFIA 2AB6A 1MTCA 4YQUA 3EPTA 3A2WA 3G7IA 18GSA 2VD1A 3APOA 1TU8A 3HD5A 1N2AA 4TR1A 2FA8A 5EVOA 2YV9A 2LJRA 3KM6A 2AYTA 4L0WA 4KDXA 1PX7A 4PNFA 3ERFA 1XFLA 4DSQA 4KX4A 4TRXA 2OA7A 4V2MA 3I6AA 3EMXA 5D96A 2OE3A 16GSA 2GVPA 1VGLA 1MDKA 1EEJA 2FD3A 3TKSA 2R0GA 1TW9A 4J2FA 2DJ1A 2DLXA 2B5XA 2IMDA 3N9JA 4MDCA 4HU9A 1SJ6A 4F03A 1X5CA 2HZEB 1VF4A 2LQOA 1ABAA 3TKQA 1YF0A 1FAAA 1WOUA 1WWJA 1YF1A 3DIEA 2I81A 3Q19A 1V9WA 2P0GA 1EGRA 1K3LA 3GN3A 3KH7A 4BWSA 3OR5A 2V1MA 4BL7A 1GWCA 1KEBA 1AIUA 5L71A 1AAZA 2CAIA 4KB3A 5ELGA 5GZZB 1SKWB 1PKWA 2J23A 4WR5A 5JWRB 4Q5FA 3D5JA 3HXSA 2K6VA 3UJ1A 11GSA 2VCWA 1TK5B 3KJYA 3FZ5A 5IMFA 1B4PA 4IP6A 1RQMA 4IJ3A 1G0TA 3HZ8A 3D6IA 3APQA 2I9HA 4ZBBA 4XCSA 1ZMAA 2VOCA 1HNBA 1WJKA 4XRAA 3GTUB 3L9VA 3VFIA 3FZ9A 4EL1A 3GX0A 4RQXA 2GTUA 4F9ZA 2IPAA 1SKRB 3VWWA 5IOXA 1X9WB 3GL3A 3TOTA 3BOAA 3QAGA 3GKMA 3TKSE 3QFAC 1GH2A 3U6VA 1FVJA 5CP1A 4L5OA 5ECLB 3FR6A 4ECIA 2C3TA 4BVYB 1GSUA 5CRGA 1PMTA 2DJ0A 3F6DA 4K2DA 5IPGA 4EIQA 1A24A 5B6MA 2FWEA 3W8JA 5IO2A 1SD9A 3MDKA 4OFNA 3HCZA 3KTBA 2H6ZA 1QK8A 5AIXA 3M1GA 3TJFA 1R5AA 1GLQA 4JR6A 2DJKA 4WBJA 4RQRA 3HJPA 2CZ3A 2FWHA 5HR3A 2JSZA 2PVOC 4HQSA 3P8WA 1URMA 2FWGA 1Z9HA 3DD3A 4NHZA 1X0RA 4K5RA 1OC9A 3Q6OA 3IAS2 5BRTA 2E0QA 2R4VA 4POKA 2O87A 1I9DA 1GNEA 4I2UA 2H0HA 5FHIA 4PQ1A 5J9BA 3IHGA 2GDRA 2LJAA 2ON7A 4Q5NA 4G10A 2D2ZA 5AIVA 4Z2TA 4XHMA 2VCXA 2JZTA 5JWQB 1QGVA 1YY7A 2B5EA 1RW1A 2RUFA 4K0NA 4MH2A 1S3DA 1FW1A 2VUPA 5AGYA 3G9BA 1QFNA 2O89A 5H5RA 4N30A 2IWTA 1SYRA 4E8EA 3CMIA 3L0HA 2VL9A 1GUMA 3C1RA 2FNOA 4IS0A 2RLIA 3US3A 2KP1A 1XWGA 1XWAA 2H72A 2JU5A 2CAQA 4WBRD 2E2MA 3D4MA 2FA4A 4KGIA 5IIZA 1BYEA 3HZ4A 3VLNA 4MNNA 1T7PB 1GSFA 5INYA 1TK8B 1MDIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EOH A;  2H1A A;  4TOP A;  1K0M A;  3IE3 A;  1SK2 A;  1PL2 A;  5A4W A;  2QKE A;  3LOR A;  1PSQ A;  5DJL A;  2AHE A;  2A2S A;  2FUG 2;  2PMT A;  3ERG A;  4N0V A;  1ZOF A;  2QC7 A;  5GAN D;  4TXO B;  3QFB C;  2FLS A;  4MP4 A;  4GCI A;  3A2V A;  1O8W A;  2CT6 A;  2VM2 A;  1R5P A;  4ECB A;  2BTO T;  1ZL9 A;  3HY2 A;  1TU7 A;  2L5O A;  4V2N A;  3VPT A;  4P3Y B;  4MJE A;  1XOB A;  1FB0 A;  3IR4 A;  2G2Q A;  4BA7 A;  4I5Q A;  4ECC A;  2H01 A;  2H73 A;  2EC4 A;  1GSS A;  4YH2 A;  1M9B A;  2YPM A;  5GAP D;  4FYB A;  3O6T A;  1A0R P;  3GL5 A;  1YJ6 A;  1M2B A;  2YV7 A;  3C1S A;  1M7T A;  4FO5 A;  3CTG A;  3GST A;  1SKS B;  3IXR A;  3UVH A;  2YCD A;  5J9C A;  4ZL8 A;  2WDU A;  1R26 A;  3GYK A;  2HI7 A;  3GUR A;  3BD2 A;  4FIW A;  3UL3 A;  20GS A;  4MJA A;  4POM A;  5DQY A;  3EIN A;  5CAX A;  2V6K A;  4ZL7 A;  1MEK A;  3I9V 2;  4ID0 A;  2B3S A;  2H8L A;  1GSD A;  2ON5 A;  3AY8 A;  2H76 A;  2LV3 A;  1ACV A;  1KBN A;  3GNJ A;  3GFK A;  1GSQ A;  5IMZ A;  2ZNM A;  1DBY A;  2IIY A;  2K8V A;  3C8E A;  1PQN A;  2LRN A;  4EF0 A;  1GSE A;  3F3R A;  4KA0 A;  2DJJ A;  2WRT A;  1GTA A;  2V6O A;  4OFM A;  5G31 A;  2MYG A;  3KEB A;  5COH A;  3RHB A;  1V98 A;  3WGE A;  5JCU A;  2GST A;  4GQF A;  3U5R E;  5KEJ A;  2ZUP A;  3QMX A;  5ECI B;  4HQZ A;  3FZA A;  2EIO A;  1X9S B;  4DSR A;  5DQS A;  3TRQ A;  1J9B A;  3RHC A;  4ZB9 A;  3TRX A;  2GGT A;  1HQO A;  4IHU A;  3IHQ A;  4OMV A;  3VWU A;  4HJ2 A;  2NTO A;  3ZVJ A;  2PWJ A;  4MK3 A;  4NPB A;  3IOS A;  1O6J A;  1Z3E A;  2GZP A;  2LJK A;  3M3M A;  1O85 A;  4V1A g;  3VUR A;  2G0F A;  4TR3 A;  3GIX A;  1XZO A;  2GQK A;  2VL2 C;  1X9M B;  2CX3 A;  3N5O A;  3CSH A;  4YAP A;  1USB A;  1QMV A;  4HZ2 A;  2BMX A;  2I1U A;  2YWO A;  2X99 A;  3PH9 A;  1Z6M A;  5ECP B;  2C0E A;  3HHV A;  3FRC A;  2P5Q A;  3E9J B;  2CQ9 A;  2DJ3 A;  2XPD A;  2JL4 A;  3RPN A;  2H6Y A;  4G19 A;  2PBJ A;  4OCF A;  1R4W A;  3K8N A;  4EXJ A;  2CVB A;  1YKA A;  2EIQ A;  3GH9 A;  4ML1 A;  5DAL B;  3MWH A;  5ECN B;  4ULX A;  3KP8 A;  1EOG A;  1NW2 A;  4PX1 A;  4J56 E;  1ERT A;  1BX9 A;  19GS A;  1R7H A;  3TDG A;  3FEU A;  5EPF A;  4MMM A;  3Q18 A;  1AUC A;  3LXT A;  2H0G A;  2X8C A;  1G7O A;  2YP6 A;  2ZCT A;  3C73 A;  3IC4 A;  2B1K A;  3C71 A;  1GTI A;  2H19 A;  2YJ7 A;  1MD3 A;  5G1K A;  1A0F A;  3IAM 2;  4NWY A;  3FKF A;  1T4Z A;  3HVS A;  3J7Y k;  4LMW A;  2YNX A;  4AJ8 A;  5F05 A;  4HS1 A;  1TRS A;  3I43 A;  2GT5 A;  1G7E A;  1EP7 A;  1QQ2 A;  1SEN A;  2GT6 A;  4PUR A;  3ZL5 A;  1W4V A;  1GP1 A;  5DVB A;  1X5E A;  3ISO A;  1A2M A;  2KP2 A;  2FY6 A;  5KN1 A;  3D4T A;  2WCI A;  2FHE A;  3GUS A;  1ON4 A;  3GSS A;  2IL3 A;  5JWO B;  2IME A;  4JED A;  3IBH A;  3PR8 A;  1WRY A;  4I97 A;  1DE2 A;  4IN0 A;  4MZB A;  1TXX A;  3ZRE A;  1OKT A;  1OKD A;  22GS A;  1MD4 A;  2C3Q A;  1PA3 A;  3F3Q A;  5D9T A;  5B7C A;  2PVQ A;  4H86 A;  1B48 A;  1TRW A;  1YQ1 A;  5ECR B;  3HJM A;  3UBK A;  2HZE A;  4O5R A;  2DJ2 A;  2GS3 A;  1C72 A;  5IO0 A;  1B9X C;  3G7Y A;  2YJH A;  2V41 A;  5IOW A;  4MZW A;  3TUE A;  1PRX A;  2WS2 A;  4J57 E;  5FWG A;  2H75 A;  4L5L A;  4QL9 A;  3HVX A;  2MMO A;  3GRX A;  3DVX A;  4YAV A;  3WT2 A;  3D0Z A;  3TRP A;  2IMF A;  3FZ4 A;  1TRV A;  3TJK A;  3GV1 A;  4KAE A;  4CW9 A;  5IMV A;  1V57 A;  4KDY A;  3A3T A;  3FW2 A;  5F0G A;  2DIZ A;  1SD8 A;  3CBU A;  1EWX A;  4ISD A;  4LMV A;  3GTU A;  3UOM A;  5DDL A;  2QSI A;  5GST A;  10GS A;  4PQH A;  5ECS A;  5D9X A;  1GUL A;  4O32 A;  1PX6 A;  6GSU A;  1IYI A;  3RBT A;  3TKS C;  1SYX A;  2IMI A;  3ME8 A;  2DML A;  2WJU A;  12GS A;  2IFQ B;  5DAK B;  5CRD A;  2H1G A;  4Z7X A;  2HSY A;  4BVY A;  4ECJ A;  2TRC P;  2R3X A;  3BJ5 A;  5IQY A;  4PXO A;  1OVN A;  2OJL A;  4MZC A;  1B9Y C;  3DEX A;  2R2J A;  2Z9S A;  2OBK A;  1U88 A;  7GSS A;  1EV9 A;  2YZH A;  2MMA A;  1AW9 A;  3CSJ A;  5CRH A;  2L6C A;  3LWA A;  3DRN A;  2HXK A;  3H8Q A;  4IW9 A;  1O8X A;  1PD2 1;  1Z5Y E;  1Q98 A;  3RPP A;  1SJZ A;  2C3N A;  3QAW A;  5ECO B;  1EGO A;  1AQW A;  5A5K A;  3G7J A;  1LBK A;  5C04 A;  5KN0 A;  1J0F A;  4AJ7 A;  2M46 A;  4E8H A;  1GL8 A;  5J3R A;  2NDO A;  3A5W A;  2PGT A;  3KXO A;  3HDC A;  5G2Z A;  3VI5 A;  1ZYQ B;  2K9F A;  1TOF A;  1DE1 A;  5CRW A;  4TXV A;  4KUN A;  2WFC A;  3HJO A;  1DSB A;  2KOK A;  5JCW A;  1TP9 A;  3IRA A;  1YDK A;  1SK1 A;  3ZML A;  3O3T A;  1ZZY A;  1X5D A;  4EDZ A;  2C1Y A;  5CRE A;  1T00 A;  4FYU A;  1G7D A;  3APS A;  3KZQ A;  3GA4 A;  3LQ7 A;  2B5Y A;  2I3Y A;  3ZFB A;  1AQV A;  4D73 B;  3QAV A;  2N5F A;  1VF2 A;  5D9V A;  2L59 A;  4G2E A;  5LCZ A;  4F0B A;  1F37 A;  1AC1 A;  2MBS A;  2HT9 A;  1HNA A;  1ML6 A;  4K1F A;  3JCM L;  1JZO A;  3RDW A;  1WPI A;  2IN3 A;  1K0N A;  1YEX A;  1XBS A;  6GSY A;  5F06 A;  2VCT A;  3TCO A;  4MCU A;  4PQI A;  3EE2 A;  2DMM A;  2YAN A;  4HOJ A;  2JZS A;  3IDV A;  1NHY A;  2HRN A;  14GS A;  3DYR A;  3MSZ A;  3TB2 A;  4TXO A;  4ZIJ A;  3NZN A;  3EC3 A;  3D21 A;  5G5E A;  1TDI A;  1TKD B;  3E3E A;  1FHE A;  4JU5 A;  5HFG A;  3CRT A;  3IK9 A;  4IGJ A;  4XS1 A;  3UIW A;  4GF0 A;  4IP1 A;  1XW9 A;  4IKH A;  1VRS D;  1CQG A;  4POB A;  2JZR A;  3EMP A;  3LJR A;  1Z7P A;  4O92 A;  2N5A A;  1ERV A;  5F8B A;  2P5R A;  1J08 A;  1GSY A;  4HZ4 A;  5B6N A;  2JSY A;  3VI7 A;  3CSI A;  2H30 A;  1HYU A;  5HR2 A;  3GKN A;  4EC0 A;  2C0G A;  2L6D A;  2RUE A;  3D22 A;  1EZK A;  2O8V B;  3FR9 A;  1JZR A;  5DBQ A;  1F2E A;  5CYY A;  3UMA A;  5F07 A;  1GUK A;  1O7U A;  3GX8 A;  1F3A A;  3F9U A;  3F8U A;  3FY7 A;  4ZBA A;  4NAX A;  2VCV A;  1SK0 A;  1ZGN A;  2GSR A;  1NM3 A;  3L9S A;  2I4A A;  1NHO A;  2C80 A;  2A2R A;  3DKS A;  3DXB A;  2L57 A;  3KMN A;  1M2D A;  3KTL A;  2VL2 A;  5D8I A;  2CV4 A;  1K0A A;  2FWF A;  3LEF A;  1U6T A;  5ECH B;  2H0I A;  1GUH A;  4ZIL A;  1K0D A;  1XPV A;  1BG5 A;  1OC3 A;  4Q5Q A;  1TI3 A;  1KNG A;  3EWL A;  3KMO A;  4CDO A;  5IMA A;  3F4T A;  1UVZ A;  1ERW A;  1K3O A;  2O85 A;  3SBC A;  1I5G A;  1B8X A;  4GQC A;  4XS4 B;  3SWL A;  1LJR A;  5CNW A;  1Y25 A;  2CVD A;  1CQH A;  2WB9 A;  4LLR A;  1FO5 A;  4MF7 A;  5ID2 B;  1XWB A;  4EUY A;  1BQ7 A;  1WMJ A;  3KH9 A;  2J9H A;  4K7I A;  4OFT A;  4ZBD A;  1QXH A;  3CYN A;  4JBB A;  5B8B A;  4MF5 A;  4F2I A;  4X0X A;  4ZB6 A;  2XHF A;  3PGT A;  2H74 A;  2MMN A;  4ML6 A;  2H1D A;  4DSS B;  2KUC A;  3LG6 A;  2XC2 A;  4N10 A;  4NV5 A;  3ERW A;  3H79 A;  2CVK A;  3LXZ A;  2VAF A;  2F9S A;  2B6M A;  4LA1 A;  2VIM A;  1XW6 A;  1YEP A;  4DVC A;  2ES7 A;  2LRC A;  1T4Y A;  5HFK A;  1A8Y A;  1ST9 A;  3TJB A;  1GRX A;  3KGK A;  4HEA 2;  5H5S A;  1Y6E A;  2X8G A;  3ZFL A;  4K0G A;  5EL8 A;  3UAR A;  3VPQ A;  2QGV A;  4TVE A;  4WF4 A;  2VO4 A;  5IMC A;  4ZXG A;  3FR3 A;  2NBS A;  4X43 A;  4GTU A;  2XBI A;  2NPB A;  1TRU A;  3GKK A;  1ZCP A;  4IQ1 A;  5J5N A;  3TOU A;  2C0F A;  3MAK A;  3BBY A;  1A2J A;  4YQM A;  2IMK A;  4G9H A;  2OE1 A;  3LSZ A;  1FG4 A;  5DAL A;  2H71 A;  4HU7 A;  2TRX A;  1G6W A;  5GSS A;  3ED3 A;  2MZC A;  1XOA A;  4L0U A;  4I8B A;  2B7J A;  4XS6 A;  2JAC A;  2CZ2 A;  3C7M A;  5J41 A;  1XWK A;  1UC7 A;  1S3C A;  5EY6 A;  3LYK A;  6GST A;  3ZVJ D;  1SL2 B;  1THO A;  4KW6 A;  2TIR A;  4TR0 A;  4TR1 B;  2HZF A;  2GQL A;  3ZTL A;  4IEL A;  4MPG A;  4OD7 A;  1GNW A;  1XVW A;  3F63 A;  3UAP A;  2R5G A;  4EVM A;  1PGT A;  1EP8 A;  4POL A;  3HKR A;  3BCK A;  4FH8 A;  3QPM A;  4EO3 A;  2V2G A;  2WGR A;  4ZB8 A;  2JAD A;  1M2A A;  4LL4 B;  2CX4 A;  2LS5 A;  3LGC A;  4CHS A;  2LUS A;  4GRF A;  3EU3 A;  1XIY A;  1K3Y A;  2KHP A;  2HYX A;  4NMU A;  4WEY A;  4O7H A;  2C0D A;  2O7K A;  1Q4J A;  2B1L A;  3ZLP A;  1THX A;  4K9Z A;  1TI1 A;  4MF6 A;  2XBQ A;  4TR4 A;  5J4U A;  3F6F A;  1SJI A;  1FVK A;  1K0B A;  3NOF A;  1ILO A;  5D93 A;  3TJG A;  3R2Q A;  1K0C A;  4KH7 A;  4NV2 A;  2VLT A;  4BWQ A;  1XXU A;  1OC8 A;  1WIK A;  2E2G A;  3MNG A;  4V2L A;  3W6G A;  5ENU A;  1OYJ A;  3TKP A;  2DIY A;  2LNT A;  2HNL A;  4LL1 B;  1SL0 B;  1TTZ A;  1U3A A;  4JRR A;  3WGD A;  2GSQ A;  3GHA A;  1IYH A;  2R6K A;  2H70 A;  4OWY A;  5ECK B;  1V2A A;  4QQ7 A;  5DCG A;  3DWV A;  2GLR A;  5A4V A;  4BPY A;  2EIR A;  1XCC A;  3J7Y b;  2L5L A;  4KCA A;  2RM6 A;  2X64 A;  4PNG A;  2WUL A;  2GZY A;  3GKX A;  1TK0 B;  5A4U A;  4GWR A;  5LD0 A;  4I2T A;  1K0O A;  3L4N A;  3F4S A;  1BED A;  3CTF A;  4F82 A;  2IFQ A;  2PU9 C;  5DAK A;  1Z7R A;  1G6Y A;  3FHK A;  2KLX A;  3P7X A;  3ME7 A;  5C00 A;  2RII A;  1T8E B;  4JE1 A;  2NVL A;  3M0F A;  2VLU A;  5ECM B;  1UN2 A;  2GQM A;  1N8J A;  4WF5 A;  2OAD A;  1EV4 A;  1EEM A;  3WD6 A;  1M9A A;  5IPH A;  3M8N A;  3IA1 A;  3VWV A;  2F3M A;  4IVF A;  1GLP A;  3IK7 A;  2CA8 A;  3CRU A;  5HQP A;  4MPF A;  1O81 A;  3FK8 A;  4F0C A;  1WE0 A;  1LU4 A;  3QCP A;  3DVW A;  2P31 A;  3UBL A;  4HJM A;  3UEM A;  1PL1 A;  1B4Q A;  5IM9 A;  5D9W A;  5ABR A;  2WZ9 A;  1XWC A;  4MJC A;  3NIV A;  5H5Q A;  2BJX A;  4MAB A;  4KE3 A;  4MLY A;  1OC9 B;  2RM5 A;  2IJY A;  2MMZ A;  5E4W A;  2C4J A;  2N5B A;  5AIS A;  6GSX A;  3EUR A;  1JLW A;  1OE7 A;  2H1B A;  3EVI A;  3ZZX A;  3O76 A;  3TGZ A;  4YQV A;  1RK4 A;  3QDN A;  3PIN A;  4WXT A;  4EE0 A;  1DUG A;  5E59 A;  5ECQ B;  4PUA A;  4X1U A;  3ZYW A;  6GSW A;  5B8A A;  4GSS A;  4K7O A;  2YZU A;  4AJ6 A;  2AUV A;  1A8L A;  2HFD A;  3L78 A;  1OE8 A;  1S3A A;  2V32 A;  3QR6 A;  4WR4 A;  4AGS A;  1GTU A;  3M9J A;  2AV4 A;  4NHW A;  4D73 A;  2L4C A;  4WET A;  1U87 A;  4PGT A;  2VD0 A;  4WKW A;  5LNK e;  4NXI A;  1BAY A;  5G30 A;  4GSN A;  1FOV A;  1XW5 A;  3DML A;  4JR4 A;  4EDY A;  4IBP A;  3H93 A;  3EYT A;  1QUW A;  1H75 A;  1T1V A;  4AF2 A;  4EKZ A;  2X8H A;  4XRD A;  2AJQ B;  2PER A;  3P90 A;  1F3B A;  3W8S A;  1FB6 A;  5DCH A;  1YKC A;  3KP9 A;  2DBC A;  5AN1 A;  5HR0 A;  3UVT A;  2FCH A;  1M99 A;  5JCG A;  2VCZ A;  5FT3 A;  1A23 A;  4ZL9 A;  3HA9 A;  1PN9 A;  3HVV A;  13GS A;  2A4V A;  4I6X A;  2FGX A;  3ZMK A;  2YOI A;  1VF3 A;  2OBI A;  1H4O A;  3L9U A;  4TW5 A;  1PKZ A;  1W89 A;  1JZD A;  4KSM A;  1V40 A;  2H6X A;  2LNS A;  3F4R A;  4MA9 A;  2R37 A;  4HDE A;  3HYP A;  4HUA A;  1E6B A;  4OO5 A;  4BVX A;  2LST A;  3FYG A;  5G1L A;  3WYW A;  1UA5 A;  3I69 A;  1O73 A;  3LFL A;  3TKR A;  3QD9 A;  5CO3 A;  1BJX A;  4Q5R A;  3BCI A;  4ILF A;  2VLV A;  1NSW A;  2GZZ A;  1HNC A;  6GSV A;  1AQX A;  4FYC A;  1T3B A;  1JHB A;  2B7K A;  1VF1 A;  2C8U A;  2VM1 A;  2YN1 A;  1ZYE A;  3F0I A;  4GLT A;  8GSS A;  17GS A;  4XTS A;  4DEJ A;  2HE3 A;  3E0U A;  2LEG A;  1AXD A;  2K18 A;  1F6M C;  4OCE A;  2XPE A;  3KIJ A;  4GST A;  3A2X A;  4K7N A;  2L4Q A;  3EU4 A;  2AAW A;  2M80 A;  2DC5 A;  3ZRD A;  4TN8 A;  2PUK C;  3WT1 A;  1E2Y A;  2REM A;  4KSO A;  4GXZ A;  2VL3 A;  1Z6N A;  1OAZ A;  4JZQ A;  2MBT A;  4N0Z A;  3ZIT A;  2F51 A;  2LRT A;  5D73 A;  1KTE A;  1SL1 B;  4XS4 A;  4K6X A;  4MH3 A;  5ID2 A;  3ZIV A;  2M66 A;  3KCM A;  4ACS A;  4TKY A;  5KN2 A;  1WP0 A;  5KN3 A;  2M72 A;  3CXG A;  4N11 A;  1SU9 A;  3GH6 A;  2HSH A;  3ZIJ A;  3VWX A;  4RUV A;  2YWN A;  1M0U A;  9GSS A;  4XIH A;  2PN8 A;  4QL7 A;  4RI7 A;  4DSS A;  4L8E A;  1A2L A;  5DJM A;  1YZX A;  3VK9 A;  2OKA A;  6GSS A;  4V1A p;  3P2A A;  2PPT A;  1JFU A;  4IQA A;  2LKU A;  2YWI A;  2OAC A;  2HLS A;  1JLV A;  2YWM A;  4KCE A;  1XVQ A;  3KD0 A;  2DSA A;  4K8M A;  5ELA A;  3WGX A;  3M9K A;  4OO4 A;  4RI6 A;  5G5F A;  3GMF A;  3H4K A;  3QOU A;  1F9M A;  2H66 A;  3DGQ A;  1TJD A;  3Q74 A;  4KND A;  5IMD A;  3H1N A;  3TJJ A;  1JZW A;  2LTK A;  2F8A A;  2GSS A;  3IPZ A;  3RAZ A;  4KDU A;  2ALB A;  1ERU A;  2LQQ A;  2F8F A;  2HRF A;  4HI7 A;  1V58 A;  3S9F A;  2E7P A;  4IJI A;  3IV4 A;  2K8S A;  1GTB A;  1HD2 A;  3LYP A;  1MDJ A;  4MJB A;  4PUF C;  1U3I A;  2OE0 A;  2VCQ A;  3V1W A;  5HR1 A;  5HFI A;  2AB6 A;  1MTC A;  4YQU A;  3A2W A;  3G7I A;  18GS A;  2VD1 A;  3APO A;  1TU8 A;  3HD5 A;  1N2A A;  4TR1 A;  2FA8 A;  5EVO A;  2YV9 A;  2LJR A;  3KM6 A;  2AYT A;  4L0W A;  4KDX A;  1PX7 A;  4PNF A;  3ERF A;  1XFL A;  4DSQ A;  4KX4 A;  4TRX A;  2OA7 A;  4V2M A;  3I6A A;  3EMX A;  5D96 A;  2OE3 A;  16GS A;  2GVP A;  1VGL A;  1MDK A;  1EEJ A;  2FD3 A;  3TKS A;  1TW9 A;  4J2F A;  2DJ1 A;  2DLX A;  2B5X A;  2IMD A;  3N9J A;  4MDC A;  4HU9 A;  1SJ6 A;  4F03 A;  1X5C A;  2HZE B;  1VF4 A;  2LQO A;  1ABA A;  3TKQ A;  1YF0 A;  1FAA A;  1WOU A;  1WWJ A;  1YF1 A;  3DIE A;  2I81 A;  3Q19 A;  1V9W A;  2P0G A;  1EGR A;  1K3L A;  3GN3 A;  3KH7 A;  4BWS A;  3OR5 A;  2V1M A;  4BL7 A;  1GWC A;  1KEB A;  1AIU A;  5L71 A;  1AAZ A;  2CAI A;  4KB3 A;  5ELG A;  5GZZ B;  1SKW B;  1PKW A;  2J23 A;  4WR5 A;  5JWR B;  4Q5F A;  3D5J A;  3HXS A;  2K6V A;  3UJ1 A;  11GS A;  2VCW A;  1TK5 B;  3KJY A;  3FZ5 A;  5IMF A;  1B4P A;  4IP6 A;  1RQM A;  4IJ3 A;  1G0T A;  3HZ8 A;  3D6I A;  3APQ A;  2I9H A;  4ZBB A;  4XCS A;  1ZMA A;  2VOC A;  1HNB A;  1WJK A;  4XRA A;  3GTU B;  3L9V A;  3VFI A;  3FZ9 A;  4EL1 A;  3GX0 A;  4RQX A;  2GTU A;  4F9Z A;  2IPA A;  1SKR B;  3VWW A;  5IOX A;  1X9W B;  3GL3 A;  3TOT A;  3BOA A;  3QAG A;  3GKM A;  3TKS E;  3QFA C;  1GH2 A;  3U6V A;  1FVJ A;  5CP1 A;  4L5O A;  5ECL B;  3FR6 A;  4ECI A;  2C3T A;  1GSU A;  5CRG A;  1PMT A;  2DJ0 A;  3F6D A;  4K2D A;  5IPG A;  1A24 A;  5B6M A;  2FWE A;  3W8J A;  5IO2 A;  1SD9 A;  3MDK A;  4OFN A;  3HCZ A;  3KTB A;  2H6Z A;  1QK8 A;  5AIX A;  3M1G A;  3TJF A;  1R5A A;  1GLQ A;  4JR6 A;  2DJK A;  4WBJ A;  4RQR A;  3HJP A;  2CZ3 A;  2FWH A;  5HR3 A;  2JSZ A;  2PVO C;  4HQS A;  3P8W A;  1URM A;  2FWG A;  1Z9H A;  3DD3 A;  4NHZ A;  1X0R A;  1OC9 A;  3Q6O A;  3IAS 2;  2E0Q A;  2R4V A;  4POK A;  2O87 A;  1I9D A;  1GNE A;  4I2U A;  2H0H A;  5FHI A;  4PQ1 A;  5J9B A;  2GDR A;  2LJA A;  2ON7 A;  4Q5N A;  4G10 A;  2D2Z A;  5AIV A;  4XHM A;  2VCX A;  2JZT A;  5JWQ B;  1QGV A;  1YY7 A;  2B5E A;  1RW1 A;  2RUF A;  4K0N A;  4MH2 A;  1S3D A;  1FW1 A;  2VUP A;  5AGY A;  3G9B A;  1QFN A;  2O89 A;  5H5R A;  4N30 A;  2IWT A;  1SYR A;  4E8E A;  3CMI A;  3L0H A;  2VL9 A;  1GUM A;  3C1R A;  2FNO A;  4IS0 A;  2RLI A;  3US3 A;  2KP1 A;  1XWG A;  1XWA A;  2H72 A;  2JU5 A;  2CAQ A;  4WBR D;  2E2M A;  3D4M A;  2FA4 A;  4KGI A;  5IIZ A;  1BYE A;  3HZ4 A;  3VLN A;  1T7P B;  1GSF A;  5INY A;  1TK8 B;  1MDI A; 
#chains in the Genus database with same CATH topology
 1EOH A;  2H1A A;  4TOP A;  1K0M A;  3IE3 A;  1SK2 A;  1PL2 A;  4G0K A;  5A4W A;  2QKE A;  3LOR A;  1PSQ A;  5DJL A;  2AHE A;  2A2S A;  2FUG 2;  2PMT A;  3ERG A;  4N0V A;  1ZOF A;  2QC7 A;  5GAN D;  4TXO B;  3QFB C;  2FLS A;  4MP4 A;  4GCI A;  3A2V A;  1O8W A;  2CT6 A;  2VM2 A;  1R5P A;  4ECB A;  2BTO T;  1ZL9 A;  3HY2 A;  1TU7 A;  2L5O A;  1S3R A;  4V2N A;  3VPT A;  4P3Y B;  4MJE A;  1XOB A;  1FB0 A;  3IR4 A;  2G2Q A;  4BA7 A;  4I5Q A;  4ECC A;  2H01 A;  2H73 A;  2EC4 A;  1GSS A;  4YH2 A;  1M9B A;  2YPM A;  5GAP D;  4FYB A;  3O6T A;  1A0R P;  3GL5 A;  1YJ6 A;  1M2B A;  2YV7 A;  3C1S A;  1M7T A;  4FO5 A;  3CTG A;  4BIK A;  3GST A;  1SKS B;  3IXR A;  3UVH A;  4EIP A;  2YCD A;  5J9C A;  4ZL8 A;  2WDU A;  4O5U A;  1R26 A;  3GYK A;  2HI7 A;  3GUR A;  3BD2 A;  4FIW A;  3UL3 A;  20GS A;  4MJA A;  4POM A;  5DQY A;  3EIN A;  5CAX A;  2V6K A;  4ZL7 A;  1MEK A;  3I9V 2;  4ID0 A;  2B3S A;  2H8L A;  1GSD A;  2ON5 A;  3A5I A;  3AY8 A;  2H76 A;  2LV3 A;  1ACV A;  1KBN A;  3GNJ A;  3GFK A;  1GSQ A;  5IMZ A;  2ZNM A;  1DBY A;  2IIY A;  2K8V A;  3C8E A;  1PQN A;  2LRN A;  4EF0 A;  1GSE A;  3F3R A;  4KA0 A;  2DJJ A;  2X49 A;  2WRT A;  1GTA A;  2V6O A;  4OFM A;  5G31 A;  2MYG A;  3KEB A;  5COH A;  3RHB A;  1V98 A;  3WGE A;  5JCU A;  2GST A;  4GQF A;  3U5R E;  5KEJ A;  2ZUP A;  3QMX A;  5ECI B;  4HQZ A;  3FZA A;  2EIO A;  1X9S B;  4DSR A;  5DQS A;  3TRQ A;  1J9B A;  3RHC A;  4ZB9 A;  3TRX A;  2GGT A;  1HQO A;  4IHU A;  3IHQ A;  4OMV A;  3VWU A;  4HJ2 A;  2NTO A;  3ZVJ A;  2PWJ A;  4MK3 A;  4NPB A;  3IOS A;  1O6J A;  1Z3E A;  2GZP A;  2LJK A;  3M3M A;  1O85 A;  4V1A g;  3VUR A;  2G0F A;  4TR3 A;  3GIX A;  1XZO A;  2GQK A;  2VL2 C;  1X9M B;  2CX3 A;  3N5O A;  3CSH A;  4YAP A;  1USB A;  3FMW A;  1QMV A;  4HZ2 A;  2BMX A;  2I1U A;  2YWO A;  2X99 A;  3PH9 A;  1Z6M A;  5ECP B;  2C0E A;  3HHV A;  3FRC A;  2P5Q A;  3E9J B;  2CQ9 A;  2DJ3 A;  2XPD A;  2JL4 A;  3RPN A;  2H6Y A;  4G19 A;  2PBJ A;  4OCF A;  1R4W A;  3K8N A;  4EXJ A;  2CVB A;  1YKA A;  2EIQ A;  3GH9 A;  4ML1 A;  5DAL B;  3MWH A;  5ECN B;  4ULX A;  3KP8 A;  1EOG A;  1NW2 A;  4PX1 A;  4J56 E;  1ERT A;  1BX9 A;  19GS A;  1R7H A;  3TDG A;  3FEU A;  5EPF A;  4MMM A;  3Q18 A;  1AUC A;  4A5P A;  2QA1 A;  3LXT A;  2H0G A;  4G0I A;  2X8C A;  1G7O A;  2YP6 A;  2ZCT A;  3C73 A;  3IC4 A;  2B1K A;  4YKF A;  3C71 A;  4CY8 A;  1GTI A;  2H19 A;  2YJ7 A;  1MD3 A;  5G1K A;  1A0F A;  3IAM 2;  4NWY A;  3FKF A;  1T4Z A;  3HVS A;  3J7Y k;  4LMW A;  2YNX A;  4AJ8 A;  5F05 A;  4HS1 A;  1TRS A;  3I43 A;  2GT5 A;  1G7E A;  1EP7 A;  1QQ2 A;  1SEN A;  2GT6 A;  4PUR A;  3ZL5 A;  1W4V A;  1GP1 A;  5DVB A;  1X5E A;  3ISO A;  1A2M A;  2KP2 A;  2FY6 A;  4X4J A;  5KN1 A;  3D4T A;  2WCI A;  2FHE A;  3GUS A;  1ON4 A;  3GSS A;  2IL3 A;  5JWO B;  2IME A;  4JED A;  3IBH A;  3PR8 A;  1WRY A;  4I97 A;  1DE2 A;  4IN0 A;  4MZB A;  1TXX A;  3ZRE A;  1OKT A;  1OKD A;  22GS A;  1MD4 A;  2C3Q A;  1PA3 A;  3F3Q A;  5D9T A;  5B7C A;  2PVQ A;  4H86 A;  1B48 A;  1PN0 A;  1TRW A;  1YQ1 A;  5ECR B;  3HJM A;  3UBK A;  2DKH A;  2HZE A;  4O5R A;  2DJ2 A;  2GS3 A;  1C72 A;  5IO0 A;  1B9X C;  3G7Y A;  2YJH A;  2V41 A;  5IOW A;  4MZW A;  3TUE A;  1PRX A;  2WS2 A;  4J57 E;  5FWG A;  2H75 A;  4L5L A;  4QL9 A;  3HVX A;  2MMO A;  4KF9 A;  3GRX A;  3DVX A;  4YAV A;  3WT2 A;  3D0Z A;  3TRP A;  2IMF A;  3FZ4 A;  1TRV A;  3TJK A;  3GV1 A;  4KAE A;  4CW9 A;  5IMV A;  1V57 A;  4KDY A;  3A3T A;  3FW2 A;  5F0G A;  2DIZ A;  1SD8 A;  5BMU A;  3CBU A;  1EWX A;  1PFO A;  4ISD A;  4LMV A;  3GTU A;  3UOM A;  5DDL A;  2QSI A;  5GST A;  10GS A;  4PQH A;  5ECS A;  5D9X A;  1GUL A;  4O32 A;  1PX6 A;  6GSU A;  1IYI A;  4CY6 A;  3RBT A;  3TKS C;  1SYX A;  2IMI A;  3ME8 A;  2DML A;  2WJU A;  12GS A;  2IFQ B;  5DAK B;  5CRD A;  2H1G A;  4Z7X A;  2HSY A;  4BVY A;  4ECJ A;  2TRC P;  2R3X A;  3BJ5 A;  5IQY A;  4PXO A;  1OVN A;  2OJL A;  4MZC A;  1B9Y C;  3DEX A;  2R2J A;  2Z9S A;  2OBK A;  1U88 A;  7GSS A;  1EV9 A;  2YZH A;  2MMA A;  1AW9 A;  3CSJ A;  5CRH A;  2L6C A;  3LWA A;  3DRN A;  2HXK A;  3H8Q A;  4IW9 A;  1O8X A;  1PD2 1;  1Z5Y E;  1Q98 A;  3RPP A;  1SJZ A;  2C3N A;  3QAW A;  5ECO B;  1EGO A;  1AQW A;  5A5K A;  3G7J A;  1LBK A;  5C04 A;  5KN0 A;  1J0F A;  4AJ7 A;  2M46 A;  4E8H A;  1GL8 A;  5J3R A;  2NDO A;  3A5W A;  2PGT A;  3KXO A;  3HDC A;  5G2Z A;  3VI5 A;  1ZYQ B;  2K9F A;  1TOF A;  1DE1 A;  5CRW A;  2DKI A;  4TXV A;  4KUN A;  2WFC A;  3HJO A;  1DSB A;  2KOK A;  5JCW A;  1TP9 A;  3IRA A;  1YDK A;  1SK1 A;  3ZML A;  3O3T A;  1ZZY A;  1X5D A;  4EDZ A;  2C1Y A;  5CRE A;  1T00 A;  4FYU A;  1G7D A;  3APS A;  3KZQ A;  3GA4 A;  3LQ7 A;  2B5Y A;  2I3Y A;  3ZFB A;  4HSC X;  1AQV A;  4D73 B;  3QAV A;  2N5F A;  1VF2 A;  5D9V A;  2L59 A;  4G2E A;  3R3E A;  5LCZ A;  4F0B A;  1F37 A;  1AC1 A;  2MBS A;  2HT9 A;  1HNA A;  2A4H A;  1ML6 A;  4K1F A;  3JCM L;  1JZO A;  3RDW A;  1WPI A;  2IN3 A;  1K0N A;  1YEX A;  1XBS A;  6GSY A;  5F06 A;  2VCT A;  3TCO A;  4MCU A;  4PQI A;  3EE2 A;  2DMM A;  2YAN A;  4HOJ A;  2JZS A;  3IDV A;  1NHY A;  2HRN A;  14GS A;  3DYR A;  3MSZ A;  3TB2 A;  4TXO A;  4ZIJ A;  3NZN A;  3EC3 A;  3D21 A;  5G5E A;  1TDI A;  1TKD B;  3E3E A;  1FHE A;  4JU5 A;  5HFG A;  3CRT A;  3IK9 A;  4IGJ A;  2QA2 A;  4XS1 A;  3UIW A;  2X4A A;  4GF0 A;  4IP1 A;  1XW9 A;  4IKH A;  1VRS D;  1CQG A;  2R0P A;  4POB A;  2JZR A;  3EMP A;  3LJR A;  1Z7P A;  4O92 A;  2N5A A;  1ERV A;  5F8B A;  2P5R A;  1J08 A;  1GSY A;  4HZ4 A;  5B6N A;  2JSY A;  3VI7 A;  3CSI A;  4BVX B;  2H30 A;  1HYU A;  5HR2 A;  3GKN A;  4EC0 A;  2C0G A;  2L6D A;  2RUE A;  3D22 A;  1EZK A;  2O8V B;  3FR9 A;  1JZR A;  5DBQ A;  1F2E A;  5CYY A;  3UMA A;  5F07 A;  1GUK A;  4Z2R A;  2HSM A;  1O7U A;  3GX8 A;  1F3A A;  3F9U A;  3F8U A;  3FY7 A;  4ZBA A;  4NAX A;  2VCV A;  1SK0 A;  1ZGN A;  2GSR A;  1NM3 A;  3L9S A;  2I4A A;  1NHO A;  2C80 A;  2A2R A;  3DKS A;  3DXB A;  2L57 A;  3KMN A;  1M2D A;  3KTL A;  2VL2 A;  5D8I A;  2CV4 A;  1K0A A;  2FWF A;  3LEF A;  1U6T A;  5ECH B;  2H0I A;  1GUH A;  4ZIL A;  1K0D A;  1XPV A;  1BG5 A;  1OC3 A;  4Q5Q A;  1TI3 A;  1KNG A;  3EWL A;  3KMO A;  4CDO A;  5IMA A;  3F4T A;  1UVZ A;  1ERW A;  1K3O A;  2O85 A;  3SBC A;  1I5G A;  1B8X A;  4GQC A;  4XS4 B;  3SWL A;  1LJR A;  5CNW A;  1Y25 A;  2CVD A;  1CQH A;  2WB9 A;  4LLR A;  1FO5 A;  4MF7 A;  5ID2 B;  1XWB A;  4EUY A;  1BQ7 A;  1WMJ A;  5KOW A;  3KH9 A;  2J9H A;  4K7I A;  4OFT A;  4ZBD A;  1QXH A;  3CYN A;  4JBB A;  5B8B A;  4MF5 A;  4F2I A;  4X0X A;  4ZB6 A;  2XHF A;  3PGT A;  2H74 A;  2MMN A;  4ML6 A;  2H1D A;  4DSS B;  2KUC A;  3LG6 A;  2XC2 A;  2A2P A;  4N10 A;  3IC8 A;  4NV5 A;  3ERW A;  3H79 A;  2CVK A;  3LXZ A;  2VAF A;  2F9S A;  2B6M A;  4LA1 A;  2VIM A;  1XW6 A;  1YEP A;  4DVC A;  2ES7 A;  2LRC A;  1T4Y A;  5HFK A;  1A8Y A;  1ST9 A;  3TJB A;  1GRX A;  3KGK A;  4HEA 2;  5H5S A;  4ICY A;  1Y6E A;  2X8G A;  3ZFL A;  4K0G A;  5EL8 A;  3UAR A;  3VPQ A;  2QGV A;  4TVE A;  4WF4 A;  1M3I A;  2VO4 A;  5IMC A;  4ZXG A;  3FR3 A;  2NBS A;  4X43 A;  4GTU A;  2XBI A;  2NPB A;  1TRU A;  3GKK A;  1ZCP A;  4IQ1 A;  5J5N A;  3TOU A;  2C0F A;  3MAK A;  3BBY A;  1A2J A;  4YQM A;  2IMK A;  4K2X A;  4G9H A;  2OE1 A;  3LSZ A;  1FG4 A;  5DAL A;  2H71 A;  4HU7 A;  2TRX A;  1G6W A;  5GSS A;  3ED3 A;  2MZC A;  1XOA A;  4L0U A;  4I8B A;  2B7J A;  4XS6 A;  2JAC A;  2CZ2 A;  3C7M A;  5J41 A;  1XWK A;  1UC7 A;  1S3C A;  5EY6 A;  3LYK A;  6GST A;  3ZVJ D;  1SL2 B;  1THO A;  4KW6 A;  2TIR A;  4TR0 A;  4TR1 B;  2HZF A;  2GQL A;  3ZTL A;  4IEL A;  4MPG A;  4OD7 A;  1GNW A;  1XVW A;  3F63 A;  3UAP A;  2R5G A;  1M3J A;  4EVM A;  1PGT A;  1EP8 A;  4POL A;  3HKR A;  3BCK A;  4FH8 A;  3QPM A;  4EO3 A;  2V2G A;  2WGR A;  4ZB8 A;  2JAD A;  1M2A A;  3MIX A;  4LL4 B;  2CX4 A;  2LS5 A;  3LGC A;  4CHS A;  2LUS A;  4GRF A;  3EU3 A;  1XIY A;  1K3Y A;  2KHP A;  2HYX A;  4NMU A;  4WEY A;  4O7H A;  2C0D A;  2O7K A;  1Q4J A;  2B1L A;  3ZLP A;  1THX A;  4K9Z A;  1TI1 A;  4MF6 A;  2XBQ A;  4TR4 A;  5J4U A;  3F6F A;  1SJI A;  1FVK A;  1K0B A;  3NOF A;  1ILO A;  4BL7 B;  5D93 A;  3TJG A;  3R2Q A;  1K0C A;  4KH7 A;  4NV2 A;  2VLT A;  4BWQ A;  1XXU A;  1OC8 A;  1WIK A;  2E2G A;  3MNG A;  4V2L A;  3W6G A;  3CQF A;  5ENU A;  1OYJ A;  3TKP A;  2DIY A;  2LNT A;  2HNL A;  4LL1 B;  1SL0 B;  1TTZ A;  1U3A A;  4JRR A;  3WGD A;  2GSQ A;  3GHA A;  1IYH A;  2R6K A;  2H70 A;  4OWY A;  5ECK B;  1V2A A;  4QQ7 A;  5DCG A;  3DWV A;  2GLR A;  5A4V A;  4BPY A;  2EIR A;  1XCC A;  3J7Y b;  2L5L A;  4KCA A;  2RM6 A;  2X64 A;  4PNG A;  2WUL A;  2GZY A;  3GKX A;  1TK0 B;  5A4U A;  4GWR A;  5LD0 A;  4I2T A;  1K0O A;  3L4N A;  3F4S A;  1BED A;  4G0L A;  3CTF A;  4F82 A;  2IFQ A;  2PU9 C;  5DAK A;  1Z7R A;  1G6Y A;  3FHK A;  2KLX A;  3P7X A;  3ME7 A;  5C00 A;  2RII A;  1T8E B;  4JE1 A;  2NVL A;  3M0F A;  2VLU A;  5ECM B;  1UN2 A;  2GQM A;  1N8J A;  4WF5 A;  2OAD A;  1EV4 A;  1EEM A;  3WD6 A;  1M9A A;  5IPH A;  3M8N A;  3IA1 A;  3VWV A;  2F3M A;  4IVF A;  1GLP A;  3IK7 A;  4PTS A;  2CA8 A;  3CRU A;  5HQP A;  4MPF A;  1O81 A;  3FK8 A;  4F0C A;  1WE0 A;  1LU4 A;  3QCP A;  3DVW A;  2P31 A;  3MYD A;  3UBL A;  4HJM A;  3UEM A;  1PL1 A;  1B4Q A;  5IM9 A;  5D9W A;  5ABR A;  2WZ9 A;  1XWC A;  4MJC A;  3NIV A;  5H5Q A;  2BJX A;  4MAB A;  4KE3 A;  4USS A;  4MLY A;  1OC9 B;  2RM5 A;  2IJY A;  2HRA A;  2MMZ A;  5E4W A;  2C4J A;  2N5B A;  5AIS A;  6GSX A;  3EUR A;  1JLW A;  1OE7 A;  2H1B A;  3EVI A;  4YKG A;  3ZZX A;  3O76 A;  3TGZ A;  4YQV A;  1RK4 A;  3QDN A;  3PIN A;  4WXT A;  4EE0 A;  1DUG A;  5E59 A;  5ECQ B;  3LW9 A;  4PUA A;  4X1U A;  3ZYW A;  6GSW A;  5B8A A;  4GSS A;  4K7O A;  2YZU A;  2UZ8 A;  1ZYP A;  4AJ6 A;  4FQU A;  2AUV A;  1A8L A;  2HFD A;  3L78 A;  2R0C A;  1OE8 A;  1S3A A;  2V32 A;  3QR6 A;  4K5S A;  4WR4 A;  4AGS A;  1GTU A;  3M9J A;  2AV4 A;  4NHW A;  4D73 A;  1ZYN A;  2L4C A;  4WET A;  1U87 A;  4PGT A;  2VD0 A;  4WKW A;  5LNK e;  1XG8 A;  4NXI A;  1BAY A;  5G30 A;  4GSN A;  1FOV A;  3PPU A;  1XW5 A;  3DML A;  4JR4 A;  4EDY A;  4IBP A;  3H93 A;  3EYT A;  1QUW A;  1H75 A;  1T1V A;  4AF2 A;  4EKZ A;  2X8H A;  4XRD A;  2AJQ B;  2PER A;  3P90 A;  1F3B A;  3W8S A;  1FB6 A;  5DCH A;  1YKC A;  3KP9 A;  2DBC A;  5AN1 A;  5HR0 A;  3UVT A;  2FCH A;  1M99 A;  5JCG A;  2VCZ A;  1FOH A;  5FT3 A;  1A23 A;  4ZL9 A;  3HA9 A;  5KOX A;  1PN9 A;  3HVV A;  13GS A;  2A4V A;  4I6X A;  2FGX A;  3ZMK A;  2YOI A;  1VF3 A;  2OBI A;  1H4O A;  4Z2U A;  3L9U A;  4TW5 A;  1PKZ A;  1W89 A;  1JZD A;  4KSM A;  1V40 A;  2H6X A;  2LNS A;  3F4R A;  4MA9 A;  2R37 A;  4HDE A;  3HYP A;  4HUA A;  1E6B A;  4OO5 A;  4BVX A;  2LST A;  3FYG A;  5G1L A;  3WYW A;  1UA5 A;  3I69 A;  1O73 A;  3LFL A;  3TKR A;  3QD9 A;  5CO3 A;  1BJX A;  4Q5R A;  3BCI A;  4ILF A;  2VLV A;  1NSW A;  2GZZ A;  1HNC A;  4O5Q A;  6GSV A;  1AQX A;  4FYC A;  1T3B A;  1JHB A;  2B7K A;  1VF1 A;  2C8U A;  3HVN A;  2VM1 A;  2YN1 A;  1ZYE A;  3F0I A;  4GLT A;  8GSS A;  17GS A;  4XTS A;  4DEJ A;  2HE3 A;  3E0U A;  2LEG A;  1AXD A;  2K18 A;  1F6M C;  4OCE A;  2XPE A;  3KIJ A;  4GST A;  3A2X A;  4K7N A;  2L4Q A;  3EU4 A;  2AAW A;  2M80 A;  2DC5 A;  3ZRD A;  4TN8 A;  2PUK C;  3WT1 A;  1E2Y A;  2REM A;  4KSO A;  4GXZ A;  2VL3 A;  1Z6N A;  1OAZ A;  4JZQ A;  2MBT A;  4N0Z A;  3ZIT A;  2F51 A;  2LRT A;  5D73 A;  1KTE A;  1SL1 B;  4XS4 A;  4K6X A;  4MH3 A;  5ID2 A;  3ZIV A;  2M66 A;  3KCM A;  4ACS A;  4TKY A;  5KN2 A;  1WP0 A;  5KN3 A;  2M72 A;  3CXG A;  4N11 A;  1SU9 A;  3GH6 A;  2HSH A;  3ZIJ A;  3VWX A;  4RUV A;  2YWN A;  1M0U A;  9GSS A;  4XIH A;  2PN8 A;  4QL7 A;  4RI7 A;  4DSS A;  4L8E A;  1A2L A;  5DJM A;  1YZX A;  3VK9 A;  2OKA A;  2HRK A;  6GSS A;  4V1A p;  3P2A A;  2PPT A;  1JFU A;  4IQA A;  2LKU A;  2YWI A;  2OAC A;  2HLS A;  1JLV A;  2YWM A;  4KCE A;  1XVQ A;  3KD0 A;  2DSA A;  4K8M A;  5ELA A;  3WGX A;  3M9K A;  4OO4 A;  4RI6 A;  5G5F A;  3GMF A;  3H4K A;  3QOU A;  1F9M A;  2H66 A;  3DGQ A;  1TJD A;  3Q74 A;  4KND A;  5IMD A;  3H1N A;  3TJJ A;  1JZW A;  2LTK A;  2F8A A;  2GSS A;  3IPZ A;  3RAZ A;  4KDU A;  2ALB A;  1ERU A;  2LQQ A;  2F8F A;  2HRF A;  4HI7 A;  1V58 A;  3S9F A;  2E7P A;  4IJI A;  3IV4 A;  2K8S A;  1GTB A;  1HD2 A;  3LYP A;  1MDJ A;  4MJB A;  4PUF C;  1U3I A;  2OE0 A;  2VCQ A;  3V1W A;  5HR1 A;  5HFI A;  2AB6 A;  1MTC A;  4YQU A;  3EPT A;  3A2W A;  3G7I A;  18GS A;  2VD1 A;  3APO A;  1TU8 A;  3HD5 A;  1N2A A;  4TR1 A;  2FA8 A;  5EVO A;  2YV9 A;  2LJR A;  3KM6 A;  2AYT A;  4L0W A;  4KDX A;  1PX7 A;  4PNF A;  3ERF A;  1XFL A;  4DSQ A;  4KX4 A;  4TRX A;  2OA7 A;  4V2M A;  3I6A A;  3EMX A;  5D96 A;  2OE3 A;  16GS A;  2GVP A;  1VGL A;  1MDK A;  1EEJ A;  2FD3 A;  3TKS A;  2R0G A;  1TW9 A;  4J2F A;  2DJ1 A;  2DLX A;  2B5X A;  2IMD A;  3N9J A;  4MDC A;  4HU9 A;  1SJ6 A;  4F03 A;  1X5C A;  2HZE B;  1VF4 A;  2LQO A;  1ABA A;  3TKQ A;  1YF0 A;  1FAA A;  1WOU A;  1WWJ A;  1YF1 A;  3DIE A;  2I81 A;  3Q19 A;  1V9W A;  2P0G A;  1EGR A;  1K3L A;  3GN3 A;  3KH7 A;  4BWS A;  3OR5 A;  2V1M A;  4BL7 A;  1GWC A;  1KEB A;  1AIU A;  5L71 A;  1AAZ A;  2CAI A;  4KB3 A;  5ELG A;  5GZZ B;  1SKW B;  1PKW A;  2J23 A;  4WR5 A;  5JWR B;  4Q5F A;  3D5J A;  3HXS A;  2K6V A;  3UJ1 A;  11GS A;  2VCW A;  1TK5 B;  3KJY A;  3FZ5 A;  5IMF A;  1B4P A;  4IP6 A;  1RQM A;  4IJ3 A;  1G0T A;  3HZ8 A;  3D6I A;  3APQ A;  2I9H A;  4ZBB A;  4XCS A;  1ZMA A;  2VOC A;  1HNB A;  1WJK A;  4XRA A;  3GTU B;  3L9V A;  3VFI A;  3FZ9 A;  4EL1 A;  3GX0 A;  4RQX A;  2GTU A;  4F9Z A;  2IPA A;  1SKR B;  3VWW A;  5IOX A;  1X9W B;  3GL3 A;  3TOT A;  3BOA A;  3QAG A;  3GKM A;  3TKS E;  3QFA C;  1GH2 A;  3U6V A;  1FVJ A;  5CP1 A;  4L5O A;  5ECL B;  3FR6 A;  4ECI A;  2C3T A;  4BVY B;  1GSU A;  5CRG A;  1PMT A;  2DJ0 A;  3F6D A;  4K2D A;  5IPG A;  4EIQ A;  1A24 A;  5B6M A;  2FWE A;  3W8J A;  5IO2 A;  1SD9 A;  3MDK A;  4OFN A;  3HCZ A;  3KTB A;  2H6Z A;  1QK8 A;  5AIX A;  3M1G A;  3TJF A;  1R5A A;  1GLQ A;  4JR6 A;  2DJK A;  4WBJ A;  4RQR A;  3HJP A;  2CZ3 A;  2FWH A;  5HR3 A;  2JSZ A;  2PVO C;  4HQS A;  3P8W A;  1URM A;  2FWG A;  1Z9H A;  3DD3 A;  4NHZ A;  1X0R A;  4K5R A;  1OC9 A;  3Q6O A;  3IAS 2;  5BRT A;  2E0Q A;  2R4V A;  4POK A;  2O87 A;  1I9D A;  1GNE A;  4I2U A;  2H0H A;  5FHI A;  4PQ1 A;  5J9B A;  3IHG A;  2GDR A;  2LJA A;  2ON7 A;  4Q5N A;  4G10 A;  2D2Z A;  5AIV A;  4Z2T A;  4XHM A;  2VCX A;  2JZT A;  5JWQ B;  1QGV A;  1YY7 A;  2B5E A;  1RW1 A;  2RUF A;  4K0N A;  4MH2 A;  1S3D A;  1FW1 A;  2VUP A;  5AGY A;  3G9B A;  1QFN A;  2O89 A;  5H5R A;  4N30 A;  2IWT A;  1SYR A;  4E8E A;  3CMI A;  3L0H A;  2VL9 A;  1GUM A;  3C1R A;  2FNO A;  4IS0 A;  2RLI A;  3US3 A;  2KP1 A;  1XWG A;  1XWA A;  2H72 A;  2JU5 A;  2CAQ A;  4WBR D;  2E2M A;  3D4M A;  2FA4 A;  4KGI A;  5IIZ A;  1BYE A;  3HZ4 A;  3VLN A;  4MNN A;  1T7P B;  1GSF A;  5INY A;  1TK8 B;  1MDI A; 
#chains in the Genus database with same CATH homology
 1EOH A;  2H1A A;  4TOP A;  1K0M A;  3IE3 A;  1SK2 A;  1PL2 A;  4G0K A;  5A4W A;  2QKE A;  3LOR A;  1PSQ A;  5DJL A;  2AHE A;  2A2S A;  2FUG 2;  2PMT A;  3ERG A;  4N0V A;  1ZOF A;  2QC7 A;  5GAN D;  4TXO B;  3QFB C;  2FLS A;  4MP4 A;  4GCI A;  3A2V A;  1O8W A;  2CT6 A;  2VM2 A;  1R5P A;  4ECB A;  2BTO T;  1ZL9 A;  3HY2 A;  1TU7 A;  2L5O A;  4V2N A;  3VPT A;  4P3Y B;  4MJE A;  1XOB A;  1FB0 A;  3IR4 A;  2G2Q A;  4BA7 A;  4I5Q A;  4ECC A;  2H01 A;  2H73 A;  2EC4 A;  1GSS A;  4YH2 A;  1M9B A;  2YPM A;  5GAP D;  4FYB A;  3O6T A;  1A0R P;  3GL5 A;  1YJ6 A;  1M2B A;  2YV7 A;  3C1S A;  1M7T A;  4FO5 A;  3CTG A;  3GST A;  1SKS B;  3IXR A;  3UVH A;  4EIP A;  2YCD A;  5J9C A;  4ZL8 A;  2WDU A;  4O5U A;  1R26 A;  3GYK A;  2HI7 A;  3GUR A;  3BD2 A;  4FIW A;  3UL3 A;  20GS A;  4MJA A;  4POM A;  5DQY A;  3EIN A;  5CAX A;  2V6K A;  4ZL7 A;  1MEK A;  3I9V 2;  4ID0 A;  2B3S A;  2H8L A;  1GSD A;  2ON5 A;  3A5I A;  3AY8 A;  2H76 A;  2LV3 A;  1ACV A;  1KBN A;  3GNJ A;  3GFK A;  1GSQ A;  5IMZ A;  2ZNM A;  1DBY A;  2IIY A;  2K8V A;  3C8E A;  1PQN A;  2LRN A;  4EF0 A;  1GSE A;  3F3R A;  4KA0 A;  2DJJ A;  2X49 A;  2WRT A;  1GTA A;  2V6O A;  4OFM A;  5G31 A;  2MYG A;  3KEB A;  5COH A;  3RHB A;  1V98 A;  3WGE A;  5JCU A;  2GST A;  4GQF A;  3U5R E;  5KEJ A;  2ZUP A;  3QMX A;  5ECI B;  4HQZ A;  3FZA A;  2EIO A;  1X9S B;  4DSR A;  5DQS A;  3TRQ A;  1J9B A;  3RHC A;  4ZB9 A;  3TRX A;  2GGT A;  1HQO A;  4IHU A;  3IHQ A;  4OMV A;  3VWU A;  4HJ2 A;  2NTO A;  3ZVJ A;  2PWJ A;  4MK3 A;  4NPB A;  3IOS A;  1O6J A;  1Z3E A;  2GZP A;  2LJK A;  3M3M A;  1O85 A;  4V1A g;  3VUR A;  2G0F A;  4TR3 A;  3GIX A;  1XZO A;  2GQK A;  2VL2 C;  1X9M B;  2CX3 A;  3N5O A;  3CSH A;  4YAP A;  1USB A;  3FMW A;  1QMV A;  4HZ2 A;  2BMX A;  2I1U A;  2YWO A;  2X99 A;  3PH9 A;  1Z6M A;  5ECP B;  2C0E A;  3HHV A;  3FRC A;  2P5Q A;  3E9J B;  2CQ9 A;  2DJ3 A;  2XPD A;  2JL4 A;  3RPN A;  2H6Y A;  4G19 A;  2PBJ A;  4OCF A;  1R4W A;  3K8N A;  4EXJ A;  2CVB A;  1YKA A;  2EIQ A;  3GH9 A;  4ML1 A;  5DAL B;  3MWH A;  5ECN B;  4ULX A;  3KP8 A;  1EOG A;  1NW2 A;  4PX1 A;  4J56 E;  1ERT A;  1BX9 A;  19GS A;  1R7H A;  3TDG A;  3FEU A;  5EPF A;  4MMM A;  3Q18 A;  1AUC A;  4A5P A;  2QA1 A;  3LXT A;  2H0G A;  4G0I A;  2X8C A;  1G7O A;  2YP6 A;  2ZCT A;  3C73 A;  3IC4 A;  2B1K A;  4YKF A;  3C71 A;  4CY8 A;  1GTI A;  2H19 A;  2YJ7 A;  1MD3 A;  5G1K A;  1A0F A;  3IAM 2;  4NWY A;  3FKF A;  1T4Z A;  3HVS A;  3J7Y k;  4LMW A;  2YNX A;  4AJ8 A;  5F05 A;  4HS1 A;  1TRS A;  3I43 A;  2GT5 A;  1G7E A;  1EP7 A;  1QQ2 A;  1SEN A;  2GT6 A;  4PUR A;  3ZL5 A;  1W4V A;  1GP1 A;  5DVB A;  1X5E A;  3ISO A;  1A2M A;  2KP2 A;  2FY6 A;  4X4J A;  5KN1 A;  3D4T A;  2WCI A;  2FHE A;  3GUS A;  1ON4 A;  3GSS A;  2IL3 A;  5JWO B;  2IME A;  4JED A;  3IBH A;  3PR8 A;  1WRY A;  4I97 A;  1DE2 A;  4IN0 A;  4MZB A;  1TXX A;  3ZRE A;  1OKT A;  1OKD A;  22GS A;  1MD4 A;  2C3Q A;  1PA3 A;  3F3Q A;  5D9T A;  5B7C A;  2PVQ A;  4H86 A;  1B48 A;  1PN0 A;  1TRW A;  1YQ1 A;  5ECR B;  3HJM A;  3UBK A;  2DKH A;  2HZE A;  4O5R A;  2DJ2 A;  2GS3 A;  1C72 A;  5IO0 A;  1B9X C;  3G7Y A;  2YJH A;  2V41 A;  5IOW A;  4MZW A;  3TUE A;  1PRX A;  2WS2 A;  4J57 E;  5FWG A;  2H75 A;  4L5L A;  4QL9 A;  3HVX A;  2MMO A;  4KF9 A;  3GRX A;  3DVX A;  4YAV A;  3WT2 A;  3D0Z A;  3TRP A;  2IMF A;  3FZ4 A;  1TRV A;  3TJK A;  3GV1 A;  4KAE A;  4CW9 A;  5IMV A;  1V57 A;  4KDY A;  3A3T A;  3FW2 A;  5F0G A;  2DIZ A;  1SD8 A;  5BMU A;  3CBU A;  1EWX A;  4ISD A;  4LMV A;  3GTU A;  3UOM A;  5DDL A;  2QSI A;  5GST A;  10GS A;  4PQH A;  5ECS A;  5D9X A;  1GUL A;  4O32 A;  1PX6 A;  6GSU A;  1IYI A;  4CY6 A;  3RBT A;  3TKS C;  1SYX A;  2IMI A;  3ME8 A;  2DML A;  2WJU A;  12GS A;  2IFQ B;  5DAK B;  5CRD A;  2H1G A;  4Z7X A;  2HSY A;  4BVY A;  4ECJ A;  2TRC P;  2R3X A;  3BJ5 A;  5IQY A;  4PXO A;  1OVN A;  2OJL A;  4MZC A;  1B9Y C;  3DEX A;  2R2J A;  2Z9S A;  2OBK A;  1U88 A;  7GSS A;  1EV9 A;  2YZH A;  2MMA A;  1AW9 A;  3CSJ A;  5CRH A;  2L6C A;  3LWA A;  3DRN A;  2HXK A;  3H8Q A;  4IW9 A;  1O8X A;  1PD2 1;  1Z5Y E;  1Q98 A;  3RPP A;  1SJZ A;  2C3N A;  3QAW A;  5ECO B;  1EGO A;  1AQW A;  5A5K A;  3G7J A;  1LBK A;  5C04 A;  5KN0 A;  1J0F A;  4AJ7 A;  2M46 A;  4E8H A;  1GL8 A;  5J3R A;  2NDO A;  3A5W A;  2PGT A;  3KXO A;  3HDC A;  5G2Z A;  3VI5 A;  1ZYQ B;  2K9F A;  1TOF A;  1DE1 A;  5CRW A;  2DKI A;  4TXV A;  4KUN A;  2WFC A;  3HJO A;  1DSB A;  2KOK A;  5JCW A;  1TP9 A;  3IRA A;  1YDK A;  1SK1 A;  3ZML A;  3O3T A;  1ZZY A;  1X5D A;  4EDZ A;  2C1Y A;  5CRE A;  1T00 A;  4FYU A;  1G7D A;  3APS A;  3KZQ A;  3GA4 A;  3LQ7 A;  2B5Y A;  2I3Y A;  3ZFB A;  1AQV A;  4D73 B;  3QAV A;  2N5F A;  1VF2 A;  5D9V A;  2L59 A;  4G2E A;  3R3E A;  5LCZ A;  4F0B A;  1F37 A;  1AC1 A;  2MBS A;  2HT9 A;  1HNA A;  2A4H A;  1ML6 A;  4K1F A;  3JCM L;  1JZO A;  3RDW A;  1WPI A;  2IN3 A;  1K0N A;  1YEX A;  1XBS A;  6GSY A;  5F06 A;  2VCT A;  3TCO A;  4MCU A;  4PQI A;  3EE2 A;  2DMM A;  2YAN A;  4HOJ A;  2JZS A;  3IDV A;  1NHY A;  2HRN A;  14GS A;  3DYR A;  3MSZ A;  3TB2 A;  4TXO A;  4ZIJ A;  3NZN A;  3EC3 A;  3D21 A;  5G5E A;  1TDI A;  1TKD B;  3E3E A;  1FHE A;  4JU5 A;  5HFG A;  3CRT A;  3IK9 A;  4IGJ A;  2QA2 A;  4XS1 A;  3UIW A;  2X4A A;  4GF0 A;  4IP1 A;  1XW9 A;  4IKH A;  1VRS D;  1CQG A;  2R0P A;  4POB A;  2JZR A;  3EMP A;  3LJR A;  1Z7P A;  4O92 A;  2N5A A;  1ERV A;  5F8B A;  2P5R A;  1J08 A;  1GSY A;  4HZ4 A;  5B6N A;  2JSY A;  3VI7 A;  3CSI A;  4BVX B;  2H30 A;  1HYU A;  5HR2 A;  3GKN A;  4EC0 A;  2C0G A;  2L6D A;  2RUE A;  3D22 A;  1EZK A;  2O8V B;  3FR9 A;  1JZR A;  5DBQ A;  1F2E A;  5CYY A;  3UMA A;  5F07 A;  1GUK A;  4Z2R A;  2HSM A;  1O7U A;  3GX8 A;  1F3A A;  3F9U A;  3F8U A;  3FY7 A;  4ZBA A;  4NAX A;  2VCV A;  1SK0 A;  1ZGN A;  2GSR A;  1NM3 A;  3L9S A;  2I4A A;  1NHO A;  2C80 A;  2A2R A;  3DKS A;  3DXB A;  2L57 A;  3KMN A;  1M2D A;  3KTL A;  2VL2 A;  5D8I A;  2CV4 A;  1K0A A;  2FWF A;  3LEF A;  1U6T A;  5ECH B;  2H0I A;  1GUH A;  4ZIL A;  1K0D A;  1XPV A;  1BG5 A;  1OC3 A;  4Q5Q A;  1TI3 A;  1KNG A;  3EWL A;  3KMO A;  4CDO A;  5IMA A;  3F4T A;  1UVZ A;  1ERW A;  1K3O A;  2O85 A;  3SBC A;  1I5G A;  1B8X A;  4GQC A;  4XS4 B;  3SWL A;  1LJR A;  5CNW A;  1Y25 A;  2CVD A;  1CQH A;  2WB9 A;  4LLR A;  1FO5 A;  4MF7 A;  5ID2 B;  1XWB A;  4EUY A;  1BQ7 A;  1WMJ A;  5KOW A;  3KH9 A;  2J9H A;  4K7I A;  4OFT A;  4ZBD A;  1QXH A;  3CYN A;  4JBB A;  5B8B A;  4MF5 A;  4F2I A;  4X0X A;  4ZB6 A;  2XHF A;  3PGT A;  2H74 A;  2MMN A;  4ML6 A;  2H1D A;  4DSS B;  2KUC A;  3LG6 A;  2XC2 A;  2A2P A;  4N10 A;  3IC8 A;  4NV5 A;  3ERW A;  3H79 A;  2CVK A;  3LXZ A;  2VAF A;  2F9S A;  2B6M A;  4LA1 A;  2VIM A;  1XW6 A;  1YEP A;  4DVC A;  2ES7 A;  2LRC A;  1T4Y A;  5HFK A;  1A8Y A;  1ST9 A;  3TJB A;  1GRX A;  3KGK A;  4HEA 2;  5H5S A;  4ICY A;  1Y6E A;  2X8G A;  3ZFL A;  4K0G A;  5EL8 A;  3UAR A;  3VPQ A;  2QGV A;  4TVE A;  4WF4 A;  2VO4 A;  5IMC A;  4ZXG A;  3FR3 A;  2NBS A;  4X43 A;  4GTU A;  2XBI A;  2NPB A;  1TRU A;  3GKK A;  1ZCP A;  4IQ1 A;  5J5N A;  3TOU A;  2C0F A;  3MAK A;  3BBY A;  1A2J A;  4YQM A;  2IMK A;  4K2X A;  4G9H A;  2OE1 A;  3LSZ A;  1FG4 A;  5DAL A;  2H71 A;  4HU7 A;  2TRX A;  1G6W A;  5GSS A;  3ED3 A;  2MZC A;  1XOA A;  4L0U A;  4I8B A;  2B7J A;  4XS6 A;  2JAC A;  2CZ2 A;  3C7M A;  5J41 A;  1XWK A;  1UC7 A;  1S3C A;  5EY6 A;  3LYK A;  6GST A;  3ZVJ D;  1SL2 B;  1THO A;  4KW6 A;  2TIR A;  4TR0 A;  4TR1 B;  2HZF A;  2GQL A;  3ZTL A;  4IEL A;  4MPG A;  4OD7 A;  1GNW A;  1XVW A;  3F63 A;  3UAP A;  2R5G A;  4EVM A;  1PGT A;  1EP8 A;  4POL A;  3HKR A;  3BCK A;  4FH8 A;  3QPM A;  4EO3 A;  2V2G A;  2WGR A;  4ZB8 A;  2JAD A;  1M2A A;  3MIX A;  4LL4 B;  2CX4 A;  2LS5 A;  3LGC A;  4CHS A;  2LUS A;  4GRF A;  3EU3 A;  1XIY A;  1K3Y A;  2KHP A;  2HYX A;  4NMU A;  4WEY A;  4O7H A;  2C0D A;  2O7K A;  1Q4J A;  2B1L A;  3ZLP A;  1THX A;  4K9Z A;  1TI1 A;  4MF6 A;  2XBQ A;  4TR4 A;  5J4U A;  3F6F A;  1SJI A;  1FVK A;  1K0B A;  3NOF A;  1ILO A;  4BL7 B;  5D93 A;  3TJG A;  3R2Q A;  1K0C A;  4KH7 A;  4NV2 A;  2VLT A;  4BWQ A;  1XXU A;  1OC8 A;  1WIK A;  2E2G A;  3MNG A;  4V2L A;  3W6G A;  5ENU A;  1OYJ A;  3TKP A;  2DIY A;  2LNT A;  2HNL A;  4LL1 B;  1SL0 B;  1TTZ A;  1U3A A;  4JRR A;  3WGD A;  2GSQ A;  3GHA A;  1IYH A;  2R6K A;  2H70 A;  4OWY A;  5ECK B;  1V2A A;  4QQ7 A;  5DCG A;  3DWV A;  2GLR A;  5A4V A;  4BPY A;  2EIR A;  1XCC A;  3J7Y b;  2L5L A;  4KCA A;  2RM6 A;  2X64 A;  4PNG A;  2WUL A;  2GZY A;  3GKX A;  1TK0 B;  5A4U A;  4GWR A;  5LD0 A;  4I2T A;  1K0O A;  3L4N A;  3F4S A;  1BED A;  4G0L A;  3CTF A;  4F82 A;  2IFQ A;  2PU9 C;  5DAK A;  1Z7R A;  1G6Y A;  3FHK A;  2KLX A;  3P7X A;  3ME7 A;  5C00 A;  2RII A;  1T8E B;  4JE1 A;  2NVL A;  3M0F A;  2VLU A;  5ECM B;  1UN2 A;  2GQM A;  1N8J A;  4WF5 A;  2OAD A;  1EV4 A;  1EEM A;  3WD6 A;  1M9A A;  5IPH A;  3M8N A;  3IA1 A;  3VWV A;  2F3M A;  4IVF A;  1GLP A;  3IK7 A;  4PTS A;  2CA8 A;  3CRU A;  5HQP A;  4MPF A;  1O81 A;  3FK8 A;  4F0C A;  1WE0 A;  1LU4 A;  3QCP A;  3DVW A;  2P31 A;  3MYD A;  3UBL A;  4HJM A;  3UEM A;  1PL1 A;  1B4Q A;  5IM9 A;  5D9W A;  5ABR A;  2WZ9 A;  1XWC A;  4MJC A;  3NIV A;  5H5Q A;  2BJX A;  4MAB A;  4KE3 A;  4USS A;  4MLY A;  1OC9 B;  2RM5 A;  2IJY A;  2HRA A;  2MMZ A;  5E4W A;  2C4J A;  2N5B A;  5AIS A;  6GSX A;  3EUR A;  1JLW A;  1OE7 A;  2H1B A;  3EVI A;  4YKG A;  3ZZX A;  3O76 A;  3TGZ A;  4YQV A;  1RK4 A;  3QDN A;  3PIN A;  4WXT A;  4EE0 A;  1DUG A;  5E59 A;  5ECQ B;  3LW9 A;  4PUA A;  4X1U A;  3ZYW A;  6GSW A;  5B8A A;  4GSS A;  4K7O A;  2YZU A;  2UZ8 A;  1ZYP A;  4AJ6 A;  4FQU A;  2AUV A;  1A8L A;  2HFD A;  3L78 A;  2R0C A;  1OE8 A;  1S3A A;  2V32 A;  3QR6 A;  4K5S A;  4WR4 A;  4AGS A;  1GTU A;  3M9J A;  2AV4 A;  4NHW A;  4D73 A;  1ZYN A;  2L4C A;  4WET A;  1U87 A;  4PGT A;  2VD0 A;  4WKW A;  5LNK e;  4NXI A;  1BAY A;  5G30 A;  4GSN A;  1FOV A;  3PPU A;  1XW5 A;  3DML A;  4JR4 A;  4EDY A;  4IBP A;  3H93 A;  3EYT A;  1QUW A;  1H75 A;  1T1V A;  4AF2 A;  4EKZ A;  2X8H A;  4XRD A;  2AJQ B;  2PER A;  3P90 A;  1F3B A;  3W8S A;  1FB6 A;  5DCH A;  1YKC A;  3KP9 A;  2DBC A;  5AN1 A;  5HR0 A;  3UVT A;  2FCH A;  1M99 A;  5JCG A;  2VCZ A;  1FOH A;  5FT3 A;  1A23 A;  4ZL9 A;  3HA9 A;  5KOX A;  1PN9 A;  3HVV A;  13GS A;  2A4V A;  4I6X A;  2FGX A;  3ZMK A;  2YOI A;  1VF3 A;  2OBI A;  1H4O A;  4Z2U A;  3L9U A;  4TW5 A;  1PKZ A;  1W89 A;  1JZD A;  4KSM A;  1V40 A;  2H6X A;  2LNS A;  3F4R A;  4MA9 A;  2R37 A;  4HDE A;  3HYP A;  4HUA A;  1E6B A;  4OO5 A;  4BVX A;  2LST A;  3FYG A;  5G1L A;  3WYW A;  1UA5 A;  3I69 A;  1O73 A;  3LFL A;  3TKR A;  3QD9 A;  5CO3 A;  1BJX A;  4Q5R A;  3BCI A;  4ILF A;  2VLV A;  1NSW A;  2GZZ A;  1HNC A;  4O5Q A;  6GSV A;  1AQX A;  4FYC A;  1T3B A;  1JHB A;  2B7K A;  1VF1 A;  2C8U A;  2VM1 A;  2YN1 A;  1ZYE A;  3F0I A;  4GLT A;  8GSS A;  17GS A;  4XTS A;  4DEJ A;  2HE3 A;  3E0U A;  2LEG A;  1AXD A;  2K18 A;  1F6M C;  4OCE A;  2XPE A;  3KIJ A;  4GST A;  3A2X A;  4K7N A;  2L4Q A;  3EU4 A;  2AAW A;  2M80 A;  2DC5 A;  3ZRD A;  4TN8 A;  2PUK C;  3WT1 A;  1E2Y A;  2REM A;  4KSO A;  4GXZ A;  2VL3 A;  1Z6N A;  1OAZ A;  4JZQ A;  2MBT A;  4N0Z A;  3ZIT A;  2F51 A;  2LRT A;  5D73 A;  1KTE A;  1SL1 B;  4XS4 A;  4K6X A;  4MH3 A;  5ID2 A;  3ZIV A;  2M66 A;  3KCM A;  4ACS A;  4TKY A;  5KN2 A;  1WP0 A;  5KN3 A;  2M72 A;  3CXG A;  4N11 A;  1SU9 A;  3GH6 A;  2HSH A;  3ZIJ A;  3VWX A;  4RUV A;  2YWN A;  1M0U A;  9GSS A;  4XIH A;  2PN8 A;  4QL7 A;  4RI7 A;  4DSS A;  4L8E A;  1A2L A;  5DJM A;  1YZX A;  3VK9 A;  2OKA A;  2HRK A;  6GSS A;  4V1A p;  3P2A A;  2PPT A;  1JFU A;  4IQA A;  2LKU A;  2YWI A;  2OAC A;  2HLS A;  1JLV A;  2YWM A;  4KCE A;  1XVQ A;  3KD0 A;  2DSA A;  4K8M A;  5ELA A;  3WGX A;  3M9K A;  4OO4 A;  4RI6 A;  5G5F A;  3GMF A;  3H4K A;  3QOU A;  1F9M A;  2H66 A;  3DGQ A;  1TJD A;  3Q74 A;  4KND A;  5IMD A;  3H1N A;  3TJJ A;  1JZW A;  2LTK A;  2F8A A;  2GSS A;  3IPZ A;  3RAZ A;  4KDU A;  2ALB A;  1ERU A;  2LQQ A;  2F8F A;  2HRF A;  4HI7 A;  1V58 A;  3S9F A;  2E7P A;  4IJI A;  3IV4 A;  2K8S A;  1GTB A;  1HD2 A;  3LYP A;  1MDJ A;  4MJB A;  4PUF C;  1U3I A;  2OE0 A;  2VCQ A;  3V1W A;  5HR1 A;  5HFI A;  2AB6 A;  1MTC A;  4YQU A;  3EPT A;  3A2W A;  3G7I A;  18GS A;  2VD1 A;  3APO A;  1TU8 A;  3HD5 A;  1N2A A;  4TR1 A;  2FA8 A;  5EVO A;  2YV9 A;  2LJR A;  3KM6 A;  2AYT A;  4L0W A;  4KDX A;  1PX7 A;  4PNF A;  3ERF A;  1XFL A;  4DSQ A;  4KX4 A;  4TRX A;  2OA7 A;  4V2M A;  3I6A A;  3EMX A;  5D96 A;  2OE3 A;  16GS A;  2GVP A;  1VGL A;  1MDK A;  1EEJ A;  2FD3 A;  3TKS A;  2R0G A;  1TW9 A;  4J2F A;  2DJ1 A;  2DLX A;  2B5X A;  2IMD A;  3N9J A;  4MDC A;  4HU9 A;  1SJ6 A;  4F03 A;  1X5C A;  2HZE B;  1VF4 A;  2LQO A;  1ABA A;  3TKQ A;  1YF0 A;  1FAA A;  1WOU A;  1WWJ A;  1YF1 A;  3DIE A;  2I81 A;  3Q19 A;  1V9W A;  2P0G A;  1EGR A;  1K3L A;  3GN3 A;  3KH7 A;  4BWS A;  3OR5 A;  2V1M A;  4BL7 A;  1GWC A;  1KEB A;  1AIU A;  5L71 A;  1AAZ A;  2CAI A;  4KB3 A;  5ELG A;  5GZZ B;  1SKW B;  1PKW A;  2J23 A;  4WR5 A;  5JWR B;  4Q5F A;  3D5J A;  3HXS A;  2K6V A;  3UJ1 A;  11GS A;  2VCW A;  1TK5 B;  3KJY A;  3FZ5 A;  5IMF A;  1B4P A;  4IP6 A;  1RQM A;  4IJ3 A;  1G0T A;  3HZ8 A;  3D6I A;  3APQ A;  2I9H A;  4ZBB A;  4XCS A;  1ZMA A;  2VOC A;  1HNB A;  1WJK A;  4XRA A;  3GTU B;  3L9V A;  3VFI A;  3FZ9 A;  4EL1 A;  3GX0 A;  4RQX A;  2GTU A;  4F9Z A;  2IPA A;  1SKR B;  3VWW A;  5IOX A;  1X9W B;  3GL3 A;  3TOT A;  3BOA A;  3QAG A;  3GKM A;  3TKS E;  3QFA C;  1GH2 A;  3U6V A;  1FVJ A;  5CP1 A;  4L5O A;  5ECL B;  3FR6 A;  4ECI A;  2C3T A;  4BVY B;  1GSU A;  5CRG A;  1PMT A;  2DJ0 A;  3F6D A;  4K2D A;  5IPG A;  4EIQ A;  1A24 A;  5B6M A;  2FWE A;  3W8J A;  5IO2 A;  1SD9 A;  3MDK A;  4OFN A;  3HCZ A;  3KTB A;  2H6Z A;  1QK8 A;  5AIX A;  3M1G A;  3TJF A;  1R5A A;  1GLQ A;  4JR6 A;  2DJK A;  4WBJ A;  4RQR A;  3HJP A;  2CZ3 A;  2FWH A;  5HR3 A;  2JSZ A;  2PVO C;  4HQS A;  3P8W A;  1URM A;  2FWG A;  1Z9H A;  3DD3 A;  4NHZ A;  1X0R A;  4K5R A;  1OC9 A;  3Q6O A;  3IAS 2;  5BRT A;  2E0Q A;  2R4V A;  4POK A;  2O87 A;  1I9D A;  1GNE A;  4I2U A;  2H0H A;  5FHI A;  4PQ1 A;  5J9B A;  3IHG A;  2GDR A;  2LJA A;  2ON7 A;  4Q5N A;  4G10 A;  2D2Z A;  5AIV A;  4Z2T A;  4XHM A;  2VCX A;  2JZT A;  5JWQ B;  1QGV A;  1YY7 A;  2B5E A;  1RW1 A;  2RUF A;  4K0N A;  4MH2 A;  1S3D A;  1FW1 A;  2VUP A;  5AGY A;  3G9B A;  1QFN A;  2O89 A;  5H5R A;  4N30 A;  2IWT A;  1SYR A;  4E8E A;  3CMI A;  3L0H A;  2VL9 A;  1GUM A;  3C1R A;  2FNO A;  4IS0 A;  2RLI A;  3US3 A;  2KP1 A;  1XWG A;  1XWA A;  2H72 A;  2JU5 A;  2CAQ A;  4WBR D;  2E2M A;  3D4M A;  2FA4 A;  4KGI A;  5IIZ A;  1BYE A;  3HZ4 A;  3VLN A;  4MNN A;  1T7P B;  1GSF A;  5INY A;  1TK8 B;  1MDI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...