2C0EA

Structure of pdi-related chaperone, wind with his-tag on c-terminus.
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
228
structure length
228
Chain Sequence
CTGCVDLDELSFEKTVERFPYSVVKFDIAYPYGEKHEAFTAFSKSAHKATKDLLIATVGVKDYGELENKALGDRYKVDDKNFPSIFLFKGNADEYVQLPSHVDVTLDNLKAFVSANTPLYIGRDGCIKEFNEVLKNYANIPDAEQLKLIEKLQAKQEQLTDPEQQQNARAYLIYMRKIHEVGYDFLEEETKRLLRLKAGKVTEAKKEELLRKLNILEVFRVHKVTKTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords WINDBEUTEL PROTEIN
publication title Structural Elucidation of the Pdi-Related Chaperone Wind with the Help of Mutants.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 76
structure length 228
sequence length 228
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07749 ERp29 Endoplasmic reticulum protein ERp29, C-terminal domain
A PF07912 ERp29_N ERp29, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1150.12 Mainly Alpha Up-down Bundle Endoplasmic reticulum protein erp29 Endoplasmic reticulum resident protein 29, C-terminal domain 2c0eA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2c0eA01
1ZZYA 1FOVA 2MMZA 3ZIJA 4IP1A 1X5EA 1G7EA 1JLWA 1PX6A 5GSTA 2IFQB 4L0UA 4HOJA 1I9DA 3VWUA 4D73A 1TTZA 1GSEA 4IBPA 3ZRDA 1GSDA 5H5SA 3UEMA 1M0UA 4KGIA 2O8VB 5D9TA 1XFLA 2XPDA 3NIVA 3TKSC 4JR4A 4YAPA 2HRFA 1OKDA 2DMLA 2VUPA 1A2LA 2A4VA 3H8QA 2PUKC 1H75A 3KM6A 5JWQB 1X9WB 2MMAA 2MMOA 4MH2A 4FYUA 1YZXA 5KEJA 2LNTA 1A0FA 2QGVA 1PQNA 3TJBA 5A4UA 2WRTA 3BJ5A 5CAXA 1JZWA 2H1BA 1WWJA 3LXZA 5GAND 2C3TA 2H71A 3L9SA 5ECOB 1SL0B 2H73A 5G1KA 2P5RA 2VCXA 3A2WA 4O32A 5J41A 3GMFA 3IE3A 1BG5A 1TW9A 4K1FA 1O6JA 4K2DA 2AYTA 3D5JA 1EGRA 1FO5A 4ZL8A 4MJCA 1MTCA 4TKYA 3F4TA 1WOUA 2IMFA 1EOGA 2WDUA 4K6XA 2I1UA 3UIWA 3G7JA 4EVMA 3I6AA 5HR3A 4WEYA 4XIHA 2TRCP 4BA7A 2FUG2 3C1RA 2IMEA 4ILFA 2PMTA 3CTFA 4V2LA 1LBKA 4PGTA 2HSHA 3FR3A 1K0MA 4I6XA 2B5YA 2PN8A 3QDNA 3P90A 1ABAA 2N5FA 2REMA 4N0ZA 2GQMA 5HFGA 2J9HA 2D2ZA 2B1KA 1TK8B 4AJ6A 3F4RA 3WD6A 4YQVA 2DJ0A 4EXJA 3ZLPA 4ZB9A 4X1UA 3HKRA 2NDOA 4TXOA 3FK8A 4KW6A 1K0OA 3GX8A 3A2XA 2WULA 4JRRA 5J5NA 1YQ1A 2DMMA 1HNCA 1MD4A 5KN1A 5CRDA 17GSA 4GTUA 1Z3EA 4ZXGA 1SU9A 3IXRA 3GKNA 4IN0A 5G2ZA 2C0FA 1O7UA 3GA4A 1T7PB 1Z7RA 1USBA 3VPQA 3IAM2 4KNDA 3SWLA 3M1GA 3EURA 2IJYA 1THXA 1EEMA 3JCML 2DJ3A 5EL8A 1M99A 4ZB6A 1VF2A 1PGTA 4MF6A 1I5GA 2B7JA 4TR0A 1F37A 3QOUA 4IW9A 5ABRA 5DAKA 4XS6A 1PKZA 1XWCA 2XHFA 1FAAA 3AY8A 1LJRA 4HZ4A 2M80A 1ZMAA 1URMA 2Z9SA 2JSZA 2R2JA 4ZBBA 3C71A 5EVOA 1Z6MA 4NMUA 1XW9A 1A8YA 1DE1A 1E2YA 5IMAA 1W89A 2RM5A 1GTIA 1XWBA 3L9VA 3U5RE 4N10A 3LYPA 5G5EA 4Q5RA 4OWYA 3CTGA 4ID0A 2LS5A 1K0DA 1GWCA 3CBUA 3GTUB 2FY6A 3A5WA 4YAVA 2FWFA 5HR2A 3R2QA 3RDWA 3F3RA 2MBTA 3UBKA 4L5LA 2LJKA 5ECMB 4EDZA 3BBYA 1TK5B 3GYKA 1T00A 3DIEA 2AAWA 2L4QA 3FHKA 12GSA 3KD0A 2RUFA 4IQAA 2MBSA 1OC9A 2E2GA 2GT5A 2LRCA 2V32A 3IAS2 3D6IA 3TRQA 2O87A 2FCHA 4ML1A 5G30A 4RUVA 1AQXA 4J57E 3TRXA 1VF1A 3F3QA 2C1YA 2IMKA 1A23A 4MJBA 5IMFA 1SD9A 3HY2A 2VL2A 4NV2A 1M2BA 2DIZA 2H6YA 5IO0A 3KJYA 10GSA 6GSVA 3NOFA 3GL5A 1ZCPA 1HD2A 3IHQA 3D22A 5JCWA 4PQ1A 5IPGA 4YQMA 3PH9A 1OE8A 2DJ1A 2H19A 2VLUA 2BJXA 3IR4A 1PL2A 5ECSA 5ENUA 1X9SB 4WR5A 5D9WA 3J7Yb 3UVHA 3WGEA 1V9WA 3NZNA 1O8XA 4NV5A 4NHZA 4WF4A 2IWTA 4KCEA 4KB3A 2KP2A 4O7HA 5J9CA 1EZKA 2DJJA 13GSA 1TRWA 1ON4A 1TI3A 2WCIA 3KH7A 4LA1A 1Z7PA 2J23A 4WBRD 2YWIA 1AAZA 4TXOB 3EVIA 1ERTA 4K9ZA 1DUGA 3TJGA 1R4WA 1AXDA 4E8EA 1V98A 1ERWA 1SYRA 3FZAA 5A4WA 2YWMA 1WMJA 2L6CA 1BYEA 2ZNMA 3PR8A 1OVNA 2HZFA 4JEDA 4JR6A 1A2MA 2V6OA 4K7OA 3FR9A 4BVXA 2PPTA 2VCZA 5DCHA 1GLQA 5DJMA 3UL3A 2G2QA 2MYGA 2V41A 3LG6A 4HQZA 4BL7A 5LNKe 1MEKA 3ISOA 4NAXA 3O76A 2GZYA 1GTBA 5LCZA 3BOAA 4CW9A 2L5OA 4I2UA 11GSA 1Z5YE 1SKWB 3KCMA 2WB9A 2VCWA 4ZBDA 1MDIA 3FYGA 2E2MA 4N30A 1F6MC 4LL4B 4YH2A 1B4PA 3WGDA 2DIYA 1SL1B 4H86A 4MMMA 2LV3A 1S3AA 4POLA 4DSSB 2EIOA 3ZZXA 2QC7A 3ERFA 5IMDA 1QQ2A 3F6DA 3E9JB 4KA0A 1B9XC 3FZ5A 5DVBA 1JZOA 3UAPA 4QQ7A 1PMTA 1BAYA 3EMPA 3ME7A 3LORA 2MMNA 2OBIA 4K8MA 2GZZA 5KN0A 3KTBA 2H0GA 4Z7XA 5D73A 2B3SA 2C0DA 2F8AA 1UN2A 4MH3A 1ST9A 3N9JA 2X64A 4K0GA 3HA9A 2L57A 2A2RA 3ERGA 3GRXA 4QL7A 4MPFA 3P8WA 3H4KA 1TU8A 1Z6NA 2CQ9A 3RHCA 4MP4A 4ZB8A 3EC3A 2L59A 1R7HA 1XW5A 3GKXA 3KEBA 2NPBA 3M0FA 5CNWA 4TN8A 5IPHA 2K6VA 2FGXA 3LEFA 1G7OA 5ECLB 5DQYA 4PUAA 3LXTA 5CYYA 1DE2A 8GSSA 1WRYA 3BD2A 1O73A 2QSIA 1XBSA 1OC9B 1HYUA 2XBIA 1O85A 5CREA 4PQHA 4ECIA 4ZIJA 2P5QA 4GSNA 1U3IA 3LYKA 2H1GA 3EE2A 3PINA 4F9ZA 3F63A 4IJIA 4RI6A 2HXKA 2F3MA 1NHYA 4OFTA 3FY7A 3HDCA 3IV4A 4NPBA 3I69A 5E59A 1XVWA 6GSSA 1FHEA 5C04A 3KGKA 3HXSA 1JFUA 2GS3A 3KP9A 1T8EB 2YN1A 3I9V2 2GLRA 4HU9A 2X8HA 4WXTA 3GV1A 4XRAA 2K8VA 4JBBA 2AV4A 1TXXA 4IELA 3GTUA 2B6MA 2ZUPA 3CRUA 5FT3A 1QK8A 5HFIA 2BMXA 5J3RA 1TK0B 4ACSA 1K0BA 1X9MB 1NM3A 1IYIA 1TP9A 3Q74A 4ZBAA 6GSXA 4WF5A 3EINA 1SD8A 3EWLA 4EUYA 2X8GA 3EMXA 3APQA 3GH9A 3CSHA 3QPMA 2JZRA 2L5LA 3ZITA 3QAVA 4MJEA 4TVEA 2H0HA 3C8EA 22GSA 1SKRB 3TGZA 4KSOA 4PUFC 1GUHA 1PKWA 2H0IA 3L9UA 1UVZA 4V1Ag 2NVLA 3PGTA 1OKTA 1A8LA 4BWSA 2VL3A 2DLXA 2I9HA 1TRUA 3Q19A 1G6YA 1W4VA 2GVPA 1OYJA 4OFMA 2HRNA 4G2EA 4XHMA 5ECPB 3RPPA 2PWJA 3KIJA 4HQSA 2VLVA 3RBTA 4YQUA 2VL2C 2LKUA 2JADA 2R37A 5J9BA 1YJ6A 3TKSE 2I3YA 1YEPA 3LGCA 5AIXA 5DJLA 3O3TA 2CVDA 2OE3A 1XZOA 3KMNA 2DJKA 3HYPA 1JZRA 4V2MA 5ECIB 3M9JA 1SJZA 2C8UA 1WPIA 1OC3A 1V58A 2AUVA 3KMOA 1K0NA 4BWQA 1XOAA 1XXUA 4GSSA 3L4NA 5AIVA 5F05A 5HQPA 3KZQA 2YP6A 3KTLA 2ZCTA 3HD5A 18GSA 2IMDA 4XRDA 3EYTA 5D9XA 3H93A 3RAZA 2LEGA 4OD7A 3TCOA 1YF0A 2H1DA 2I81A 4K7NA 1TDIA 3TB2A 4HU7A 2I4AA 4MK3A 3TJJA 3GKMA 2CAIA 2QKEA 4O92A 3KXOA 5KN2A 1PSQA 4K0NA 3LWAA 5IMVA 4E8HA 3APOA 1EV9A 3W8JA 2FWHA 4IHUA 5CRHA 3FEUA 4F0CA 2ES7A 3GURA 4DSSA 4KE3A 2VD0A 1T1VA 4LLRA 3QFAC 2P31A 1CQHA 3F0IA 1SKSB 2LSTA 2C3NA 2KP1A 1HNAA 4X0XA 3WT1A 2OADA 1QFNA 2OACA 3UMAA 4AGSA 4PXOA 2ON5A 4TR3A 2VAFA 5DDLA 1PRXA 1F3BA 3E3EA 5ID2B 1GNWA 2O7KA 4FIWA 4IKHA 3V1WA 9GSSA 1B48A 1EGOA 1K0AA 2IN3A 1AQVA 3EU4A 1GSYA 1KTEA 3LFLA 4ECJA 6GSUA 2ALBA 1BX9A 3QD9A 1AW9A 1J08A 4BVYA 1FB0A 1PL1A 2VM2A 2RM6A 2G0FA 1WP0A 5H5QA 2YZUA 2WJUA 1GSUA 2VD1A 2AHEA 1ZYQB 2P0GA 2YNXA 2CAQA 3IK7A 2RUEA 4QL9A 4POKA 2GGTA 2HI7A 2VL9A 1XWAA 2VLTA 3GKKA 2R4VA 4L5OA 2C0EA 4ECCA 3ZL5A 1ZYEA 2V6KA 4LL1B 1ACVA 1R26A 2JACA 3DMLA 1GP1A 4MF7A 2CX4A 2NTOA 1K3YA 3TKRA 1XPVA 3VWWA 5FHIA 3GN3A 2XPEA 3UARA 2M72A 4DVCA 1CQGA 1A2JA 3CXGA 2H76A 1U6TA 3I43A 3BCKA 4KX4A 3HJMA 1PD21 3DRNA 1DBYA 2YANA 2N5BA 4OMVA 1PN9A 4RQRA 1TJDA 1U3AA 3MDKA 5B6MA 2KOKA 5G31A 3APSA 1NSWA 3ME8A 1M9AA 5CRGA 3IK9A 1N8JA 3J7Yk 4RI7A 4TW5A 3RPNA 3UVTA 5IOWA 1T4ZA 2B5XA 4V1Ap 1EV4A 1K3LA 2FWEA 7GSSA 4GCIA 4HS1A 1YDKA 5JWOB 4OO4A 3L78A 1TU7A 5GSSA 3G7YA 3GIXA 2GSRA 1ILOA 3HVVA 1XWGA 2KLXA 1JZDA 4K7IA 3UJ1A 3GX0A 3A2VA 1H4OA 1Y6EA 2LQOA 3CRTA 1EOHA 14GSA 1ZL9A 3TUEA 3TJKA 3FKFA 5D8IA 2B1LA 2R6KA 2XBQA 1XVQA 2N5AA 4OCEA 5COHA 1DSBA 2FHEA 2F9SA 4I2TA 5JWRB 3VLNA 2NBSA 3ZFLA 2HFDA 1ERVA 3DD3A 3KP8A 3MAKA 4EKZA 2GDRA 1QGVA 5AISA 5KN3A 1SK2A 1N2AA 1OC8A 2PVQA 3CYNA 1RQMA 2X8CA 4F2IA 2OJLA 1YKCA 1WJKA 3IBHA 1J0FA 1XW6A 1IYHA 1MDJA 2OA7A 4BPYA 1J9BA 1TKDB 1WIKA 5J4UA 2H72A 2PU9C 3P2AA 4AF2A 2CT6A 5GZZB 4FO5A 6GSYA 1A24A 4HJMA 2X99A 5B6NA 5D9VA 3TJFA 1ML6A 3F8UA 3CMIA 1X5CA 3M8NA 2B5EA 2WZ9A 1WE0A 3C73A 1ZGNA 4J56E 4WR4A 3W8SA 2V1MA 4EF0A 3TRPA 4V2NA 5AN1A 1BQ7A 1KNGA 4CHSA 1U88A 5JCGA 4POBA 4IGJA 1FVJA 1R5AA 2H66A 5HR0A 1KBNA 4CDOA 3VK9A 5A4VA 1F2EA 4PX1A 5AGYA 5DCGA 1G7DA 2CZ2A 3H1NA 3L0HA 2LJRA 4MABA 1G6WA 5D93A 5D96A 2FLSA 2HZEA 4P3YB 3US3A 2K18A 1LU4A 2OBKA 3HHVA 1SYXA 5ECNB 3S9FA 1QMVA 4POMA 5CRWA 4F0BA 4GLTA 4ECBA 2BTOT 2C3QA 3VFIA 2L6DA 4ML6A 3DVWA 1F9MA 1RK4A 1GULA 3DVXA 5DALA 3IRAA 5ID2A 1V57A 3ZFBA 4PNFA 4XS4A 4IS0A 5IIZA 3IPZA 3M9KA 3F6FA 3C7MA 2CX3A 1Q4JA 1U87A 3OR5A 4IJ3A 3QFBC 3U6VA 2YJ7A 3DEXA 1HQOA 3G7IA 3LJRA 4KDUA 2KHPA 4TOPA 4Q5NA 2GSTA 1O81A 5F07A 5H5RA 4L0WA 3QAGA 5ECKB 4MDCA 1GNEA 4WBJA 4X43A 3HZ4A 5EPFA 4EE0A 3N5OA 4WETA 3VURA 1GRXA 2IPAA 1Z9HA 4PNGA 4PQIA 4HI7A 3HZ8A 3CSJA 3FZ9A 4OCFA 2LTKA 3UOMA 1SJ6A 4LMVA 1ZOFA 4TXVA 3ZIVA 1PA3A 3HJPA 4OFNA 3SBCA 2H8LA 2CA8A 1GTUA 4KDXA 4I8BA 3UBLA 4MZBA 4AJ7A 1VF3A 4NWYA 4TRXA 2YPMA 4ULXA 3LQ7A 19GSA 1XIYA 1GSQA 3KH9A 5G1LA 2VIMA 3Q18A 2JL4A 1XWKA 1OE7A 4XS1A 4PURA 2HYXA 4EO3A 1EWXA 2C0GA 2OE0A 2JU5A 3FRCA 5ELGA 3MNGA 4O5RA 1GL8A 2H6XA 3ZREA 4EL1A 4G9HA 3DGQA 2PBJA 1RW1A 3H79A 4J2FA 2H6ZA 2YJHA 1R5PA 1S3CA 2L4CA 1F3AA 1V2AA 2TIRA 1GUMA 2FNOA 2OKAA 5F06A 1K0CA 4HDEA 3O6TA 2AJQB 1Y25A 2YV7A 4MZWA 2VM1A 3MWHA 4KAEA 3BCIA 4I97A 4KCAA 3ZMLA 3VI5A 3D0ZA 1GUKA 4XCSA 1VF4A 2E0QA 2B7KA 5HFKA 3DKSA 5IQYA 2GQKA 3IDVA 1VRSD 4IP6A 5ECRB 1SK1A 3VWXA 1GH2A 3HJOA 4JZQA 1KEBA 5JCUA 2HSYA 1FB6A 4IVFA 2VOCA 5ECQB 3M3MA 3TOUA 1K3OA 3D4TA 4MLYA 1QXHA 4G10A 3ZTLA 2E7PA 2HZEB 2CVBA 5F8BA 3C1SA 1VGLA 3CSIA 2H30A 5DBQA 3MSZA 20GSA 4Q5FA 1G0TA 1MDKA 4HZ2A 5B8AA 5DALB 5B7CA 3W6GA 5FWGA 2DC5A 2CVKA 4D73B 4XS4B 1Q98A 4GQCA 2YZHA 3IOSA 1GSFA 2O85A 3TKSA 2DSAA 2YCDA 2CV4A 4GXZA 3TKQA 4FYBA 4GQFA 1M2AA 4ZILA 3K8NA 2CZ3A 4DSRA 5DQSA 2VCQA 3GHAA 2GZPA 4Q5QA 2C4JA 2MZCA 4TR1A 1ERUA 5IO2A 1YEXA 3TOTA 4MA9A 6GSTA 1T4YA 3VI7A 4FH8A 2EC4A 3QMXA 5C00A 3IA1A 3GL3A 5B8BA 1O8WA 2LNSA 1GSSA 3GUSA 1BEDA 1JLVA 2H70A 3G9BA 2GSQA 4AJ8A 1SJIA 4RQXA 3DXBA 5F0GA 2RLIA 2HNLA 2C80A 1T3BA 3ZVJA 2FWGA 2LRTA 4WKWA 2JZTA 5G5FA 4ZL9A 1FG4A 3IC4A 2EIQA 3QAWA 2EIRA 5ELAA 4TR4A 4MJAA 2IFQA 1YKAA 3TKPA 2VCVA 1E6BA 4JU5A 3ZMKA 4KDYA 1HNBA 3ERWA 5L71A 3D21A 3F4SA 2O89A 1TRVA 3FZ4A 1SENA 2VCTA 4N0VA 3HVXA 3EU3A 1XCCA 5EY6A 4OO5A 4GF0A 1AIUA 4EC0A 2IMIA 1AUCA 4ISDA 5IM9A 1SK0A 3GSTA 2PERA 3WGXA 3F9UA 1FVKA 1GLPA 1B8XA 2YWNA 2R5GA 2H01A 2GSSA 3LSZA 4DEJA 1FW1A 4IQ1A 2IIYA 1PX7A 2HT9A 4N11A 2XC2A 2H74A 2OE1A 3FR6A 3GFKA 2K8SA 2R3XA 1C72A 2AB6A 4XTSA 2TRXA 5A5KA 1AQWA 2LJAA 3Q6OA 3TDGA 6GSWA 3GNJA 4F82A 1S3DA 3GSSA 2RIIA 1MD3A 2M46A 1XOBA 4LMWA 4GRFA 1SL2B 5ECHB 4MZCA 1YY7A 1TI1A 4ZL7A 3A3TA 2H75A 2GQLA 3WYWA 5CP1A 2HLSA 4HEA2 4MPGA 4MF5A 2F8FA 1M2DA 2HE3A 5IOXA 2H1AA 3FW2A 4F03A 3HVSA 2JZSA 5CO3A 3P7XA 16GSA 2GTUA 3RHBA 1NHOA 2A2SA 3QCPA 5IMZA 3VWVA 5DAKB 4DSQA 1TOFA 2FA8A 3QR6A 1NW2A 2ON7A 1QUWA 2YV9A 1X0RA 3D4MA 2GT6A 2DBCA 4FYCA 2JSYA 4L8EA 2DJ2A 5IMCA 1OAZA 4HUAA 1V40A 5LD0A 1EEJA 1B4QA 2YWOA 4NXIA 4GSTA 2M66A 4HJ2A 1YF1A 1M9BA 3WT2A 1UA5A 1TRSA 2WS2A 2V2GA 1EP7A 1JHBA 3DWVA 5HR1A 2PVOC 5INYA 5E4WA 2YOIA 2LQQA 4TR1B 1B9YC 3ZYWA 4NHWA 4MCUA 1BJXA 4KH7A 3VPTA 4KSMA 1GTAA 2FD3A 4KUNA 1X5DA 3ZVJD 2IL3A 2LRNA 1M7TA 2WFCA 4GWRA 2LUSA 5GAPD 2KUCA 2VO4A 4I5QA 2K9FA 3GH6A 2PGTA 1AC1A 3DYRA 1EP8A 2WGRA 1A0RP 3HCZA 1UC7A 3ED3A 4JE1A 4EDYA 4G19A 2FA4A 1THOA 3E0UA 2F51A
chains in the Genus database with same CATH superfamily
1ZZYA 1FOVA 2MMZA 3ZIJA 4IP1A 1X5EA 1G7EA 1JLWA 1PX6A 5GSTA 2IFQB 4L0UA 4HOJA 1I9DA 3VWUA 2X4AA 4D73A 1TTZA 1GSEA 4IBPA 3ZRDA 1GSDA 2A4HA 5H5SA 3UEMA 1M0UA 4KGIA 2O8VB 5D9TA 1XFLA 2XPDA 3NIVA 3TKSC 4JR4A 4YAPA 2HRFA 1OKDA 2DMLA 3EPTA 2VUPA 1A2LA 2A4VA 3H8QA 2PUKC 1H75A 3KM6A 5JWQB 1X9WB 2MMAA 2MMOA 4MH2A 4FYUA 1YZXA 5KEJA 2LNTA 4X4JA 1A0FA 2QGVA 1PQNA 3TJBA 5A4UA 2WRTA 3BJ5A 5CAXA 1JZWA 2H1BA 1WWJA 3LXZA 5GAND 2C3TA 2H71A 3L9SA 4PTSA 5ECOB 1SL0B 2H73A 5G1KA 2P5RA 2VCXA 3A2WA 4O32A 5J41A 3GMFA 3IE3A 1BG5A 1TW9A 4K1FA 1O6JA 4K2DA 2AYTA 3D5JA 1EGRA 4K2XA 1FO5A 4ZL8A 4BL7B 4MJCA 1MTCA 4TKYA 3F4TA 1WOUA 2IMFA 1EOGA 2WDUA 4K6XA 2I1UA 3UIWA 3G7JA 4USSA 4EVMA 3I6AA 5HR3A 4WEYA 4XIHA 2TRCP 4BA7A 2FUG2 3C1RA 2IMEA 4BIKA 4ILFA 2PMTA 3CTFA 4V2LA 1LBKA 4PGTA 2HSHA 3FR3A 1K0MA 4I6XA 2B5YA 2PN8A 3QDNA 3P90A 1ABAA 2N5FA 2REMA 4N0ZA 2GQMA 5KOXA 5HFGA 2J9HA 2D2ZA 2B1KA 1TK8B 4AJ6A 3F4RA 3WD6A 4YQVA 2DJ0A 4EXJA 3ZLPA 3IHGA 4ZB9A 4X1UA 3HKRA 2NDOA 4TXOA 3FK8A 4KW6A 1K0OA 3GX8A 4A5PA 3A2XA 2WULA 4JRRA 5J5NA 1YQ1A 2DMMA 1HNCA 1MD4A 3PPUA 5KN1A 5CRDA 17GSA 4GTUA 1Z3EA 4ZXGA 2QA2A 1SU9A 3IXRA 3GKNA 4IN0A 5G2ZA 2C0FA 1O7UA 3GA4A 1T7PB 1Z7RA 1USBA 3VPQA 3IAM2 4KNDA 3SWLA 3M1GA 3EURA 2IJYA 1THXA 1EEMA 3JCML 2DJ3A 5EL8A 1M99A 4ZB6A 1VF2A 1PGTA 4MF6A 2HSMA 1I5GA 2B7JA 4TR0A 1F37A 3QOUA 4IW9A 5ABRA 5DAKA 4XS6A 1PKZA 1XWCA 2XHFA 1FAAA 3AY8A 1LJRA 4HZ4A 2M80A 4CY8A 1ZMAA 1URMA 2Z9SA 2JSZA 2R2JA 4ZBBA 3C71A 5EVOA 1Z6MA 4NMUA 1XW9A 1A8YA 1DE1A 1E2YA 5IMAA 1W89A 2RM5A 1GTIA 1XWBA 3L9VA 3U5RE 4N10A 3LYPA 5G5EA 4Q5RA 4OWYA 3CTGA 4ID0A 3FMWA 2LS5A 1K0DA 1GWCA 3CBUA 3GTUB 2FY6A 3A5WA 4YAVA 2FWFA 5HR2A 4G0IA 3R2QA 3RDWA 3F3RA 2MBTA 3UBKA 4L5LA 2LJKA 5ECMB 4EDZA 4EIPA 3BBYA 1TK5B 3GYKA 1T00A 3DIEA 2AAWA 4HSCX 2L4QA 3FHKA 12GSA 3KD0A 2RUFA 4IQAA 2MBSA 1OC9A 2E2GA 2GT5A 2LRCA 2V32A 3IAS2 3D6IA 3TRQA 2O87A 5KOWA 2FCHA 4ML1A 5G30A 4RUVA 1AQXA 4J57E 3TRXA 1VF1A 3F3QA 2C1YA 2IMKA 1A23A 4MJBA 1M3JA 5IMFA 1SD9A 3HY2A 2VL2A 4NV2A 1M2BA 2DIZA 2H6YA 5IO0A 3KJYA 2DKHA 10GSA 6GSVA 3NOFA 3GL5A 1ZCPA 2HRKA 1HD2A 3IHQA 3D22A 5JCWA 4PQ1A 5IPGA 4YQMA 1PFOA 3PH9A 1OE8A 2DJ1A 2H19A 2VLUA 2BJXA 3IR4A 1PL2A 5ECSA 5ENUA 1X9SB 4WR5A 5D9WA 3J7Yb 3UVHA 3WGEA 1V9WA 3NZNA 1O8XA 4NV5A 4NHZA 4WF4A 2IWTA 4KCEA 4KB3A 2KP2A 4O7HA 5J9CA 1EZKA 2DJJA 13GSA 1TRWA 1ON4A 1TI3A 2WCIA 3KH7A 4ICYA 4LA1A 1Z7PA 2J23A 4WBRD 2YWIA 1AAZA 4TXOB 3EVIA 1ERTA 4K9ZA 1DUGA 3TJGA 1R4WA 1AXDA 4E8EA 1V98A 1ERWA 1SYRA 3FZAA 5A4WA 2YWMA 2UZ8A 1WMJA 2L6CA 1BYEA 2ZNMA 3PR8A 1OVNA 2HZFA 4JEDA 4JR6A 1A2MA 2V6OA 4K7OA 3FR9A 4BVXA 2PPTA 2VCZA 5DCHA 1GLQA 5DJMA 3UL3A 2G2QA 2MYGA 2V41A 3LG6A 4HQZA 4BL7A 5LNKe 1MEKA 3ISOA 4NAXA 3O76A 2GZYA 1GTBA 5LCZA 3BOAA 4CW9A 2L5OA 4I2UA 11GSA 1Z5YE 1SKWB 3KCMA 2WB9A 2VCWA 4ZBDA 1MDIA 3FYGA 2E2MA 4N30A 1F6MC 4LL4B 4YH2A 1B4PA 3WGDA 2DIYA 1SL1B 4H86A 4MNNA 4MMMA 2LV3A 1S3AA 4POLA 4DSSB 2EIOA 3ZZXA 4O5UA 2QC7A 3ERFA 5IMDA 1QQ2A 3F6DA 3E9JB 4KA0A 1B9XC 3FZ5A 5DVBA 1JZOA 3UAPA 4QQ7A 1PMTA 1BAYA 3EMPA 3ME7A 3LORA 2MMNA 2OBIA 4K8MA 2GZZA 5KN0A 3KTBA 2H0GA 4Z7XA 5D73A 2B3SA 2C0DA 2F8AA 1PN0A 1UN2A 4MH3A 1ST9A 3N9JA 2X64A 4K0GA 3HA9A 2L57A 2A2RA 3ERGA 3GRXA 4QL7A 4Z2TA 4MPFA 3P8WA 3H4KA 1TU8A 1Z6NA 2CQ9A 3RHCA 4MP4A 4ZB8A 3EC3A 2L59A 1R7HA 1XW5A 3GKXA 3KEBA 2NPBA 3M0FA 5CNWA 1ZYPA 4TN8A 3MYDA 5IPHA 2K6VA 2FGXA 3LEFA 1G7OA 5ECLB 5DQYA 4PUAA 3LXTA 5CYYA 1DE2A 8GSSA 1WRYA 3BD2A 1O73A 2QSIA 1XBSA 1OC9B 1HYUA 2XBIA 4G0KA 3MIXA 1O85A 5CREA 4PQHA 4ECIA 4G0LA 4ZIJA 2P5QA 4GSNA 1U3IA 3LYKA 2H1GA 3EE2A 3PINA 4F9ZA 3F63A 4IJIA 4RI6A 2HXKA 2F3MA 1NHYA 4OFTA 3FY7A 3HDCA 3IV4A 4NPBA 3I69A 5E59A 1XVWA 6GSSA 1FHEA 5C04A 4Z2RA 3KGKA 3HXSA 1JFUA 2GS3A 3KP9A 1T8EB 2YN1A 3I9V2 2GLRA 4HU9A 2X8HA 4WXTA 3GV1A 4XRAA 2K8VA 4JBBA 2AV4A 1TXXA 4IELA 3GTUA 2B6MA 2ZUPA 3CRUA 5FT3A 1QK8A 5HFIA 2BMXA 5J3RA 1TK0B 4ACSA 1K0BA 1X9MB 1NM3A 1IYIA 1TP9A 3Q74A 4ZBAA 6GSXA 4K5SA 4WF5A 3EINA 1SD8A 3EWLA 4EUYA 2X8GA 3EMXA 3APQA 3GH9A 3CSHA 3QPMA 2JZRA 2L5LA 3ZITA 3QAVA 4MJEA 4TVEA 2H0HA 3C8EA 22GSA 1SKRB 3TGZA 2R0PA 4KSOA 4PUFC 1GUHA 1PKWA 2H0IA 3L9UA 1UVZA 4V1Ag 2NVLA 3PGTA 1OKTA 5BRTA 1A8LA 4BWSA 2VL3A 2DLXA 2I9HA 1TRUA 3Q19A 1G6YA 1W4VA 4BVXB 2GVPA 1OYJA 4OFMA 2HRNA 4G2EA 4XHMA 5ECPB 3RPPA 2PWJA 3KIJA 4HQSA 2VLVA 3RBTA 4YQUA 2VL2C 2LKUA 2JADA 2R37A 5J9BA 1YJ6A 3TKSE 2I3YA 1YEPA 3LGCA 5AIXA 5DJLA 3O3TA 2CVDA 2OE3A 1XZOA 3KMNA 2DJKA 2DKIA 3HYPA 1JZRA 4V2MA 5ECIB 3M9JA 1SJZA 2C8UA 1WPIA 1OC3A 1V58A 2AUVA 3KMOA 1K0NA 4BWQA 1XOAA 1XXUA 4GSSA 4K5RA 3L4NA 5AIVA 5F05A 5HQPA 3KZQA 2YP6A 3KTLA 2ZCTA 3HD5A 18GSA 2IMDA 4XRDA 3EYTA 5D9XA 3H93A 3RAZA 2LEGA 4OD7A 3TCOA 1YF0A 2H1DA 2I81A 4K7NA 1TDIA 3TB2A 4HU7A 2I4AA 4MK3A 1FOHA 3TJJA 3GKMA 2CAIA 2QKEA 4O92A 3KXOA 5KN2A 2R0CA 1PSQA 4K0NA 3LWAA 5IMVA 4E8HA 3APOA 1EV9A 3W8JA 2FWHA 4IHUA 5CRHA 3FEUA 4F0CA 2ES7A 3GURA 4DSSA 4KE3A 2VD0A 1T1VA 3R3EA 4LLRA 3QFAC 2P31A 1CQHA 3F0IA 1SKSB 2LSTA 2C3NA 2KP1A 1HNAA 4X0XA 3WT1A 2OADA 1QFNA 2OACA 3UMAA 4AGSA 4PXOA 2ON5A 4TR3A 2VAFA 5DDLA 1PRXA 1F3BA 3E3EA 5ID2B 1GNWA 2O7KA 4FIWA 4IKHA 3V1WA 9GSSA 1B48A 1EGOA 1K0AA 2IN3A 1AQVA 3EU4A 1GSYA 1KTEA 3LFLA 4ECJA 6GSUA 2ALBA 1BX9A 3QD9A 1AW9A 1J08A 4BVYA 1FB0A 1PL1A 2VM2A 2RM6A 2G0FA 1WP0A 5H5QA 2YZUA 2WJUA 1GSUA 2VD1A 2AHEA 1ZYQB 2P0GA 2YNXA 2CAQA 3IK7A 2RUEA 4QL9A 4POKA 2GGTA 2HI7A 2VL9A 1XWAA 2VLTA 3GKKA 2R4VA 4L5OA 2C0EA 4ECCA 3ZL5A 1ZYEA 2V6KA 4LL1B 1ACVA 1R26A 2JACA 3DMLA 1GP1A 4MF7A 2CX4A 2NTOA 1K3YA 3TKRA 1XPVA 3VWWA 5FHIA 3GN3A 2XPEA 3UARA 2M72A 4DVCA 1CQGA 1A2JA 3CXGA 2H76A 1U6TA 3I43A 3BCKA 4KX4A 3HJMA 1PD21 3DRNA 1DBYA 2YANA 2N5BA 4OMVA 1PN9A 4RQRA 1TJDA 1U3AA 3MDKA 5B6MA 2KOKA 5G31A 3APSA 2HRAA 1NSWA 3ME8A 1M9AA 5CRGA 3IK9A 1N8JA 3J7Yk 4RI7A 4TW5A 3RPNA 3UVTA 5IOWA 1T4ZA 2B5XA 4V1Ap 1EV4A 1K3LA 2FWEA 7GSSA 4GCIA 4HS1A 1YDKA 5JWOB 1M3IA 4OO4A 3L78A 1TU7A 5GSSA 3G7YA 3GIXA 2GSRA 1ILOA 3HVVA 1XWGA 2KLXA 1JZDA 4K7IA 3UJ1A 3GX0A 3A2VA 1H4OA 1Y6EA 2LQOA 3CRTA 1EOHA 14GSA 1ZL9A 3TUEA 3TJKA 3FKFA 5D8IA 2B1LA 2R6KA 2XBQA 1XVQA 4O5QA 2N5AA 4OCEA 5COHA 1DSBA 2FHEA 2F9SA 4I2TA 5JWRB 3VLNA 2NBSA 3ZFLA 2HFDA 1ERVA 3DD3A 3KP8A 3MAKA 4EKZA 2GDRA 1QGVA 5AISA 5KN3A 1SK2A 1N2AA 1S3RA 1OC8A 2PVQA 3CYNA 1RQMA 2R0GA 2X8CA 4F2IA 2OJLA 1YKCA 1WJKA 3IBHA 1J0FA 1XW6A 1IYHA 1MDJA 2OA7A 4BPYA 1J9BA 1TKDB 1WIKA 5J4UA 2H72A 2PU9C 3P2AA 4AF2A 2CT6A 5GZZB 4FO5A 6GSYA 1A24A 4HJMA 2X99A 5B6NA 5D9VA 3TJFA 1ML6A 3F8UA 3CMIA 1X5CA 3M8NA 2B5EA 2WZ9A 1WE0A 3C73A 4BVYB 1ZGNA 4J56E 4WR4A 3W8SA 2V1MA 4EF0A 3TRPA 3LW9A 4V2NA 5AN1A 1BQ7A 1KNGA 4CHSA 1U88A 5JCGA 4POBA 4IGJA 1FVJA 1R5AA 2H66A 5HR0A 2X49A 1KBNA 4CDOA 3VK9A 5A4VA 1F2EA 4PX1A 5AGYA 5DCGA 1G7DA 2CZ2A 3H1NA 4Z2UA 3L0HA 2LJRA 4MABA 1G6WA 5D93A 5D96A 2FLSA 2HZEA 4P3YB 3US3A 2K18A 1LU4A 2OBKA 3HHVA 1SYXA 5ECNB 3S9FA 1QMVA 4POMA 4CY6A 5CRWA 4F0BA 4GLTA 4ECBA 2BTOT 2C3QA 3VFIA 2L6DA 4ML6A 3DVWA 1F9MA 1RK4A 1GULA 3DVXA 5DALA 3IRAA 5ID2A 1V57A 3ZFBA 4PNFA 4XS4A 4IS0A 5IIZA 3IPZA 3M9KA 3F6FA 3C7MA 2CX3A 1Q4JA 1U87A 3OR5A 4IJ3A 3QFBC 3U6VA 2YJ7A 3DEXA 1HQOA 1XG8A 3G7IA 3LJRA 4KDUA 2KHPA 4TOPA 4Q5NA 2GSTA 1O81A 5F07A 5H5RA 4L0WA 3QAGA 5ECKB 1ZYNA 4MDCA 1GNEA 4WBJA 4X43A 3HZ4A 5EPFA 4EE0A 3N5OA 4WETA 3VURA 1GRXA 3CQFA 2IPAA 1Z9HA 4PNGA 4PQIA 4HI7A 3HZ8A 3CSJA 3FZ9A 4OCFA 2LTKA 3UOMA 1SJ6A 4LMVA 1ZOFA 4TXVA 3ZIVA 1PA3A 3HJPA 2QA1A 4OFNA 3SBCA 2H8LA 2CA8A 1GTUA 4KDXA 4I8BA 3UBLA 4MZBA 4AJ7A 1VF3A 4NWYA 4TRXA 2YPMA 4ULXA 3LQ7A 19GSA 1XIYA 1GSQA 3KH9A 5G1LA 2VIMA 3Q18A 2JL4A 1XWKA 1OE7A 4XS1A 4PURA 2HYXA 4EO3A 1EWXA 2C0GA 2OE0A 2JU5A 3FRCA 5ELGA 3MNGA 4O5RA 1GL8A 2H6XA 3ZREA 4EL1A 4G9HA 3DGQA 2PBJA 1RW1A 3H79A 4J2FA 2H6ZA 2YJHA 1R5PA 1S3CA 2L4CA 1F3AA 1V2AA 2TIRA 1GUMA 2FNOA 2OKAA 5F06A 1K0CA 4HDEA 3O6TA 2AJQB 1Y25A 2YV7A 4MZWA 2VM1A 3MWHA 4KAEA 3BCIA 4I97A 4KCAA 3ZMLA 3VI5A 3D0ZA 1GUKA 4XCSA 1VF4A 2E0QA 2B7KA 5HFKA 3DKSA 5IQYA 2GQKA 4YKFA 3IDVA 1VRSD 4IP6A 5ECRB 1SK1A 3VWXA 1GH2A 3HJOA 4JZQA 1KEBA 5JCUA 2HSYA 1FB6A 4IVFA 2VOCA 5ECQB 3M3MA 3TOUA 1K3OA 3D4TA 4MLYA 1QXHA 4G10A 3ZTLA 2E7PA 2HZEB 2CVBA 5F8BA 3C1SA 1VGLA 3CSIA 2H30A 5DBQA 3MSZA 20GSA 4Q5FA 1G0TA 1MDKA 4HZ2A 5B8AA 5DALB 5B7CA 3W6GA 5FWGA 2DC5A 2CVKA 4D73B 4XS4B 1Q98A 4GQCA 2YZHA 3IOSA 1GSFA 2O85A 3TKSA 2DSAA 2YCDA 2CV4A 4GXZA 5BMUA 3TKQA 4FYBA 4GQFA 1M2AA 4ZILA 3K8NA 2CZ3A 4DSRA 5DQSA 2VCQA 3GHAA 2GZPA 4Q5QA 2C4JA 2MZCA 4TR1A 1ERUA 5IO2A 1YEXA 4EIQA 3TOTA 4MA9A 6GSTA 1T4YA 3VI7A 4FH8A 2EC4A 3QMXA 4KF9A 5C00A 3IA1A 3GL3A 5B8BA 1O8WA 2LNSA 1GSSA 3GUSA 1BEDA 1JLVA 2H70A 3G9BA 2GSQA 4AJ8A 1SJIA 4RQXA 3DXBA 5F0GA 2RLIA 2HNLA 2C80A 1T3BA 3ZVJA 2FWGA 2LRTA 4WKWA 2JZTA 5G5FA 4ZL9A 1FG4A 3HVNA 3IC4A 2EIQA 3QAWA 2EIRA 5ELAA 4TR4A 4MJAA 2IFQA 1YKAA 3TKPA 2VCVA 1E6BA 4JU5A 3ZMKA 4KDYA 1HNBA 3ERWA 5L71A 3D21A 3F4SA 2O89A 1TRVA 3FZ4A 1SENA 2VCTA 4N0VA 3HVXA 3EU3A 1XCCA 5EY6A 4OO5A 4GF0A 1AIUA 4EC0A 2IMIA 1AUCA 4ISDA 5IM9A 1SK0A 3GSTA 2PERA 3WGXA 3F9UA 1FVKA 1GLPA 1B8XA 2YWNA 2R5GA 2H01A 2GSSA 3LSZA 4DEJA 1FW1A 3A5IA 4IQ1A 2IIYA 3IC8A 1PX7A 2HT9A 4N11A 2XC2A 2H74A 2OE1A 3FR6A 3GFKA 2K8SA 2R3XA 1C72A 2AB6A 4XTSA 2TRXA 5A5KA 1AQWA 2LJAA 3Q6OA 3TDGA 6GSWA 3GNJA 4F82A 1S3DA 3GSSA 2RIIA 1MD3A 2M46A 1XOBA 4LMWA 4GRFA 1SL2B 5ECHB 4MZCA 1YY7A 1TI1A 4FQUA 4ZL7A 3A3TA 2H75A 2GQLA 3WYWA 5CP1A 2HLSA 4HEA2 4MPGA 4MF5A 2F8FA 1M2DA 2HE3A 5IOXA 2H1AA 3FW2A 4F03A 3HVSA 2JZSA 5CO3A 3P7XA 16GSA 2GTUA 3RHBA 1NHOA 2A2SA 3QCPA 5IMZA 3VWVA 5DAKB 4DSQA 1TOFA 2FA8A 3QR6A 1NW2A 2ON7A 1QUWA 2YV9A 1X0RA 3D4MA 2GT6A 2DBCA 4YKGA 4FYCA 2JSYA 4L8EA 2DJ2A 5IMCA 1OAZA 4HUAA 1V40A 5LD0A 1EEJA 1B4QA 2YWOA 4NXIA 4GSTA 2M66A 4HJ2A 1YF1A 1M9BA 3WT2A 1UA5A 1TRSA 2WS2A 2V2GA 1EP7A 1JHBA 3DWVA 2A2PA 5HR1A 2PVOC 5INYA 5E4WA 2YOIA 2LQQA 4TR1B 1B9YC 3ZYWA 4NHWA 4MCUA 1BJXA 4KH7A 3VPTA 4KSMA 1GTAA 2FD3A 4KUNA 1X5DA 3ZVJD 2IL3A 2LRNA 1M7TA 2WFCA 4GWRA 2LUSA 5GAPD 2KUCA 2VO4A 4I5QA 2K9FA 3GH6A 2PGTA 1AC1A 3DYRA 1EP8A 2WGRA 1A0RP 3HCZA 1UC7A 3ED3A 4JE1A 4EDYA 4G19A 2FA4A 1THOA 3E0UA 2F51A
chains in the Genus database with same CATH topology
1ZZYA 1FOVA 2MMZA 3ZIJA 4IP1A 1X5EA 1G7EA 1JLWA 1PX6A 5GSTA 2IFQB 4L0UA 4HOJA 1I9DA 3VWUA 2X4AA 4D73A 1TTZA 1GSEA 4IBPA 3ZRDA 1GSDA 2A4HA 5H5SA 3UEMA 1M0UA 4KGIA 2O8VB 5D9TA 1XFLA 2XPDA 3NIVA 3TKSC 4JR4A 4YAPA 2HRFA 1OKDA 2DMLA 3EPTA 2VUPA 1A2LA 2A4VA 3H8QA 2PUKC 1H75A 3KM6A 5JWQB 1X9WB 2MMAA 2MMOA 4MH2A 4FYUA 1YZXA 5KEJA 2LNTA 4X4JA 1A0FA 2QGVA 1PQNA 3TJBA 5A4UA 2WRTA 3BJ5A 5CAXA 1JZWA 2H1BA 1WWJA 3LXZA 5GAND 2C3TA 2H71A 3L9SA 4PTSA 5ECOB 1SL0B 2H73A 5G1KA 2P5RA 2VCXA 3A2WA 4O32A 5J41A 3GMFA 3IE3A 1BG5A 1TW9A 4K1FA 1O6JA 4K2DA 2AYTA 3D5JA 1EGRA 4K2XA 1FO5A 4ZL8A 4BL7B 4MJCA 1MTCA 4TKYA 3F4TA 1WOUA 2IMFA 1EOGA 2WDUA 4K6XA 2I1UA 3UIWA 3G7JA 4USSA 4EVMA 3I6AA 5HR3A 4WEYA 4XIHA 2TRCP 4BA7A 2FUG2 3C1RA 2IMEA 4ILFA 2PMTA 3CTFA 4V2LA 1LBKA 4PGTA 2HSHA 3FR3A 1K0MA 4I6XA 2B5YA 2PN8A 3QDNA 3P90A 1ABAA 2N5FA 2REMA 4N0ZA 2GQMA 5KOXA 5HFGA 2J9HA 2D2ZA 2B1KA 1TK8B 4AJ6A 3F4RA 3WD6A 4YQVA 2DJ0A 4EXJA 3ZLPA 3IHGA 4ZB9A 4X1UA 3HKRA 2NDOA 4TXOA 3FK8A 4KW6A 1K0OA 3GX8A 4A5PA 3A2XA 2WULA 4JRRA 5J5NA 1YQ1A 2DMMA 1HNCA 1MD4A 3PPUA 5KN1A 5CRDA 17GSA 4GTUA 1Z3EA 4ZXGA 2QA2A 1SU9A 3IXRA 3GKNA 4IN0A 5G2ZA 2C0FA 1O7UA 3GA4A 1T7PB 1Z7RA 1USBA 3VPQA 3IAM2 4KNDA 3SWLA 3M1GA 3EURA 2IJYA 1THXA 1EEMA 3JCML 2DJ3A 5EL8A 1M99A 4ZB6A 1VF2A 1PGTA 4MF6A 2HSMA 1I5GA 2B7JA 4TR0A 1F37A 3QOUA 4IW9A 5ABRA 5DAKA 4XS6A 1PKZA 1XWCA 2XHFA 1FAAA 3AY8A 1LJRA 4HZ4A 2M80A 4CY8A 1ZMAA 1URMA 2Z9SA 2JSZA 2R2JA 4ZBBA 3C71A 5EVOA 1Z6MA 4NMUA 1XW9A 1A8YA 1DE1A 1E2YA 5IMAA 1W89A 2RM5A 1GTIA 1XWBA 3L9VA 3U5RE 4N10A 3LYPA 5G5EA 4Q5RA 4OWYA 3CTGA 4ID0A 3FMWA 2LS5A 1K0DA 1GWCA 3CBUA 3GTUB 2FY6A 3A5WA 4YAVA 2FWFA 5HR2A 4G0IA 3R2QA 3RDWA 3F3RA 2MBTA 3UBKA 4L5LA 2LJKA 5ECMB 4EDZA 4EIPA 3BBYA 1TK5B 3GYKA 1T00A 3DIEA 2AAWA 2L4QA 3FHKA 12GSA 3KD0A 2RUFA 4IQAA 2MBSA 1OC9A 2E2GA 2GT5A 2LRCA 2V32A 3IAS2 3D6IA 3TRQA 2O87A 5KOWA 2FCHA 4ML1A 5G30A 4RUVA 1AQXA 4J57E 3TRXA 1VF1A 3F3QA 2C1YA 2IMKA 1A23A 4MJBA 5IMFA 1SD9A 3HY2A 2VL2A 4NV2A 1M2BA 2DIZA 2H6YA 5IO0A 3KJYA 2DKHA 10GSA 6GSVA 3NOFA 3GL5A 1ZCPA 2HRKA 1HD2A 3IHQA 3D22A 5JCWA 4PQ1A 5IPGA 4YQMA 3PH9A 1OE8A 2DJ1A 2H19A 2VLUA 2BJXA 3IR4A 1PL2A 5ECSA 5ENUA 1X9SB 4WR5A 5D9WA 3J7Yb 3UVHA 3WGEA 1V9WA 3NZNA 1O8XA 4NV5A 4NHZA 4WF4A 2IWTA 4KCEA 4KB3A 2KP2A 4O7HA 5J9CA 1EZKA 2DJJA 13GSA 1TRWA 1ON4A 1TI3A 2WCIA 3KH7A 4ICYA 4LA1A 1Z7PA 2J23A 4WBRD 2YWIA 1AAZA 4TXOB 3EVIA 1ERTA 4K9ZA 1DUGA 3TJGA 1R4WA 1AXDA 4E8EA 1V98A 1ERWA 1SYRA 3FZAA 5A4WA 2YWMA 2UZ8A 1WMJA 2L6CA 1BYEA 2ZNMA 3PR8A 1OVNA 2HZFA 4JEDA 4JR6A 1A2MA 2V6OA 4K7OA 3FR9A 4BVXA 2PPTA 2VCZA 5DCHA 1GLQA 5DJMA 3UL3A 2G2QA 2MYGA 2V41A 3LG6A 4HQZA 4BL7A 5LNKe 1MEKA 3ISOA 4NAXA 3O76A 2GZYA 1GTBA 5LCZA 3BOAA 4CW9A 2L5OA 4I2UA 11GSA 1Z5YE 1SKWB 3KCMA 2WB9A 2VCWA 4ZBDA 1MDIA 3FYGA 2E2MA 4N30A 1F6MC 4LL4B 4YH2A 1B4PA 3WGDA 2DIYA 1SL1B 4H86A 4MNNA 4MMMA 2LV3A 1S3AA 4POLA 4DSSB 2EIOA 3ZZXA 4O5UA 2QC7A 3ERFA 5IMDA 1QQ2A 3F6DA 3E9JB 4KA0A 1B9XC 3FZ5A 5DVBA 1JZOA 3UAPA 4QQ7A 1PMTA 1BAYA 3EMPA 3ME7A 3LORA 2MMNA 2OBIA 4K8MA 2GZZA 5KN0A 3KTBA 2H0GA 4Z7XA 5D73A 2B3SA 2C0DA 2F8AA 1PN0A 1UN2A 4MH3A 1ST9A 3N9JA 2X64A 4K0GA 3HA9A 2L57A 2A2RA 3ERGA 3GRXA 4QL7A 4Z2TA 4MPFA 3P8WA 3H4KA 1TU8A 1Z6NA 2CQ9A 3RHCA 4MP4A 4ZB8A 3EC3A 2L59A 1R7HA 1XW5A 3GKXA 3KEBA 2NPBA 3M0FA 5CNWA 1ZYPA 4TN8A 3MYDA 5IPHA 2K6VA 2FGXA 3LEFA 1G7OA 5ECLB 5DQYA 4PUAA 3LXTA 5CYYA 1DE2A 8GSSA 1WRYA 3BD2A 1O73A 2QSIA 1XBSA 1OC9B 1HYUA 2XBIA 4G0KA 3MIXA 1O85A 5CREA 4PQHA 4ECIA 4G0LA 4ZIJA 2P5QA 4GSNA 1U3IA 3LYKA 2H1GA 3EE2A 3PINA 4F9ZA 3F63A 4IJIA 4RI6A 2HXKA 2F3MA 1NHYA 4OFTA 3FY7A 3HDCA 3IV4A 4NPBA 3I69A 5E59A 1XVWA 6GSSA 1FHEA 5C04A 4Z2RA 3KGKA 3HXSA 1JFUA 2GS3A 3KP9A 1T8EB 2YN1A 3I9V2 2GLRA 4HU9A 2X8HA 4WXTA 3GV1A 4XRAA 2K8VA 4JBBA 2AV4A 1TXXA 4IELA 3GTUA 2B6MA 2ZUPA 3CRUA 5FT3A 1QK8A 5HFIA 2BMXA 5J3RA 1TK0B 4ACSA 1K0BA 1X9MB 1NM3A 1IYIA 1TP9A 3Q74A 4ZBAA 6GSXA 4K5SA 4WF5A 3EINA 1SD8A 3EWLA 4EUYA 2X8GA 3EMXA 3APQA 3GH9A 3CSHA 3QPMA 2JZRA 2L5LA 3ZITA 3QAVA 4MJEA 4TVEA 2H0HA 3C8EA 22GSA 1SKRB 3TGZA 2R0PA 4KSOA 4PUFC 1GUHA 1PKWA 2H0IA 3L9UA 1UVZA 4V1Ag 2NVLA 3PGTA 1OKTA 5BRTA 1A8LA 4BWSA 2VL3A 2DLXA 2I9HA 1TRUA 3Q19A 1G6YA 1W4VA 4BVXB 2GVPA 1OYJA 4OFMA 2HRNA 4G2EA 4XHMA 5ECPB 3RPPA 2PWJA 3KIJA 4HQSA 2VLVA 3RBTA 4YQUA 2VL2C 2LKUA 2JADA 2R37A 5J9BA 1YJ6A 3TKSE 2I3YA 1YEPA 3LGCA 5AIXA 5DJLA 3O3TA 2CVDA 2OE3A 1XZOA 3KMNA 2DJKA 2DKIA 3HYPA 1JZRA 4V2MA 5ECIB 3M9JA 1SJZA 2C8UA 1WPIA 1OC3A 1V58A 2AUVA 3KMOA 1K0NA 4BWQA 1XOAA 1XXUA 4GSSA 4K5RA 3L4NA 5AIVA 5F05A 5HQPA 3KZQA 2YP6A 3KTLA 2ZCTA 3HD5A 18GSA 2IMDA 4XRDA 3EYTA 5D9XA 3H93A 3RAZA 2LEGA 4OD7A 3TCOA 1YF0A 2H1DA 2I81A 4K7NA 1TDIA 3TB2A 4HU7A 2I4AA 4MK3A 1FOHA 3TJJA 3GKMA 2CAIA 2QKEA 4O92A 3KXOA 5KN2A 2R0CA 1PSQA 4K0NA 3LWAA 5IMVA 4E8HA 3APOA 1EV9A 3W8JA 2FWHA 4IHUA 5CRHA 3FEUA 4F0CA 2ES7A 3GURA 4DSSA 4KE3A 2VD0A 1T1VA 3R3EA 4LLRA 3QFAC 2P31A 1CQHA 3F0IA 1SKSB 2LSTA 2C3NA 2KP1A 1HNAA 4X0XA 3WT1A 2OADA 1QFNA 2OACA 3UMAA 4AGSA 4PXOA 2ON5A 4TR3A 2VAFA 5DDLA 1PRXA 1F3BA 3E3EA 5ID2B 1GNWA 2O7KA 4FIWA 4IKHA 3V1WA 9GSSA 1B48A 1EGOA 1K0AA 2IN3A 1AQVA 3EU4A 1GSYA 1KTEA 3LFLA 4ECJA 6GSUA 2ALBA 1BX9A 3QD9A 1AW9A 1J08A 4BVYA 1FB0A 1PL1A 2VM2A 2RM6A 2G0FA 1WP0A 5H5QA 2YZUA 2WJUA 1GSUA 2VD1A 2AHEA 1ZYQB 2P0GA 2YNXA 2CAQA 3IK7A 2RUEA 4QL9A 4POKA 2GGTA 2HI7A 2VL9A 1XWAA 2VLTA 3GKKA 2R4VA 4L5OA 2C0EA 4ECCA 3ZL5A 1ZYEA 2V6KA 4LL1B 1ACVA 1R26A 2JACA 3DMLA 1GP1A 4MF7A 2CX4A 2NTOA 1K3YA 3TKRA 1XPVA 3VWWA 5FHIA 3GN3A 2XPEA 3UARA 2M72A 4DVCA 1CQGA 1A2JA 3CXGA 2H76A 1U6TA 3I43A 3BCKA 4KX4A 3HJMA 1PD21 3DRNA 1DBYA 2YANA 2N5BA 4OMVA 1PN9A 4RQRA 1TJDA 1U3AA 3MDKA 5B6MA 2KOKA 5G31A 3APSA 2HRAA 1NSWA 3ME8A 1M9AA 5CRGA 3IK9A 1N8JA 3J7Yk 4RI7A 4TW5A 3RPNA 3UVTA 5IOWA 1T4ZA 2B5XA 4V1Ap 1EV4A 1K3LA 2FWEA 7GSSA 4GCIA 4HS1A 1YDKA 5JWOB 4OO4A 3L78A 1TU7A 5GSSA 3G7YA 3GIXA 2GSRA 1ILOA 3HVVA 1XWGA 2KLXA 1JZDA 4K7IA 3UJ1A 3GX0A 3A2VA 1H4OA 1Y6EA 2LQOA 3CRTA 1EOHA 14GSA 1ZL9A 3TUEA 3TJKA 3FKFA 5D8IA 2B1LA 2R6KA 2XBQA 1XVQA 4O5QA 2N5AA 4OCEA 5COHA 1DSBA 2FHEA 2F9SA 4I2TA 5JWRB 3VLNA 2NBSA 3ZFLA 2HFDA 1ERVA 3DD3A 3KP8A 3MAKA 4EKZA 2GDRA 1QGVA 5AISA 5KN3A 1SK2A 1N2AA 1OC8A 2PVQA 3CYNA 1RQMA 2R0GA 2X8CA 4F2IA 2OJLA 1YKCA 1WJKA 3IBHA 1J0FA 1XW6A 1IYHA 1MDJA 2OA7A 4BPYA 1J9BA 1TKDB 1WIKA 5J4UA 2H72A 2PU9C 3P2AA 4AF2A 2CT6A 5GZZB 4FO5A 6GSYA 1A24A 4HJMA 2X99A 5B6NA 5D9VA 3TJFA 1ML6A 3F8UA 3CMIA 1X5CA 3M8NA 2B5EA 2WZ9A 1WE0A 3C73A 4BVYB 1ZGNA 4J56E 4WR4A 3W8SA 2V1MA 4EF0A 3TRPA 3LW9A 4V2NA 5AN1A 1BQ7A 1KNGA 4CHSA 1U88A 5JCGA 4POBA 4IGJA 1FVJA 1R5AA 2H66A 5HR0A 2X49A 1KBNA 4CDOA 3VK9A 5A4VA 1F2EA 4PX1A 5AGYA 5DCGA 1G7DA 2CZ2A 3H1NA 4Z2UA 3L0HA 2LJRA 4MABA 1G6WA 5D93A 5D96A 2FLSA 2HZEA 4P3YB 3US3A 2K18A 1LU4A 2OBKA 3HHVA 1SYXA 5ECNB 3S9FA 1QMVA 4POMA 4CY6A 5CRWA 4F0BA 4GLTA 4ECBA 2BTOT 2C3QA 3VFIA 2L6DA 4ML6A 3DVWA 1F9MA 1RK4A 1GULA 3DVXA 5DALA 3IRAA 5ID2A 1V57A 3ZFBA 4PNFA 4XS4A 4IS0A 5IIZA 3IPZA 3M9KA 3F6FA 3C7MA 2CX3A 1Q4JA 1U87A 3OR5A 4IJ3A 3QFBC 3U6VA 2YJ7A 3DEXA 1HQOA 3G7IA 3LJRA 4KDUA 2KHPA 4TOPA 4Q5NA 2GSTA 1O81A 5F07A 5H5RA 4L0WA 3QAGA 5ECKB 1ZYNA 4MDCA 1GNEA 4WBJA 4X43A 3HZ4A 5EPFA 4EE0A 3N5OA 4WETA 3VURA 1GRXA 2IPAA 1Z9HA 4PNGA 4PQIA 4HI7A 3HZ8A 3CSJA 3FZ9A 4OCFA 2LTKA 3UOMA 1SJ6A 4LMVA 1ZOFA 4TXVA 3ZIVA 1PA3A 3HJPA 2QA1A 4OFNA 3SBCA 2H8LA 2CA8A 1GTUA 4KDXA 4I8BA 3UBLA 4MZBA 4AJ7A 1VF3A 4NWYA 4TRXA 2YPMA 4ULXA 3LQ7A 19GSA 1XIYA 1GSQA 3KH9A 5G1LA 2VIMA 3Q18A 2JL4A 1XWKA 1OE7A 4XS1A 4PURA 2HYXA 4EO3A 1EWXA 2C0GA 2OE0A 2JU5A 3FRCA 5ELGA 3MNGA 4O5RA 1GL8A 2H6XA 3ZREA 4EL1A 4G9HA 3DGQA 2PBJA 1RW1A 3H79A 4J2FA 2H6ZA 2YJHA 1R5PA 1S3CA 2L4CA 1F3AA 1V2AA 2TIRA 1GUMA 2FNOA 2OKAA 5F06A 1K0CA 4HDEA 3O6TA 2AJQB 1Y25A 2YV7A 4MZWA 2VM1A 3MWHA 4KAEA 3BCIA 4I97A 4KCAA 3ZMLA 3VI5A 3D0ZA 1GUKA 4XCSA 1VF4A 2E0QA 2B7KA 5HFKA 3DKSA 5IQYA 2GQKA 4YKFA 3IDVA 1VRSD 4IP6A 5ECRB 1SK1A 3VWXA 1GH2A 3HJOA 4JZQA 1KEBA 5JCUA 2HSYA 1FB6A 4IVFA 2VOCA 5ECQB 3M3MA 3TOUA 1K3OA 3D4TA 4MLYA 1QXHA 4G10A 3ZTLA 2E7PA 2HZEB 2CVBA 5F8BA 3C1SA 1VGLA 3CSIA 2H30A 5DBQA 3MSZA 20GSA 4Q5FA 1G0TA 1MDKA 4HZ2A 5B8AA 5DALB 5B7CA 3W6GA 5FWGA 2DC5A 2CVKA 4D73B 4XS4B 1Q98A 4GQCA 2YZHA 3IOSA 1GSFA 2O85A 3TKSA 2DSAA 2YCDA 2CV4A 4GXZA 5BMUA 3TKQA 4FYBA 4GQFA 1M2AA 4ZILA 3K8NA 2CZ3A 4DSRA 5DQSA 2VCQA 3GHAA 2GZPA 4Q5QA 2C4JA 2MZCA 4TR1A 1ERUA 5IO2A 1YEXA 4EIQA 3TOTA 4MA9A 6GSTA 1T4YA 3VI7A 4FH8A 2EC4A 3QMXA 4KF9A 5C00A 3IA1A 3GL3A 5B8BA 1O8WA 2LNSA 1GSSA 3GUSA 1BEDA 1JLVA 2H70A 3G9BA 2GSQA 4AJ8A 1SJIA 4RQXA 3DXBA 5F0GA 2RLIA 2HNLA 2C80A 1T3BA 3ZVJA 2FWGA 2LRTA 4WKWA 2JZTA 5G5FA 4ZL9A 1FG4A 3IC4A 2EIQA 3QAWA 2EIRA 5ELAA 4TR4A 4MJAA 2IFQA 1YKAA 3TKPA 2VCVA 1E6BA 4JU5A 3ZMKA 4KDYA 1HNBA 3ERWA 5L71A 3D21A 3F4SA 2O89A 1TRVA 3FZ4A 1SENA 2VCTA 4N0VA 3HVXA 3EU3A 1XCCA 5EY6A 4OO5A 4GF0A 1AIUA 4EC0A 2IMIA 1AUCA 4ISDA 5IM9A 1SK0A 3GSTA 2PERA 3WGXA 3F9UA 1FVKA 1GLPA 1B8XA 2YWNA 2R5GA 2H01A 2GSSA 3LSZA 4DEJA 1FW1A 3A5IA 4IQ1A 2IIYA 3IC8A 1PX7A 2HT9A 4N11A 2XC2A 2H74A 2OE1A 3FR6A 3GFKA 2K8SA 2R3XA 1C72A 2AB6A 4XTSA 2TRXA 5A5KA 1AQWA 2LJAA 3Q6OA 3TDGA 6GSWA 3GNJA 4F82A 1S3DA 3GSSA 2RIIA 1MD3A 2M46A 1XOBA 4LMWA 4GRFA 1SL2B 5ECHB 4MZCA 1YY7A 1TI1A 4FQUA 4ZL7A 3A3TA 2H75A 2GQLA 3WYWA 5CP1A 2HLSA 4HEA2 4MPGA 4MF5A 2F8FA 1M2DA 2HE3A 5IOXA 2H1AA 3FW2A 4F03A 3HVSA 2JZSA 5CO3A 3P7XA 16GSA 2GTUA 3RHBA 1NHOA 2A2SA 3QCPA 5IMZA 3VWVA 5DAKB 4DSQA 1TOFA 2FA8A 3QR6A 1NW2A 2ON7A 1QUWA 2YV9A 1X0RA 3D4MA 2GT6A 2DBCA 4YKGA 4FYCA 2JSYA 4L8EA 2DJ2A 5IMCA 1OAZA 4HUAA 1V40A 5LD0A 1EEJA 1B4QA 2YWOA 4NXIA 4GSTA 2M66A 4HJ2A 1YF1A 1M9BA 3WT2A 1UA5A 1TRSA 2WS2A 2V2GA 1EP7A 1JHBA 3DWVA 2A2PA 5HR1A 2PVOC 5INYA 5E4WA 2YOIA 2LQQA 4TR1B 1B9YC 3ZYWA 4NHWA 4MCUA 1BJXA 4KH7A 3VPTA 4KSMA 1GTAA 2FD3A 4KUNA 1X5DA 3ZVJD 2IL3A 2LRNA 1M7TA 2WFCA 4GWRA 2LUSA 5GAPD 2KUCA 2VO4A 4I5QA 2K9FA 3GH6A 2PGTA 1AC1A 3DYRA 1EP8A 2WGRA 1A0RP 3HCZA 1UC7A 3ED3A 4JE1A 4EDYA 4G19A 2FA4A 1THOA 3E0UA 2F51A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZZY A;  1FOV A;  2MMZ A;  3ZIJ A;  4IP1 A;  1X5E A;  1G7E A;  1JLW A;  1PX6 A;  5GST A;  2IFQ B;  4L0U A;  4HOJ A;  1I9D A;  3VWU A;  4D73 A;  1TTZ A;  1GSE A;  4IBP A;  3ZRD A;  1GSD A;  5H5S A;  3UEM A;  1M0U A;  4KGI A;  2O8V B;  5D9T A;  1XFL A;  2XPD A;  3NIV A;  3TKS C;  4JR4 A;  4YAP A;  2HRF A;  1OKD A;  2DML A;  2VUP A;  1A2L A;  2A4V A;  3H8Q A;  2PUK C;  1H75 A;  3KM6 A;  5JWQ B;  1X9W B;  2MMA A;  2MMO A;  4MH2 A;  4FYU A;  1YZX A;  5KEJ A;  2LNT A;  1A0F A;  2QGV A;  1PQN A;  3TJB A;  5A4U A;  2WRT A;  3BJ5 A;  5CAX A;  1JZW A;  2H1B A;  1WWJ A;  3LXZ A;  5GAN D;  2C3T A;  2H71 A;  3L9S A;  5ECO B;  1SL0 B;  2H73 A;  5G1K A;  2P5R A;  2VCX A;  3A2W A;  4O32 A;  5J41 A;  3GMF A;  3IE3 A;  1BG5 A;  1TW9 A;  4K1F A;  1O6J A;  4K2D A;  2AYT A;  3D5J A;  1EGR A;  1FO5 A;  4ZL8 A;  4MJC A;  1MTC A;  4TKY A;  3F4T A;  1WOU A;  2IMF A;  1EOG A;  2WDU A;  4K6X A;  2I1U A;  3UIW A;  3G7J A;  4EVM A;  3I6A A;  5HR3 A;  4WEY A;  4XIH A;  2TRC P;  4BA7 A;  2FUG 2;  3C1R A;  2IME A;  4ILF A;  2PMT A;  3CTF A;  4V2L A;  1LBK A;  4PGT A;  2HSH A;  3FR3 A;  1K0M A;  4I6X A;  2B5Y A;  2PN8 A;  3QDN A;  3P90 A;  1ABA A;  2N5F A;  2REM A;  4N0Z A;  2GQM A;  5HFG A;  2J9H A;  2D2Z A;  2B1K A;  1TK8 B;  4AJ6 A;  3F4R A;  3WD6 A;  4YQV A;  2DJ0 A;  4EXJ A;  3ZLP A;  4ZB9 A;  4X1U A;  3HKR A;  2NDO A;  4TXO A;  3FK8 A;  4KW6 A;  1K0O A;  3GX8 A;  3A2X A;  2WUL A;  4JRR A;  5J5N A;  1YQ1 A;  2DMM A;  1HNC A;  1MD4 A;  5KN1 A;  5CRD A;  17GS A;  4GTU A;  1Z3E A;  4ZXG A;  1SU9 A;  3IXR A;  3GKN A;  4IN0 A;  5G2Z A;  2C0F A;  1O7U A;  3GA4 A;  1T7P B;  1Z7R A;  1USB A;  3VPQ A;  3IAM 2;  4KND A;  3SWL A;  3M1G A;  3EUR A;  2IJY A;  1THX A;  1EEM A;  3JCM L;  2DJ3 A;  5EL8 A;  1M99 A;  4ZB6 A;  1VF2 A;  1PGT A;  4MF6 A;  1I5G A;  2B7J A;  4TR0 A;  1F37 A;  3QOU A;  4IW9 A;  5ABR A;  5DAK A;  4XS6 A;  1PKZ A;  1XWC A;  2XHF A;  1FAA A;  3AY8 A;  1LJR A;  4HZ4 A;  2M80 A;  1ZMA A;  1URM A;  2Z9S A;  2JSZ A;  2R2J A;  4ZBB A;  3C71 A;  5EVO A;  1Z6M A;  4NMU A;  1XW9 A;  1A8Y A;  1DE1 A;  1E2Y A;  5IMA A;  1W89 A;  2RM5 A;  1GTI A;  1XWB A;  3L9V A;  3U5R E;  4N10 A;  3LYP A;  5G5E A;  4Q5R A;  4OWY A;  3CTG A;  4ID0 A;  2LS5 A;  1K0D A;  1GWC A;  3CBU A;  3GTU B;  2FY6 A;  3A5W A;  4YAV A;  2FWF A;  5HR2 A;  3R2Q A;  3RDW A;  3F3R A;  2MBT A;  3UBK A;  4L5L A;  2LJK A;  5ECM B;  4EDZ A;  3BBY A;  1TK5 B;  3GYK A;  1T00 A;  3DIE A;  2AAW A;  2L4Q A;  3FHK A;  12GS A;  3KD0 A;  2RUF A;  4IQA A;  2MBS A;  1OC9 A;  2E2G A;  2GT5 A;  2LRC A;  2V32 A;  3IAS 2;  3D6I A;  3TRQ A;  2O87 A;  2FCH A;  4ML1 A;  5G30 A;  4RUV A;  1AQX A;  4J57 E;  3TRX A;  1VF1 A;  3F3Q A;  2C1Y A;  2IMK A;  1A23 A;  4MJB A;  5IMF A;  1SD9 A;  3HY2 A;  2VL2 A;  4NV2 A;  1M2B A;  2DIZ A;  2H6Y A;  5IO0 A;  3KJY A;  10GS A;  6GSV A;  3NOF A;  3GL5 A;  1ZCP A;  1HD2 A;  3IHQ A;  3D22 A;  5JCW A;  4PQ1 A;  5IPG A;  4YQM A;  3PH9 A;  1OE8 A;  2DJ1 A;  2H19 A;  2VLU A;  2BJX A;  3IR4 A;  1PL2 A;  5ECS A;  5ENU A;  1X9S B;  4WR5 A;  5D9W A;  3J7Y b;  3UVH A;  3WGE A;  1V9W A;  3NZN A;  1O8X A;  4NV5 A;  4NHZ A;  4WF4 A;  2IWT A;  4KCE A;  4KB3 A;  2KP2 A;  4O7H A;  5J9C A;  1EZK A;  2DJJ A;  13GS A;  1TRW A;  1ON4 A;  1TI3 A;  2WCI A;  3KH7 A;  4LA1 A;  1Z7P A;  2J23 A;  4WBR D;  2YWI A;  1AAZ A;  4TXO B;  3EVI A;  1ERT A;  4K9Z A;  1DUG A;  3TJG A;  1R4W A;  1AXD A;  4E8E A;  1V98 A;  1ERW A;  1SYR A;  3FZA A;  5A4W A;  2YWM A;  1WMJ A;  2L6C A;  1BYE A;  2ZNM A;  3PR8 A;  1OVN A;  2HZF A;  4JED A;  4JR6 A;  1A2M A;  2V6O A;  4K7O A;  3FR9 A;  4BVX A;  2PPT A;  2VCZ A;  5DCH A;  1GLQ A;  5DJM A;  3UL3 A;  2G2Q A;  2MYG A;  2V41 A;  3LG6 A;  4HQZ A;  4BL7 A;  5LNK e;  1MEK A;  3ISO A;  4NAX A;  3O76 A;  2GZY A;  1GTB A;  5LCZ A;  3BOA A;  4CW9 A;  2L5O A;  4I2U A;  11GS A;  1Z5Y E;  1SKW B;  3KCM A;  2WB9 A;  2VCW A;  4ZBD A;  1MDI A;  3FYG A;  2E2M A;  4N30 A;  1F6M C;  4LL4 B;  4YH2 A;  1B4P A;  3WGD A;  2DIY A;  1SL1 B;  4H86 A;  4MMM A;  2LV3 A;  1S3A A;  4POL A;  4DSS B;  2EIO A;  3ZZX A;  2QC7 A;  3ERF A;  5IMD A;  1QQ2 A;  3F6D A;  3E9J B;  4KA0 A;  1B9X C;  3FZ5 A;  5DVB A;  1JZO A;  3UAP A;  4QQ7 A;  1PMT A;  1BAY A;  3EMP A;  3ME7 A;  3LOR A;  2MMN A;  2OBI A;  4K8M A;  2GZZ A;  5KN0 A;  3KTB A;  2H0G A;  4Z7X A;  5D73 A;  2B3S A;  2C0D A;  2F8A A;  1UN2 A;  4MH3 A;  1ST9 A;  3N9J A;  2X64 A;  4K0G A;  3HA9 A;  2L57 A;  2A2R A;  3ERG A;  3GRX A;  4QL7 A;  4MPF A;  3P8W A;  3H4K A;  1TU8 A;  1Z6N A;  2CQ9 A;  3RHC A;  4MP4 A;  4ZB8 A;  3EC3 A;  2L59 A;  1R7H A;  1XW5 A;  3GKX A;  3KEB A;  2NPB A;  3M0F A;  5CNW A;  4TN8 A;  5IPH A;  2K6V A;  2FGX A;  3LEF A;  1G7O A;  5ECL B;  5DQY A;  4PUA A;  3LXT A;  5CYY A;  1DE2 A;  8GSS A;  1WRY A;  3BD2 A;  1O73 A;  2QSI A;  1XBS A;  1OC9 B;  1HYU A;  2XBI A;  1O85 A;  5CRE A;  4PQH A;  4ECI A;  4ZIJ A;  2P5Q A;  4GSN A;  1U3I A;  3LYK A;  2H1G A;  3EE2 A;  3PIN A;  4F9Z A;  3F63 A;  4IJI A;  4RI6 A;  2HXK A;  2F3M A;  1NHY A;  4OFT A;  3FY7 A;  3HDC A;  3IV4 A;  4NPB A;  3I69 A;  5E59 A;  1XVW A;  6GSS A;  1FHE A;  5C04 A;  3KGK A;  3HXS A;  1JFU A;  2GS3 A;  3KP9 A;  1T8E B;  2YN1 A;  3I9V 2;  2GLR A;  4HU9 A;  2X8H A;  4WXT A;  3GV1 A;  4XRA A;  2K8V A;  4JBB A;  2AV4 A;  1TXX A;  4IEL A;  3GTU A;  2B6M A;  2ZUP A;  3CRU A;  5FT3 A;  1QK8 A;  5HFI A;  2BMX A;  5J3R A;  1TK0 B;  4ACS A;  1K0B A;  1X9M B;  1NM3 A;  1IYI A;  1TP9 A;  3Q74 A;  4ZBA A;  6GSX A;  4WF5 A;  3EIN A;  1SD8 A;  3EWL A;  4EUY A;  2X8G A;  3EMX A;  3APQ A;  3GH9 A;  3CSH A;  3QPM A;  2JZR A;  2L5L A;  3ZIT A;  3QAV A;  4MJE A;  4TVE A;  2H0H A;  3C8E A;  22GS A;  1SKR B;  3TGZ A;  4KSO A;  4PUF C;  1GUH A;  1PKW A;  2H0I A;  3L9U A;  1UVZ A;  4V1A g;  2NVL A;  3PGT A;  1OKT A;  1A8L A;  4BWS A;  2VL3 A;  2DLX A;  2I9H A;  1TRU A;  3Q19 A;  1G6Y A;  1W4V A;  2GVP A;  1OYJ A;  4OFM A;  2HRN A;  4G2E A;  4XHM A;  5ECP B;  3RPP A;  2PWJ A;  3KIJ A;  4HQS A;  2VLV A;  3RBT A;  4YQU A;  2VL2 C;  2LKU A;  2JAD A;  2R37 A;  5J9B A;  1YJ6 A;  3TKS E;  2I3Y A;  1YEP A;  3LGC A;  5AIX A;  5DJL A;  3O3T A;  2CVD A;  2OE3 A;  1XZO A;  3KMN A;  2DJK A;  3HYP A;  1JZR A;  4V2M A;  5ECI B;  3M9J A;  1SJZ A;  2C8U A;  1WPI A;  1OC3 A;  1V58 A;  2AUV A;  3KMO A;  1K0N A;  4BWQ A;  1XOA A;  1XXU A;  4GSS A;  3L4N A;  5AIV A;  5F05 A;  5HQP A;  3KZQ A;  2YP6 A;  3KTL A;  2ZCT A;  3HD5 A;  18GS A;  2IMD A;  4XRD A;  3EYT A;  5D9X A;  3H93 A;  3RAZ A;  2LEG A;  4OD7 A;  3TCO A;  1YF0 A;  2H1D A;  2I81 A;  4K7N A;  1TDI A;  3TB2 A;  4HU7 A;  2I4A A;  4MK3 A;  3TJJ A;  3GKM A;  2CAI A;  2QKE A;  4O92 A;  3KXO A;  5KN2 A;  1PSQ A;  4K0N A;  3LWA A;  5IMV A;  4E8H A;  3APO A;  1EV9 A;  3W8J A;  2FWH A;  4IHU A;  5CRH A;  3FEU A;  4F0C A;  2ES7 A;  3GUR A;  4DSS A;  4KE3 A;  2VD0 A;  1T1V A;  4LLR A;  3QFA C;  2P31 A;  1CQH A;  3F0I A;  1SKS B;  2LST A;  2C3N A;  2KP1 A;  1HNA A;  4X0X A;  3WT1 A;  2OAD A;  1QFN A;  2OAC A;  3UMA A;  4AGS A;  4PXO A;  2ON5 A;  4TR3 A;  2VAF A;  5DDL A;  1PRX A;  1F3B A;  3E3E A;  5ID2 B;  1GNW A;  2O7K A;  4FIW A;  4IKH A;  3V1W A;  9GSS A;  1B48 A;  1EGO A;  1K0A A;  2IN3 A;  1AQV A;  3EU4 A;  1GSY A;  1KTE A;  3LFL A;  4ECJ A;  6GSU A;  2ALB A;  1BX9 A;  3QD9 A;  1AW9 A;  1J08 A;  4BVY A;  1FB0 A;  1PL1 A;  2VM2 A;  2RM6 A;  2G0F A;  1WP0 A;  5H5Q A;  2YZU A;  2WJU A;  1GSU A;  2VD1 A;  2AHE A;  1ZYQ B;  2P0G A;  2YNX A;  2CAQ A;  3IK7 A;  2RUE A;  4QL9 A;  4POK A;  2GGT A;  2HI7 A;  2VL9 A;  1XWA A;  2VLT A;  3GKK A;  2R4V A;  4L5O A;  2C0E A;  4ECC A;  3ZL5 A;  1ZYE A;  2V6K A;  4LL1 B;  1ACV A;  1R26 A;  2JAC A;  3DML A;  1GP1 A;  4MF7 A;  2CX4 A;  2NTO A;  1K3Y A;  3TKR A;  1XPV A;  3VWW A;  5FHI A;  3GN3 A;  2XPE A;  3UAR A;  2M72 A;  4DVC A;  1CQG A;  1A2J A;  3CXG A;  2H76 A;  1U6T A;  3I43 A;  3BCK A;  4KX4 A;  3HJM A;  1PD2 1;  3DRN A;  1DBY A;  2YAN A;  2N5B A;  4OMV A;  1PN9 A;  4RQR A;  1TJD A;  1U3A A;  3MDK A;  5B6M A;  2KOK A;  5G31 A;  3APS A;  1NSW A;  3ME8 A;  1M9A A;  5CRG A;  3IK9 A;  1N8J A;  3J7Y k;  4RI7 A;  4TW5 A;  3RPN A;  3UVT A;  5IOW A;  1T4Z A;  2B5X A;  4V1A p;  1EV4 A;  1K3L A;  2FWE A;  7GSS A;  4GCI A;  4HS1 A;  1YDK A;  5JWO B;  4OO4 A;  3L78 A;  1TU7 A;  5GSS A;  3G7Y A;  3GIX A;  2GSR A;  1ILO A;  3HVV A;  1XWG A;  2KLX A;  1JZD A;  4K7I A;  3UJ1 A;  3GX0 A;  3A2V A;  1H4O A;  1Y6E A;  2LQO A;  3CRT A;  1EOH A;  14GS A;  1ZL9 A;  3TUE A;  3TJK A;  3FKF A;  5D8I A;  2B1L A;  2R6K A;  2XBQ A;  1XVQ A;  2N5A A;  4OCE A;  5COH A;  1DSB A;  2FHE A;  2F9S A;  4I2T A;  5JWR B;  3VLN A;  2NBS A;  3ZFL A;  2HFD A;  1ERV A;  3DD3 A;  3KP8 A;  3MAK A;  4EKZ A;  2GDR A;  1QGV A;  5AIS A;  5KN3 A;  1SK2 A;  1N2A A;  1OC8 A;  2PVQ A;  3CYN A;  1RQM A;  2X8C A;  4F2I A;  2OJL A;  1YKC A;  1WJK A;  3IBH A;  1J0F A;  1XW6 A;  1IYH A;  1MDJ A;  2OA7 A;  4BPY A;  1J9B A;  1TKD B;  1WIK A;  5J4U A;  2H72 A;  2PU9 C;  3P2A A;  4AF2 A;  2CT6 A;  5GZZ B;  4FO5 A;  6GSY A;  1A24 A;  4HJM A;  2X99 A;  5B6N A;  5D9V A;  3TJF A;  1ML6 A;  3F8U A;  3CMI A;  1X5C A;  3M8N A;  2B5E A;  2WZ9 A;  1WE0 A;  3C73 A;  1ZGN A;  4J56 E;  4WR4 A;  3W8S A;  2V1M A;  4EF0 A;  3TRP A;  4V2N A;  5AN1 A;  1BQ7 A;  1KNG A;  4CHS A;  1U88 A;  5JCG A;  4POB A;  4IGJ A;  1FVJ A;  1R5A A;  2H66 A;  5HR0 A;  1KBN A;  4CDO A;  3VK9 A;  5A4V A;  1F2E A;  4PX1 A;  5AGY A;  5DCG A;  1G7D A;  2CZ2 A;  3H1N A;  3L0H A;  2LJR A;  4MAB A;  1G6W A;  5D93 A;  5D96 A;  2FLS A;  2HZE A;  4P3Y B;  3US3 A;  2K18 A;  1LU4 A;  2OBK A;  3HHV A;  1SYX A;  5ECN B;  3S9F A;  1QMV A;  4POM A;  5CRW A;  4F0B A;  4GLT A;  4ECB A;  2BTO T;  2C3Q A;  3VFI A;  2L6D A;  4ML6 A;  3DVW A;  1F9M A;  1RK4 A;  1GUL A;  3DVX A;  5DAL A;  3IRA A;  5ID2 A;  1V57 A;  3ZFB A;  4PNF A;  4XS4 A;  4IS0 A;  5IIZ A;  3IPZ A;  3M9K A;  3F6F A;  3C7M A;  2CX3 A;  1Q4J A;  1U87 A;  3OR5 A;  4IJ3 A;  3QFB C;  3U6V A;  2YJ7 A;  3DEX A;  1HQO A;  3G7I A;  3LJR A;  4KDU A;  2KHP A;  4TOP A;  4Q5N A;  2GST A;  1O81 A;  5F07 A;  5H5R A;  4L0W A;  3QAG A;  5ECK B;  4MDC A;  1GNE A;  4WBJ A;  4X43 A;  3HZ4 A;  5EPF A;  4EE0 A;  3N5O A;  4WET A;  3VUR A;  1GRX A;  2IPA A;  1Z9H A;  4PNG A;  4PQI A;  4HI7 A;  3HZ8 A;  3CSJ A;  3FZ9 A;  4OCF A;  2LTK A;  3UOM A;  1SJ6 A;  4LMV A;  1ZOF A;  4TXV A;  3ZIV A;  1PA3 A;  3HJP A;  4OFN A;  3SBC A;  2H8L A;  2CA8 A;  1GTU A;  4KDX A;  4I8B A;  3UBL A;  4MZB A;  4AJ7 A;  1VF3 A;  4NWY A;  4TRX A;  2YPM A;  4ULX A;  3LQ7 A;  19GS A;  1XIY A;  1GSQ A;  3KH9 A;  5G1L A;  2VIM A;  3Q18 A;  2JL4 A;  1XWK A;  1OE7 A;  4XS1 A;  4PUR A;  2HYX A;  4EO3 A;  1EWX A;  2C0G A;  2OE0 A;  2JU5 A;  3FRC A;  5ELG A;  3MNG A;  4O5R A;  1GL8 A;  2H6X A;  3ZRE A;  4EL1 A;  4G9H A;  3DGQ A;  2PBJ A;  1RW1 A;  3H79 A;  4J2F A;  2H6Z A;  2YJH A;  1R5P A;  1S3C A;  2L4C A;  1F3A A;  1V2A A;  2TIR A;  1GUM A;  2FNO A;  2OKA A;  5F06 A;  1K0C A;  4HDE A;  3O6T A;  2AJQ B;  1Y25 A;  2YV7 A;  4MZW A;  2VM1 A;  3MWH A;  4KAE A;  3BCI A;  4I97 A;  4KCA A;  3ZML A;  3VI5 A;  3D0Z A;  1GUK A;  4XCS A;  1VF4 A;  2E0Q A;  2B7K A;  5HFK A;  3DKS A;  5IQY A;  2GQK A;  3IDV A;  1VRS D;  4IP6 A;  5ECR B;  1SK1 A;  3VWX A;  1GH2 A;  3HJO A;  4JZQ A;  1KEB A;  5JCU A;  2HSY A;  1FB6 A;  4IVF A;  2VOC A;  5ECQ B;  3M3M A;  3TOU A;  1K3O A;  3D4T A;  4MLY A;  1QXH A;  4G10 A;  3ZTL A;  2E7P A;  2HZE B;  2CVB A;  5F8B A;  3C1S A;  1VGL A;  3CSI A;  2H30 A;  5DBQ A;  3MSZ A;  20GS A;  4Q5F A;  1G0T A;  1MDK A;  4HZ2 A;  5B8A A;  5DAL B;  5B7C A;  3W6G A;  5FWG A;  2DC5 A;  2CVK A;  4D73 B;  4XS4 B;  1Q98 A;  4GQC A;  2YZH A;  3IOS A;  1GSF A;  2O85 A;  3TKS A;  2DSA A;  2YCD A;  2CV4 A;  4GXZ A;  3TKQ A;  4FYB A;  4GQF A;  1M2A A;  4ZIL A;  3K8N A;  2CZ3 A;  4DSR A;  5DQS A;  2VCQ A;  3GHA A;  2GZP A;  4Q5Q A;  2C4J A;  2MZC A;  4TR1 A;  1ERU A;  5IO2 A;  1YEX A;  3TOT A;  4MA9 A;  6GST A;  1T4Y A;  3VI7 A;  4FH8 A;  2EC4 A;  3QMX A;  5C00 A;  3IA1 A;  3GL3 A;  5B8B A;  1O8W A;  2LNS A;  1GSS A;  3GUS A;  1BED A;  1JLV A;  2H70 A;  3G9B A;  2GSQ A;  4AJ8 A;  1SJI A;  4RQX A;  3DXB A;  5F0G A;  2RLI A;  2HNL A;  2C80 A;  1T3B A;  3ZVJ A;  2FWG A;  2LRT A;  4WKW A;  2JZT A;  5G5F A;  4ZL9 A;  1FG4 A;  3IC4 A;  2EIQ A;  3QAW A;  2EIR A;  5ELA A;  4TR4 A;  4MJA A;  2IFQ A;  1YKA A;  3TKP A;  2VCV A;  1E6B A;  4JU5 A;  3ZMK A;  4KDY A;  1HNB A;  3ERW A;  5L71 A;  3D21 A;  3F4S A;  2O89 A;  1TRV A;  3FZ4 A;  1SEN A;  2VCT A;  4N0V A;  3HVX A;  3EU3 A;  1XCC A;  5EY6 A;  4OO5 A;  4GF0 A;  1AIU A;  4EC0 A;  2IMI A;  1AUC A;  4ISD A;  5IM9 A;  1SK0 A;  3GST A;  2PER A;  3WGX A;  3F9U A;  1FVK A;  1GLP A;  1B8X A;  2YWN A;  2R5G A;  2H01 A;  2GSS A;  3LSZ A;  4DEJ A;  1FW1 A;  4IQ1 A;  2IIY A;  1PX7 A;  2HT9 A;  4N11 A;  2XC2 A;  2H74 A;  2OE1 A;  3FR6 A;  3GFK A;  2K8S A;  2R3X A;  1C72 A;  2AB6 A;  4XTS A;  2TRX A;  5A5K A;  1AQW A;  2LJA A;  3Q6O A;  3TDG A;  6GSW A;  3GNJ A;  4F82 A;  1S3D A;  3GSS A;  2RII A;  1MD3 A;  2M46 A;  1XOB A;  4LMW A;  4GRF A;  1SL2 B;  5ECH B;  4MZC A;  1YY7 A;  1TI1 A;  4ZL7 A;  3A3T A;  2H75 A;  2GQL A;  3WYW A;  5CP1 A;  2HLS A;  4HEA 2;  4MPG A;  4MF5 A;  2F8F A;  1M2D A;  2HE3 A;  5IOX A;  2H1A A;  3FW2 A;  4F03 A;  3HVS A;  2JZS A;  5CO3 A;  3P7X A;  16GS A;  2GTU A;  3RHB A;  1NHO A;  2A2S A;  3QCP A;  5IMZ A;  3VWV A;  5DAK B;  4DSQ A;  1TOF A;  2FA8 A;  3QR6 A;  1NW2 A;  2ON7 A;  1QUW A;  2YV9 A;  1X0R A;  3D4M A;  2GT6 A;  2DBC A;  4FYC A;  2JSY A;  4L8E A;  2DJ2 A;  5IMC A;  1OAZ A;  4HUA A;  1V40 A;  5LD0 A;  1EEJ A;  1B4Q A;  2YWO A;  4NXI A;  4GST A;  2M66 A;  4HJ2 A;  1YF1 A;  1M9B A;  3WT2 A;  1UA5 A;  1TRS A;  2WS2 A;  2V2G A;  1EP7 A;  1JHB A;  3DWV A;  5HR1 A;  2PVO C;  5INY A;  5E4W A;  2YOI A;  2LQQ A;  4TR1 B;  1B9Y C;  3ZYW A;  4NHW A;  4MCU A;  1BJX A;  4KH7 A;  3VPT A;  4KSM A;  1GTA A;  2FD3 A;  4KUN A;  1X5D A;  3ZVJ D;  2IL3 A;  2LRN A;  1M7T A;  2WFC A;  4GWR A;  2LUS A;  5GAP D;  2KUC A;  2VO4 A;  4I5Q A;  2K9F A;  3GH6 A;  2PGT A;  1AC1 A;  3DYR A;  1EP8 A;  2WGR A;  1A0R P;  3HCZ A;  1UC7 A;  3ED3 A;  4JE1 A;  4EDY A;  4G19 A;  2FA4 A;  1THO A;  3E0U A;  2F51 A; 
#chains in the Genus database with same CATH topology
 1ZZY A;  1FOV A;  2MMZ A;  3ZIJ A;  4IP1 A;  1X5E A;  1G7E A;  1JLW A;  1PX6 A;  5GST A;  2IFQ B;  4L0U A;  4HOJ A;  1I9D A;  3VWU A;  2X4A A;  4D73 A;  1TTZ A;  1GSE A;  4IBP A;  3ZRD A;  1GSD A;  2A4H A;  5H5S A;  3UEM A;  1M0U A;  4KGI A;  2O8V B;  5D9T A;  1XFL A;  2XPD A;  3NIV A;  3TKS C;  4JR4 A;  4YAP A;  2HRF A;  1OKD A;  2DML A;  3EPT A;  2VUP A;  1A2L A;  2A4V A;  3H8Q A;  2PUK C;  1H75 A;  3KM6 A;  5JWQ B;  1X9W B;  2MMA A;  2MMO A;  4MH2 A;  4FYU A;  1YZX A;  5KEJ A;  2LNT A;  4X4J A;  1A0F A;  2QGV A;  1PQN A;  3TJB A;  5A4U A;  2WRT A;  3BJ5 A;  5CAX A;  1JZW A;  2H1B A;  1WWJ A;  3LXZ A;  5GAN D;  2C3T A;  2H71 A;  3L9S A;  4PTS A;  5ECO B;  1SL0 B;  2H73 A;  5G1K A;  2P5R A;  2VCX A;  3A2W A;  4O32 A;  5J41 A;  3GMF A;  3IE3 A;  1BG5 A;  1TW9 A;  4K1F A;  1O6J A;  4K2D A;  2AYT A;  3D5J A;  1EGR A;  4K2X A;  1FO5 A;  4ZL8 A;  4BL7 B;  4MJC A;  1MTC A;  4TKY A;  3F4T A;  1WOU A;  2IMF A;  1EOG A;  2WDU A;  4K6X A;  2I1U A;  3UIW A;  3G7J A;  4USS A;  4EVM A;  3I6A A;  5HR3 A;  4WEY A;  4XIH A;  2TRC P;  4BA7 A;  2FUG 2;  3C1R A;  2IME A;  4BIK A;  4ILF A;  2PMT A;  3CTF A;  4V2L A;  1LBK A;  4PGT A;  2HSH A;  3FR3 A;  1K0M A;  4I6X A;  2B5Y A;  2PN8 A;  3QDN A;  3P90 A;  1ABA A;  2N5F A;  2REM A;  4N0Z A;  2GQM A;  5KOX A;  5HFG A;  2J9H A;  2D2Z A;  2B1K A;  1TK8 B;  4AJ6 A;  3F4R A;  3WD6 A;  4YQV A;  2DJ0 A;  4EXJ A;  3ZLP A;  3IHG A;  4ZB9 A;  4X1U A;  3HKR A;  2NDO A;  4TXO A;  3FK8 A;  4KW6 A;  1K0O A;  3GX8 A;  4A5P A;  3A2X A;  2WUL A;  4JRR A;  5J5N A;  1YQ1 A;  2DMM A;  1HNC A;  1MD4 A;  3PPU A;  5KN1 A;  5CRD A;  17GS A;  4GTU A;  1Z3E A;  4ZXG A;  2QA2 A;  1SU9 A;  3IXR A;  3GKN A;  4IN0 A;  5G2Z A;  2C0F A;  1O7U A;  3GA4 A;  1T7P B;  1Z7R A;  1USB A;  3VPQ A;  3IAM 2;  4KND A;  3SWL A;  3M1G A;  3EUR A;  2IJY A;  1THX A;  1EEM A;  3JCM L;  2DJ3 A;  5EL8 A;  1M99 A;  4ZB6 A;  1VF2 A;  1PGT A;  4MF6 A;  2HSM A;  1I5G A;  2B7J A;  4TR0 A;  1F37 A;  3QOU A;  4IW9 A;  5ABR A;  5DAK A;  4XS6 A;  1PKZ A;  1XWC A;  2XHF A;  1FAA A;  3AY8 A;  1LJR A;  4HZ4 A;  2M80 A;  4CY8 A;  1ZMA A;  1URM A;  2Z9S A;  2JSZ A;  2R2J A;  4ZBB A;  3C71 A;  5EVO A;  1Z6M A;  4NMU A;  1XW9 A;  1A8Y A;  1DE1 A;  1E2Y A;  5IMA A;  1W89 A;  2RM5 A;  1GTI A;  1XWB A;  3L9V A;  3U5R E;  4N10 A;  3LYP A;  5G5E A;  4Q5R A;  4OWY A;  3CTG A;  4ID0 A;  3FMW A;  2LS5 A;  1K0D A;  1GWC A;  3CBU A;  3GTU B;  2FY6 A;  3A5W A;  4YAV A;  2FWF A;  5HR2 A;  4G0I A;  3R2Q A;  3RDW A;  3F3R A;  2MBT A;  3UBK A;  4L5L A;  2LJK A;  5ECM B;  4EDZ A;  4EIP A;  3BBY A;  1TK5 B;  3GYK A;  1T00 A;  3DIE A;  2AAW A;  4HSC X;  2L4Q A;  3FHK A;  12GS A;  3KD0 A;  2RUF A;  4IQA A;  2MBS A;  1OC9 A;  2E2G A;  2GT5 A;  2LRC A;  2V32 A;  3IAS 2;  3D6I A;  3TRQ A;  2O87 A;  5KOW A;  2FCH A;  4ML1 A;  5G30 A;  4RUV A;  1AQX A;  4J57 E;  3TRX A;  1VF1 A;  3F3Q A;  2C1Y A;  2IMK A;  1A23 A;  4MJB A;  1M3J A;  5IMF A;  1SD9 A;  3HY2 A;  2VL2 A;  4NV2 A;  1M2B A;  2DIZ A;  2H6Y A;  5IO0 A;  3KJY A;  2DKH A;  10GS A;  6GSV A;  3NOF A;  3GL5 A;  1ZCP A;  2HRK A;  1HD2 A;  3IHQ A;  3D22 A;  5JCW A;  4PQ1 A;  5IPG A;  4YQM A;  1PFO A;  3PH9 A;  1OE8 A;  2DJ1 A;  2H19 A;  2VLU A;  2BJX A;  3IR4 A;  1PL2 A;  5ECS A;  5ENU A;  1X9S B;  4WR5 A;  5D9W A;  3J7Y b;  3UVH A;  3WGE A;  1V9W A;  3NZN A;  1O8X A;  4NV5 A;  4NHZ A;  4WF4 A;  2IWT A;  4KCE A;  4KB3 A;  2KP2 A;  4O7H A;  5J9C A;  1EZK A;  2DJJ A;  13GS A;  1TRW A;  1ON4 A;  1TI3 A;  2WCI A;  3KH7 A;  4ICY A;  4LA1 A;  1Z7P A;  2J23 A;  4WBR D;  2YWI A;  1AAZ A;  4TXO B;  3EVI A;  1ERT A;  4K9Z A;  1DUG A;  3TJG A;  1R4W A;  1AXD A;  4E8E A;  1V98 A;  1ERW A;  1SYR A;  3FZA A;  5A4W A;  2YWM A;  2UZ8 A;  1WMJ A;  2L6C A;  1BYE A;  2ZNM A;  3PR8 A;  1OVN A;  2HZF A;  4JED A;  4JR6 A;  1A2M A;  2V6O A;  4K7O A;  3FR9 A;  4BVX A;  2PPT A;  2VCZ A;  5DCH A;  1GLQ A;  5DJM A;  3UL3 A;  2G2Q A;  2MYG A;  2V41 A;  3LG6 A;  4HQZ A;  4BL7 A;  5LNK e;  1MEK A;  3ISO A;  4NAX A;  3O76 A;  2GZY A;  1GTB A;  5LCZ A;  3BOA A;  4CW9 A;  2L5O A;  4I2U A;  11GS A;  1Z5Y E;  1SKW B;  3KCM A;  2WB9 A;  2VCW A;  4ZBD A;  1MDI A;  3FYG A;  2E2M A;  4N30 A;  1F6M C;  4LL4 B;  4YH2 A;  1B4P A;  3WGD A;  2DIY A;  1SL1 B;  4H86 A;  4MNN A;  4MMM A;  2LV3 A;  1S3A A;  4POL A;  4DSS B;  2EIO A;  3ZZX A;  4O5U A;  2QC7 A;  3ERF A;  5IMD A;  1QQ2 A;  3F6D A;  3E9J B;  4KA0 A;  1B9X C;  3FZ5 A;  5DVB A;  1JZO A;  3UAP A;  4QQ7 A;  1PMT A;  1BAY A;  3EMP A;  3ME7 A;  3LOR A;  2MMN A;  2OBI A;  4K8M A;  2GZZ A;  5KN0 A;  3KTB A;  2H0G A;  4Z7X A;  5D73 A;  2B3S A;  2C0D A;  2F8A A;  1PN0 A;  1UN2 A;  4MH3 A;  1ST9 A;  3N9J A;  2X64 A;  4K0G A;  3HA9 A;  2L57 A;  2A2R A;  3ERG A;  3GRX A;  4QL7 A;  4Z2T A;  4MPF A;  3P8W A;  3H4K A;  1TU8 A;  1Z6N A;  2CQ9 A;  3RHC A;  4MP4 A;  4ZB8 A;  3EC3 A;  2L59 A;  1R7H A;  1XW5 A;  3GKX A;  3KEB A;  2NPB A;  3M0F A;  5CNW A;  1ZYP A;  4TN8 A;  3MYD A;  5IPH A;  2K6V A;  2FGX A;  3LEF A;  1G7O A;  5ECL B;  5DQY A;  4PUA A;  3LXT A;  5CYY A;  1DE2 A;  8GSS A;  1WRY A;  3BD2 A;  1O73 A;  2QSI A;  1XBS A;  1OC9 B;  1HYU A;  2XBI A;  4G0K A;  3MIX A;  1O85 A;  5CRE A;  4PQH A;  4ECI A;  4G0L A;  4ZIJ A;  2P5Q A;  4GSN A;  1U3I A;  3LYK A;  2H1G A;  3EE2 A;  3PIN A;  4F9Z A;  3F63 A;  4IJI A;  4RI6 A;  2HXK A;  2F3M A;  1NHY A;  4OFT A;  3FY7 A;  3HDC A;  3IV4 A;  4NPB A;  3I69 A;  5E59 A;  1XVW A;  6GSS A;  1FHE A;  5C04 A;  4Z2R A;  3KGK A;  3HXS A;  1JFU A;  2GS3 A;  3KP9 A;  1T8E B;  2YN1 A;  3I9V 2;  2GLR A;  4HU9 A;  2X8H A;  4WXT A;  3GV1 A;  4XRA A;  2K8V A;  4JBB A;  2AV4 A;  1TXX A;  4IEL A;  3GTU A;  2B6M A;  2ZUP A;  3CRU A;  5FT3 A;  1QK8 A;  5HFI A;  2BMX A;  5J3R A;  1TK0 B;  4ACS A;  1K0B A;  1X9M B;  1NM3 A;  1IYI A;  1TP9 A;  3Q74 A;  4ZBA A;  6GSX A;  4K5S A;  4WF5 A;  3EIN A;  1SD8 A;  3EWL A;  4EUY A;  2X8G A;  3EMX A;  3APQ A;  3GH9 A;  3CSH A;  3QPM A;  2JZR A;  2L5L A;  3ZIT A;  3QAV A;  4MJE A;  4TVE A;  2H0H A;  3C8E A;  22GS A;  1SKR B;  3TGZ A;  2R0P A;  4KSO A;  4PUF C;  1GUH A;  1PKW A;  2H0I A;  3L9U A;  1UVZ A;  4V1A g;  2NVL A;  3PGT A;  1OKT A;  5BRT A;  1A8L A;  4BWS A;  2VL3 A;  2DLX A;  2I9H A;  1TRU A;  3Q19 A;  1G6Y A;  1W4V A;  4BVX B;  2GVP A;  1OYJ A;  4OFM A;  2HRN A;  4G2E A;  4XHM A;  5ECP B;  3RPP A;  2PWJ A;  3KIJ A;  4HQS A;  2VLV A;  3RBT A;  4YQU A;  2VL2 C;  2LKU A;  2JAD A;  2R37 A;  5J9B A;  1YJ6 A;  3TKS E;  2I3Y A;  1YEP A;  3LGC A;  5AIX A;  5DJL A;  3O3T A;  2CVD A;  2OE3 A;  1XZO A;  3KMN A;  2DJK A;  2DKI A;  3HYP A;  1JZR A;  4V2M A;  5ECI B;  3M9J A;  1SJZ A;  2C8U A;  1WPI A;  1OC3 A;  1V58 A;  2AUV A;  3KMO A;  1K0N A;  4BWQ A;  1XOA A;  1XXU A;  4GSS A;  4K5R A;  3L4N A;  5AIV A;  5F05 A;  5HQP A;  3KZQ A;  2YP6 A;  3KTL A;  2ZCT A;  3HD5 A;  18GS A;  2IMD A;  4XRD A;  3EYT A;  5D9X A;  3H93 A;  3RAZ A;  2LEG A;  4OD7 A;  3TCO A;  1YF0 A;  2H1D A;  2I81 A;  4K7N A;  1TDI A;  3TB2 A;  4HU7 A;  2I4A A;  4MK3 A;  1FOH A;  3TJJ A;  3GKM A;  2CAI A;  2QKE A;  4O92 A;  3KXO A;  5KN2 A;  2R0C A;  1PSQ A;  4K0N A;  3LWA A;  5IMV A;  4E8H A;  3APO A;  1EV9 A;  3W8J A;  2FWH A;  4IHU A;  5CRH A;  3FEU A;  4F0C A;  2ES7 A;  3GUR A;  4DSS A;  4KE3 A;  2VD0 A;  1T1V A;  3R3E A;  4LLR A;  3QFA C;  2P31 A;  1CQH A;  3F0I A;  1SKS B;  2LST A;  2C3N A;  2KP1 A;  1HNA A;  4X0X A;  3WT1 A;  2OAD A;  1QFN A;  2OAC A;  3UMA A;  4AGS A;  4PXO A;  2ON5 A;  4TR3 A;  2VAF A;  5DDL A;  1PRX A;  1F3B A;  3E3E A;  5ID2 B;  1GNW A;  2O7K A;  4FIW A;  4IKH A;  3V1W A;  9GSS A;  1B48 A;  1EGO A;  1K0A A;  2IN3 A;  1AQV A;  3EU4 A;  1GSY A;  1KTE A;  3LFL A;  4ECJ A;  6GSU A;  2ALB A;  1BX9 A;  3QD9 A;  1AW9 A;  1J08 A;  4BVY A;  1FB0 A;  1PL1 A;  2VM2 A;  2RM6 A;  2G0F A;  1WP0 A;  5H5Q A;  2YZU A;  2WJU A;  1GSU A;  2VD1 A;  2AHE A;  1ZYQ B;  2P0G A;  2YNX A;  2CAQ A;  3IK7 A;  2RUE A;  4QL9 A;  4POK A;  2GGT A;  2HI7 A;  2VL9 A;  1XWA A;  2VLT A;  3GKK A;  2R4V A;  4L5O A;  2C0E A;  4ECC A;  3ZL5 A;  1ZYE A;  2V6K A;  4LL1 B;  1ACV A;  1R26 A;  2JAC A;  3DML A;  1GP1 A;  4MF7 A;  2CX4 A;  2NTO A;  1K3Y A;  3TKR A;  1XPV A;  3VWW A;  5FHI A;  3GN3 A;  2XPE A;  3UAR A;  2M72 A;  4DVC A;  1CQG A;  1A2J A;  3CXG A;  2H76 A;  1U6T A;  3I43 A;  3BCK A;  4KX4 A;  3HJM A;  1PD2 1;  3DRN A;  1DBY A;  2YAN A;  2N5B A;  4OMV A;  1PN9 A;  4RQR A;  1TJD A;  1U3A A;  3MDK A;  5B6M A;  2KOK A;  5G31 A;  3APS A;  2HRA A;  1NSW A;  3ME8 A;  1M9A A;  5CRG A;  3IK9 A;  1N8J A;  3J7Y k;  4RI7 A;  4TW5 A;  3RPN A;  3UVT A;  5IOW A;  1T4Z A;  2B5X A;  4V1A p;  1EV4 A;  1K3L A;  2FWE A;  7GSS A;  4GCI A;  4HS1 A;  1YDK A;  5JWO B;  1M3I A;  4OO4 A;  3L78 A;  1TU7 A;  5GSS A;  3G7Y A;  3GIX A;  2GSR A;  1ILO A;  3HVV A;  1XWG A;  2KLX A;  1JZD A;  4K7I A;  3UJ1 A;  3GX0 A;  3A2V A;  1H4O A;  1Y6E A;  2LQO A;  3CRT A;  1EOH A;  14GS A;  1ZL9 A;  3TUE A;  3TJK A;  3FKF A;  5D8I A;  2B1L A;  2R6K A;  2XBQ A;  1XVQ A;  4O5Q A;  2N5A A;  4OCE A;  5COH A;  1DSB A;  2FHE A;  2F9S A;  4I2T A;  5JWR B;  3VLN A;  2NBS A;  3ZFL A;  2HFD A;  1ERV A;  3DD3 A;  3KP8 A;  3MAK A;  4EKZ A;  2GDR A;  1QGV A;  5AIS A;  5KN3 A;  1SK2 A;  1N2A A;  1S3R A;  1OC8 A;  2PVQ A;  3CYN A;  1RQM A;  2R0G A;  2X8C A;  4F2I A;  2OJL A;  1YKC A;  1WJK A;  3IBH A;  1J0F A;  1XW6 A;  1IYH A;  1MDJ A;  2OA7 A;  4BPY A;  1J9B A;  1TKD B;  1WIK A;  5J4U A;  2H72 A;  2PU9 C;  3P2A A;  4AF2 A;  2CT6 A;  5GZZ B;  4FO5 A;  6GSY A;  1A24 A;  4HJM A;  2X99 A;  5B6N A;  5D9V A;  3TJF A;  1ML6 A;  3F8U A;  3CMI A;  1X5C A;  3M8N A;  2B5E A;  2WZ9 A;  1WE0 A;  3C73 A;  4BVY B;  1ZGN A;  4J56 E;  4WR4 A;  3W8S A;  2V1M A;  4EF0 A;  3TRP A;  3LW9 A;  4V2N A;  5AN1 A;  1BQ7 A;  1KNG A;  4CHS A;  1U88 A;  5JCG A;  4POB A;  4IGJ A;  1FVJ A;  1R5A A;  2H66 A;  5HR0 A;  2X49 A;  1KBN A;  4CDO A;  3VK9 A;  5A4V A;  1F2E A;  4PX1 A;  5AGY A;  5DCG A;  1G7D A;  2CZ2 A;  3H1N A;  4Z2U A;  3L0H A;  2LJR A;  4MAB A;  1G6W A;  5D93 A;  5D96 A;  2FLS A;  2HZE A;  4P3Y B;  3US3 A;  2K18 A;  1LU4 A;  2OBK A;  3HHV A;  1SYX A;  5ECN B;  3S9F A;  1QMV A;  4POM A;  4CY6 A;  5CRW A;  4F0B A;  4GLT A;  4ECB A;  2BTO T;  2C3Q A;  3VFI A;  2L6D A;  4ML6 A;  3DVW A;  1F9M A;  1RK4 A;  1GUL A;  3DVX A;  5DAL A;  3IRA A;  5ID2 A;  1V57 A;  3ZFB A;  4PNF A;  4XS4 A;  4IS0 A;  5IIZ A;  3IPZ A;  3M9K A;  3F6F A;  3C7M A;  2CX3 A;  1Q4J A;  1U87 A;  3OR5 A;  4IJ3 A;  3QFB C;  3U6V A;  2YJ7 A;  3DEX A;  1HQO A;  1XG8 A;  3G7I A;  3LJR A;  4KDU A;  2KHP A;  4TOP A;  4Q5N A;  2GST A;  1O81 A;  5F07 A;  5H5R A;  4L0W A;  3QAG A;  5ECK B;  1ZYN A;  4MDC A;  1GNE A;  4WBJ A;  4X43 A;  3HZ4 A;  5EPF A;  4EE0 A;  3N5O A;  4WET A;  3VUR A;  1GRX A;  3CQF A;  2IPA A;  1Z9H A;  4PNG A;  4PQI A;  4HI7 A;  3HZ8 A;  3CSJ A;  3FZ9 A;  4OCF A;  2LTK A;  3UOM A;  1SJ6 A;  4LMV A;  1ZOF A;  4TXV A;  3ZIV A;  1PA3 A;  3HJP A;  2QA1 A;  4OFN A;  3SBC A;  2H8L A;  2CA8 A;  1GTU A;  4KDX A;  4I8B A;  3UBL A;  4MZB A;  4AJ7 A;  1VF3 A;  4NWY A;  4TRX A;  2YPM A;  4ULX A;  3LQ7 A;  19GS A;  1XIY A;  1GSQ A;  3KH9 A;  5G1L A;  2VIM A;  3Q18 A;  2JL4 A;  1XWK A;  1OE7 A;  4XS1 A;  4PUR A;  2HYX A;  4EO3 A;  1EWX A;  2C0G A;  2OE0 A;  2JU5 A;  3FRC A;  5ELG A;  3MNG A;  4O5R A;  1GL8 A;  2H6X A;  3ZRE A;  4EL1 A;  4G9H A;  3DGQ A;  2PBJ A;  1RW1 A;  3H79 A;  4J2F A;  2H6Z A;  2YJH A;  1R5P A;  1S3C A;  2L4C A;  1F3A A;  1V2A A;  2TIR A;  1GUM A;  2FNO A;  2OKA A;  5F06 A;  1K0C A;  4HDE A;  3O6T A;  2AJQ B;  1Y25 A;  2YV7 A;  4MZW A;  2VM1 A;  3MWH A;  4KAE A;  3BCI A;  4I97 A;  4KCA A;  3ZML A;  3VI5 A;  3D0Z A;  1GUK A;  4XCS A;  1VF4 A;  2E0Q A;  2B7K A;  5HFK A;  3DKS A;  5IQY A;  2GQK A;  4YKF A;  3IDV A;  1VRS D;  4IP6 A;  5ECR B;  1SK1 A;  3VWX A;  1GH2 A;  3HJO A;  4JZQ A;  1KEB A;  5JCU A;  2HSY A;  1FB6 A;  4IVF A;  2VOC A;  5ECQ B;  3M3M A;  3TOU A;  1K3O A;  3D4T A;  4MLY A;  1QXH A;  4G10 A;  3ZTL A;  2E7P A;  2HZE B;  2CVB A;  5F8B A;  3C1S A;  1VGL A;  3CSI A;  2H30 A;  5DBQ A;  3MSZ A;  20GS A;  4Q5F A;  1G0T A;  1MDK A;  4HZ2 A;  5B8A A;  5DAL B;  5B7C A;  3W6G A;  5FWG A;  2DC5 A;  2CVK A;  4D73 B;  4XS4 B;  1Q98 A;  4GQC A;  2YZH A;  3IOS A;  1GSF A;  2O85 A;  3TKS A;  2DSA A;  2YCD A;  2CV4 A;  4GXZ A;  5BMU A;  3TKQ A;  4FYB A;  4GQF A;  1M2A A;  4ZIL A;  3K8N A;  2CZ3 A;  4DSR A;  5DQS A;  2VCQ A;  3GHA A;  2GZP A;  4Q5Q A;  2C4J A;  2MZC A;  4TR1 A;  1ERU A;  5IO2 A;  1YEX A;  4EIQ A;  3TOT A;  4MA9 A;  6GST A;  1T4Y A;  3VI7 A;  4FH8 A;  2EC4 A;  3QMX A;  4KF9 A;  5C00 A;  3IA1 A;  3GL3 A;  5B8B A;  1O8W A;  2LNS A;  1GSS A;  3GUS A;  1BED A;  1JLV A;  2H70 A;  3G9B A;  2GSQ A;  4AJ8 A;  1SJI A;  4RQX A;  3DXB A;  5F0G A;  2RLI A;  2HNL A;  2C80 A;  1T3B A;  3ZVJ A;  2FWG A;  2LRT A;  4WKW A;  2JZT A;  5G5F A;  4ZL9 A;  1FG4 A;  3HVN A;  3IC4 A;  2EIQ A;  3QAW A;  2EIR A;  5ELA A;  4TR4 A;  4MJA A;  2IFQ A;  1YKA A;  3TKP A;  2VCV A;  1E6B A;  4JU5 A;  3ZMK A;  4KDY A;  1HNB A;  3ERW A;  5L71 A;  3D21 A;  3F4S A;  2O89 A;  1TRV A;  3FZ4 A;  1SEN A;  2VCT A;  4N0V A;  3HVX A;  3EU3 A;  1XCC A;  5EY6 A;  4OO5 A;  4GF0 A;  1AIU A;  4EC0 A;  2IMI A;  1AUC A;  4ISD A;  5IM9 A;  1SK0 A;  3GST A;  2PER A;  3WGX A;  3F9U A;  1FVK A;  1GLP A;  1B8X A;  2YWN A;  2R5G A;  2H01 A;  2GSS A;  3LSZ A;  4DEJ A;  1FW1 A;  3A5I A;  4IQ1 A;  2IIY A;  3IC8 A;  1PX7 A;  2HT9 A;  4N11 A;  2XC2 A;  2H74 A;  2OE1 A;  3FR6 A;  3GFK A;  2K8S A;  2R3X A;  1C72 A;  2AB6 A;  4XTS A;  2TRX A;  5A5K A;  1AQW A;  2LJA A;  3Q6O A;  3TDG A;  6GSW A;  3GNJ A;  4F82 A;  1S3D A;  3GSS A;  2RII A;  1MD3 A;  2M46 A;  1XOB A;  4LMW A;  4GRF A;  1SL2 B;  5ECH B;  4MZC A;  1YY7 A;  1TI1 A;  4FQU A;  4ZL7 A;  3A3T A;  2H75 A;  2GQL A;  3WYW A;  5CP1 A;  2HLS A;  4HEA 2;  4MPG A;  4MF5 A;  2F8F A;  1M2D A;  2HE3 A;  5IOX A;  2H1A A;  3FW2 A;  4F03 A;  3HVS A;  2JZS A;  5CO3 A;  3P7X A;  16GS A;  2GTU A;  3RHB A;  1NHO A;  2A2S A;  3QCP A;  5IMZ A;  3VWV A;  5DAK B;  4DSQ A;  1TOF A;  2FA8 A;  3QR6 A;  1NW2 A;  2ON7 A;  1QUW A;  2YV9 A;  1X0R A;  3D4M A;  2GT6 A;  2DBC A;  4YKG A;  4FYC A;  2JSY A;  4L8E A;  2DJ2 A;  5IMC A;  1OAZ A;  4HUA A;  1V40 A;  5LD0 A;  1EEJ A;  1B4Q A;  2YWO A;  4NXI A;  4GST A;  2M66 A;  4HJ2 A;  1YF1 A;  1M9B A;  3WT2 A;  1UA5 A;  1TRS A;  2WS2 A;  2V2G A;  1EP7 A;  1JHB A;  3DWV A;  2A2P A;  5HR1 A;  2PVO C;  5INY A;  5E4W A;  2YOI A;  2LQQ A;  4TR1 B;  1B9Y C;  3ZYW A;  4NHW A;  4MCU A;  1BJX A;  4KH7 A;  3VPT A;  4KSM A;  1GTA A;  2FD3 A;  4KUN A;  1X5D A;  3ZVJ D;  2IL3 A;  2LRN A;  1M7T A;  2WFC A;  4GWR A;  2LUS A;  5GAP D;  2KUC A;  2VO4 A;  4I5Q A;  2K9F A;  3GH6 A;  2PGT A;  1AC1 A;  3DYR A;  1EP8 A;  2WGR A;  1A0R P;  3HCZ A;  1UC7 A;  3ED3 A;  4JE1 A;  4EDY A;  4G19 A;  2FA4 A;  1THO A;  3E0U A;  2F51 A; 
#chains in the Genus database with same CATH homology
 1ZZY A;  1FOV A;  2MMZ A;  3ZIJ A;  4IP1 A;  1X5E A;  1G7E A;  1JLW A;  1PX6 A;  5GST A;  2IFQ B;  4L0U A;  4HOJ A;  1I9D A;  3VWU A;  2X4A A;  4D73 A;  1TTZ A;  1GSE A;  4IBP A;  3ZRD A;  1GSD A;  2A4H A;  5H5S A;  3UEM A;  1M0U A;  4KGI A;  2O8V B;  5D9T A;  1XFL A;  2XPD A;  3NIV A;  3TKS C;  4JR4 A;  4YAP A;  2HRF A;  1OKD A;  2DML A;  3EPT A;  2VUP A;  1A2L A;  2A4V A;  3H8Q A;  2PUK C;  1H75 A;  3KM6 A;  5JWQ B;  1X9W B;  2MMA A;  2MMO A;  4MH2 A;  4FYU A;  1YZX A;  5KEJ A;  2LNT A;  4X4J A;  1A0F A;  2QGV A;  1PQN A;  3TJB A;  5A4U A;  2WRT A;  3BJ5 A;  5CAX A;  1JZW A;  2H1B A;  1WWJ A;  3LXZ A;  5GAN D;  2C3T A;  2H71 A;  3L9S A;  4PTS A;  5ECO B;  1SL0 B;  2H73 A;  5G1K A;  2P5R A;  2VCX A;  3A2W A;  4O32 A;  5J41 A;  3GMF A;  3IE3 A;  1BG5 A;  1TW9 A;  4K1F A;  1O6J A;  4K2D A;  2AYT A;  3D5J A;  1EGR A;  4K2X A;  1FO5 A;  4ZL8 A;  4BL7 B;  4MJC A;  1MTC A;  4TKY A;  3F4T A;  1WOU A;  2IMF A;  1EOG A;  2WDU A;  4K6X A;  2I1U A;  3UIW A;  3G7J A;  4USS A;  4EVM A;  3I6A A;  5HR3 A;  4WEY A;  4XIH A;  2TRC P;  4BA7 A;  2FUG 2;  3C1R A;  2IME A;  4ILF A;  2PMT A;  3CTF A;  4V2L A;  1LBK A;  4PGT A;  2HSH A;  3FR3 A;  1K0M A;  4I6X A;  2B5Y A;  2PN8 A;  3QDN A;  3P90 A;  1ABA A;  2N5F A;  2REM A;  4N0Z A;  2GQM A;  5KOX A;  5HFG A;  2J9H A;  2D2Z A;  2B1K A;  1TK8 B;  4AJ6 A;  3F4R A;  3WD6 A;  4YQV A;  2DJ0 A;  4EXJ A;  3ZLP A;  3IHG A;  4ZB9 A;  4X1U A;  3HKR A;  2NDO A;  4TXO A;  3FK8 A;  4KW6 A;  1K0O A;  3GX8 A;  4A5P A;  3A2X A;  2WUL A;  4JRR A;  5J5N A;  1YQ1 A;  2DMM A;  1HNC A;  1MD4 A;  3PPU A;  5KN1 A;  5CRD A;  17GS A;  4GTU A;  1Z3E A;  4ZXG A;  2QA2 A;  1SU9 A;  3IXR A;  3GKN A;  4IN0 A;  5G2Z A;  2C0F A;  1O7U A;  3GA4 A;  1T7P B;  1Z7R A;  1USB A;  3VPQ A;  3IAM 2;  4KND A;  3SWL A;  3M1G A;  3EUR A;  2IJY A;  1THX A;  1EEM A;  3JCM L;  2DJ3 A;  5EL8 A;  1M99 A;  4ZB6 A;  1VF2 A;  1PGT A;  4MF6 A;  2HSM A;  1I5G A;  2B7J A;  4TR0 A;  1F37 A;  3QOU A;  4IW9 A;  5ABR A;  5DAK A;  4XS6 A;  1PKZ A;  1XWC A;  2XHF A;  1FAA A;  3AY8 A;  1LJR A;  4HZ4 A;  2M80 A;  4CY8 A;  1ZMA A;  1URM A;  2Z9S A;  2JSZ A;  2R2J A;  4ZBB A;  3C71 A;  5EVO A;  1Z6M A;  4NMU A;  1XW9 A;  1A8Y A;  1DE1 A;  1E2Y A;  5IMA A;  1W89 A;  2RM5 A;  1GTI A;  1XWB A;  3L9V A;  3U5R E;  4N10 A;  3LYP A;  5G5E A;  4Q5R A;  4OWY A;  3CTG A;  4ID0 A;  3FMW A;  2LS5 A;  1K0D A;  1GWC A;  3CBU A;  3GTU B;  2FY6 A;  3A5W A;  4YAV A;  2FWF A;  5HR2 A;  4G0I A;  3R2Q A;  3RDW A;  3F3R A;  2MBT A;  3UBK A;  4L5L A;  2LJK A;  5ECM B;  4EDZ A;  4EIP A;  3BBY A;  1TK5 B;  3GYK A;  1T00 A;  3DIE A;  2AAW A;  2L4Q A;  3FHK A;  12GS A;  3KD0 A;  2RUF A;  4IQA A;  2MBS A;  1OC9 A;  2E2G A;  2GT5 A;  2LRC A;  2V32 A;  3IAS 2;  3D6I A;  3TRQ A;  2O87 A;  5KOW A;  2FCH A;  4ML1 A;  5G30 A;  4RUV A;  1AQX A;  4J57 E;  3TRX A;  1VF1 A;  3F3Q A;  2C1Y A;  2IMK A;  1A23 A;  4MJB A;  5IMF A;  1SD9 A;  3HY2 A;  2VL2 A;  4NV2 A;  1M2B A;  2DIZ A;  2H6Y A;  5IO0 A;  3KJY A;  2DKH A;  10GS A;  6GSV A;  3NOF A;  3GL5 A;  1ZCP A;  2HRK A;  1HD2 A;  3IHQ A;  3D22 A;  5JCW A;  4PQ1 A;  5IPG A;  4YQM A;  3PH9 A;  1OE8 A;  2DJ1 A;  2H19 A;  2VLU A;  2BJX A;  3IR4 A;  1PL2 A;  5ECS A;  5ENU A;  1X9S B;  4WR5 A;  5D9W A;  3J7Y b;  3UVH A;  3WGE A;  1V9W A;  3NZN A;  1O8X A;  4NV5 A;  4NHZ A;  4WF4 A;  2IWT A;  4KCE A;  4KB3 A;  2KP2 A;  4O7H A;  5J9C A;  1EZK A;  2DJJ A;  13GS A;  1TRW A;  1ON4 A;  1TI3 A;  2WCI A;  3KH7 A;  4ICY A;  4LA1 A;  1Z7P A;  2J23 A;  4WBR D;  2YWI A;  1AAZ A;  4TXO B;  3EVI A;  1ERT A;  4K9Z A;  1DUG A;  3TJG A;  1R4W A;  1AXD A;  4E8E A;  1V98 A;  1ERW A;  1SYR A;  3FZA A;  5A4W A;  2YWM A;  2UZ8 A;  1WMJ A;  2L6C A;  1BYE A;  2ZNM A;  3PR8 A;  1OVN A;  2HZF A;  4JED A;  4JR6 A;  1A2M A;  2V6O A;  4K7O A;  3FR9 A;  4BVX A;  2PPT A;  2VCZ A;  5DCH A;  1GLQ A;  5DJM A;  3UL3 A;  2G2Q A;  2MYG A;  2V41 A;  3LG6 A;  4HQZ A;  4BL7 A;  5LNK e;  1MEK A;  3ISO A;  4NAX A;  3O76 A;  2GZY A;  1GTB A;  5LCZ A;  3BOA A;  4CW9 A;  2L5O A;  4I2U A;  11GS A;  1Z5Y E;  1SKW B;  3KCM A;  2WB9 A;  2VCW A;  4ZBD A;  1MDI A;  3FYG A;  2E2M A;  4N30 A;  1F6M C;  4LL4 B;  4YH2 A;  1B4P A;  3WGD A;  2DIY A;  1SL1 B;  4H86 A;  4MNN A;  4MMM A;  2LV3 A;  1S3A A;  4POL A;  4DSS B;  2EIO A;  3ZZX A;  4O5U A;  2QC7 A;  3ERF A;  5IMD A;  1QQ2 A;  3F6D A;  3E9J B;  4KA0 A;  1B9X C;  3FZ5 A;  5DVB A;  1JZO A;  3UAP A;  4QQ7 A;  1PMT A;  1BAY A;  3EMP A;  3ME7 A;  3LOR A;  2MMN A;  2OBI A;  4K8M A;  2GZZ A;  5KN0 A;  3KTB A;  2H0G A;  4Z7X A;  5D73 A;  2B3S A;  2C0D A;  2F8A A;  1PN0 A;  1UN2 A;  4MH3 A;  1ST9 A;  3N9J A;  2X64 A;  4K0G A;  3HA9 A;  2L57 A;  2A2R A;  3ERG A;  3GRX A;  4QL7 A;  4Z2T A;  4MPF A;  3P8W A;  3H4K A;  1TU8 A;  1Z6N A;  2CQ9 A;  3RHC A;  4MP4 A;  4ZB8 A;  3EC3 A;  2L59 A;  1R7H A;  1XW5 A;  3GKX A;  3KEB A;  2NPB A;  3M0F A;  5CNW A;  1ZYP A;  4TN8 A;  3MYD A;  5IPH A;  2K6V A;  2FGX A;  3LEF A;  1G7O A;  5ECL B;  5DQY A;  4PUA A;  3LXT A;  5CYY A;  1DE2 A;  8GSS A;  1WRY A;  3BD2 A;  1O73 A;  2QSI A;  1XBS A;  1OC9 B;  1HYU A;  2XBI A;  4G0K A;  3MIX A;  1O85 A;  5CRE A;  4PQH A;  4ECI A;  4G0L A;  4ZIJ A;  2P5Q A;  4GSN A;  1U3I A;  3LYK A;  2H1G A;  3EE2 A;  3PIN A;  4F9Z A;  3F63 A;  4IJI A;  4RI6 A;  2HXK A;  2F3M A;  1NHY A;  4OFT A;  3FY7 A;  3HDC A;  3IV4 A;  4NPB A;  3I69 A;  5E59 A;  1XVW A;  6GSS A;  1FHE A;  5C04 A;  4Z2R A;  3KGK A;  3HXS A;  1JFU A;  2GS3 A;  3KP9 A;  1T8E B;  2YN1 A;  3I9V 2;  2GLR A;  4HU9 A;  2X8H A;  4WXT A;  3GV1 A;  4XRA A;  2K8V A;  4JBB A;  2AV4 A;  1TXX A;  4IEL A;  3GTU A;  2B6M A;  2ZUP A;  3CRU A;  5FT3 A;  1QK8 A;  5HFI A;  2BMX A;  5J3R A;  1TK0 B;  4ACS A;  1K0B A;  1X9M B;  1NM3 A;  1IYI A;  1TP9 A;  3Q74 A;  4ZBA A;  6GSX A;  4K5S A;  4WF5 A;  3EIN A;  1SD8 A;  3EWL A;  4EUY A;  2X8G A;  3EMX A;  3APQ A;  3GH9 A;  3CSH A;  3QPM A;  2JZR A;  2L5L A;  3ZIT A;  3QAV A;  4MJE A;  4TVE A;  2H0H A;  3C8E A;  22GS A;  1SKR B;  3TGZ A;  2R0P A;  4KSO A;  4PUF C;  1GUH A;  1PKW A;  2H0I A;  3L9U A;  1UVZ A;  4V1A g;  2NVL A;  3PGT A;  1OKT A;  5BRT A;  1A8L A;  4BWS A;  2VL3 A;  2DLX A;  2I9H A;  1TRU A;  3Q19 A;  1G6Y A;  1W4V A;  4BVX B;  2GVP A;  1OYJ A;  4OFM A;  2HRN A;  4G2E A;  4XHM A;  5ECP B;  3RPP A;  2PWJ A;  3KIJ A;  4HQS A;  2VLV A;  3RBT A;  4YQU A;  2VL2 C;  2LKU A;  2JAD A;  2R37 A;  5J9B A;  1YJ6 A;  3TKS E;  2I3Y A;  1YEP A;  3LGC A;  5AIX A;  5DJL A;  3O3T A;  2CVD A;  2OE3 A;  1XZO A;  3KMN A;  2DJK A;  2DKI A;  3HYP A;  1JZR A;  4V2M A;  5ECI B;  3M9J A;  1SJZ A;  2C8U A;  1WPI A;  1OC3 A;  1V58 A;  2AUV A;  3KMO A;  1K0N A;  4BWQ A;  1XOA A;  1XXU A;  4GSS A;  4K5R A;  3L4N A;  5AIV A;  5F05 A;  5HQP A;  3KZQ A;  2YP6 A;  3KTL A;  2ZCT A;  3HD5 A;  18GS A;  2IMD A;  4XRD A;  3EYT A;  5D9X A;  3H93 A;  3RAZ A;  2LEG A;  4OD7 A;  3TCO A;  1YF0 A;  2H1D A;  2I81 A;  4K7N A;  1TDI A;  3TB2 A;  4HU7 A;  2I4A A;  4MK3 A;  1FOH A;  3TJJ A;  3GKM A;  2CAI A;  2QKE A;  4O92 A;  3KXO A;  5KN2 A;  2R0C A;  1PSQ A;  4K0N A;  3LWA A;  5IMV A;  4E8H A;  3APO A;  1EV9 A;  3W8J A;  2FWH A;  4IHU A;  5CRH A;  3FEU A;  4F0C A;  2ES7 A;  3GUR A;  4DSS A;  4KE3 A;  2VD0 A;  1T1V A;  3R3E A;  4LLR A;  3QFA C;  2P31 A;  1CQH A;  3F0I A;  1SKS B;  2LST A;  2C3N A;  2KP1 A;  1HNA A;  4X0X A;  3WT1 A;  2OAD A;  1QFN A;  2OAC A;  3UMA A;  4AGS A;  4PXO A;  2ON5 A;  4TR3 A;  2VAF A;  5DDL A;  1PRX A;  1F3B A;  3E3E A;  5ID2 B;  1GNW A;  2O7K A;  4FIW A;  4IKH A;  3V1W A;  9GSS A;  1B48 A;  1EGO A;  1K0A A;  2IN3 A;  1AQV A;  3EU4 A;  1GSY A;  1KTE A;  3LFL A;  4ECJ A;  6GSU A;  2ALB A;  1BX9 A;  3QD9 A;  1AW9 A;  1J08 A;  4BVY A;  1FB0 A;  1PL1 A;  2VM2 A;  2RM6 A;  2G0F A;  1WP0 A;  5H5Q A;  2YZU A;  2WJU A;  1GSU A;  2VD1 A;  2AHE A;  1ZYQ B;  2P0G A;  2YNX A;  2CAQ A;  3IK7 A;  2RUE A;  4QL9 A;  4POK A;  2GGT A;  2HI7 A;  2VL9 A;  1XWA A;  2VLT A;  3GKK A;  2R4V A;  4L5O A;  2C0E A;  4ECC A;  3ZL5 A;  1ZYE A;  2V6K A;  4LL1 B;  1ACV A;  1R26 A;  2JAC A;  3DML A;  1GP1 A;  4MF7 A;  2CX4 A;  2NTO A;  1K3Y A;  3TKR A;  1XPV A;  3VWW A;  5FHI A;  3GN3 A;  2XPE A;  3UAR A;  2M72 A;  4DVC A;  1CQG A;  1A2J A;  3CXG A;  2H76 A;  1U6T A;  3I43 A;  3BCK A;  4KX4 A;  3HJM A;  1PD2 1;  3DRN A;  1DBY A;  2YAN A;  2N5B A;  4OMV A;  1PN9 A;  4RQR A;  1TJD A;  1U3A A;  3MDK A;  5B6M A;  2KOK A;  5G31 A;  3APS A;  2HRA A;  1NSW A;  3ME8 A;  1M9A A;  5CRG A;  3IK9 A;  1N8J A;  3J7Y k;  4RI7 A;  4TW5 A;  3RPN A;  3UVT A;  5IOW A;  1T4Z A;  2B5X A;  4V1A p;  1EV4 A;  1K3L A;  2FWE A;  7GSS A;  4GCI A;  4HS1 A;  1YDK A;  5JWO B;  4OO4 A;  3L78 A;  1TU7 A;  5GSS A;  3G7Y A;  3GIX A;  2GSR A;  1ILO A;  3HVV A;  1XWG A;  2KLX A;  1JZD A;  4K7I A;  3UJ1 A;  3GX0 A;  3A2V A;  1H4O A;  1Y6E A;  2LQO A;  3CRT A;  1EOH A;  14GS A;  1ZL9 A;  3TUE A;  3TJK A;  3FKF A;  5D8I A;  2B1L A;  2R6K A;  2XBQ A;  1XVQ A;  4O5Q A;  2N5A A;  4OCE A;  5COH A;  1DSB A;  2FHE A;  2F9S A;  4I2T A;  5JWR B;  3VLN A;  2NBS A;  3ZFL A;  2HFD A;  1ERV A;  3DD3 A;  3KP8 A;  3MAK A;  4EKZ A;  2GDR A;  1QGV A;  5AIS A;  5KN3 A;  1SK2 A;  1N2A A;  1OC8 A;  2PVQ A;  3CYN A;  1RQM A;  2R0G A;  2X8C A;  4F2I A;  2OJL A;  1YKC A;  1WJK A;  3IBH A;  1J0F A;  1XW6 A;  1IYH A;  1MDJ A;  2OA7 A;  4BPY A;  1J9B A;  1TKD B;  1WIK A;  5J4U A;  2H72 A;  2PU9 C;  3P2A A;  4AF2 A;  2CT6 A;  5GZZ B;  4FO5 A;  6GSY A;  1A24 A;  4HJM A;  2X99 A;  5B6N A;  5D9V A;  3TJF A;  1ML6 A;  3F8U A;  3CMI A;  1X5C A;  3M8N A;  2B5E A;  2WZ9 A;  1WE0 A;  3C73 A;  4BVY B;  1ZGN A;  4J56 E;  4WR4 A;  3W8S A;  2V1M A;  4EF0 A;  3TRP A;  3LW9 A;  4V2N A;  5AN1 A;  1BQ7 A;  1KNG A;  4CHS A;  1U88 A;  5JCG A;  4POB A;  4IGJ A;  1FVJ A;  1R5A A;  2H66 A;  5HR0 A;  2X49 A;  1KBN A;  4CDO A;  3VK9 A;  5A4V A;  1F2E A;  4PX1 A;  5AGY A;  5DCG A;  1G7D A;  2CZ2 A;  3H1N A;  4Z2U A;  3L0H A;  2LJR A;  4MAB A;  1G6W A;  5D93 A;  5D96 A;  2FLS A;  2HZE A;  4P3Y B;  3US3 A;  2K18 A;  1LU4 A;  2OBK A;  3HHV A;  1SYX A;  5ECN B;  3S9F A;  1QMV A;  4POM A;  4CY6 A;  5CRW A;  4F0B A;  4GLT A;  4ECB A;  2BTO T;  2C3Q A;  3VFI A;  2L6D A;  4ML6 A;  3DVW A;  1F9M A;  1RK4 A;  1GUL A;  3DVX A;  5DAL A;  3IRA A;  5ID2 A;  1V57 A;  3ZFB A;  4PNF A;  4XS4 A;  4IS0 A;  5IIZ A;  3IPZ A;  3M9K A;  3F6F A;  3C7M A;  2CX3 A;  1Q4J A;  1U87 A;  3OR5 A;  4IJ3 A;  3QFB C;  3U6V A;  2YJ7 A;  3DEX A;  1HQO A;  3G7I A;  3LJR A;  4KDU A;  2KHP A;  4TOP A;  4Q5N A;  2GST A;  1O81 A;  5F07 A;  5H5R A;  4L0W A;  3QAG A;  5ECK B;  1ZYN A;  4MDC A;  1GNE A;  4WBJ A;  4X43 A;  3HZ4 A;  5EPF A;  4EE0 A;  3N5O A;  4WET A;  3VUR A;  1GRX A;  2IPA A;  1Z9H A;  4PNG A;  4PQI A;  4HI7 A;  3HZ8 A;  3CSJ A;  3FZ9 A;  4OCF A;  2LTK A;  3UOM A;  1SJ6 A;  4LMV A;  1ZOF A;  4TXV A;  3ZIV A;  1PA3 A;  3HJP A;  2QA1 A;  4OFN A;  3SBC A;  2H8L A;  2CA8 A;  1GTU A;  4KDX A;  4I8B A;  3UBL A;  4MZB A;  4AJ7 A;  1VF3 A;  4NWY A;  4TRX A;  2YPM A;  4ULX A;  3LQ7 A;  19GS A;  1XIY A;  1GSQ A;  3KH9 A;  5G1L A;  2VIM A;  3Q18 A;  2JL4 A;  1XWK A;  1OE7 A;  4XS1 A;  4PUR A;  2HYX A;  4EO3 A;  1EWX A;  2C0G A;  2OE0 A;  2JU5 A;  3FRC A;  5ELG A;  3MNG A;  4O5R A;  1GL8 A;  2H6X A;  3ZRE A;  4EL1 A;  4G9H A;  3DGQ A;  2PBJ A;  1RW1 A;  3H79 A;  4J2F A;  2H6Z A;  2YJH A;  1R5P A;  1S3C A;  2L4C A;  1F3A A;  1V2A A;  2TIR A;  1GUM A;  2FNO A;  2OKA A;  5F06 A;  1K0C A;  4HDE A;  3O6T A;  2AJQ B;  1Y25 A;  2YV7 A;  4MZW A;  2VM1 A;  3MWH A;  4KAE A;  3BCI A;  4I97 A;  4KCA A;  3ZML A;  3VI5 A;  3D0Z A;  1GUK A;  4XCS A;  1VF4 A;  2E0Q A;  2B7K A;  5HFK A;  3DKS A;  5IQY A;  2GQK A;  4YKF A;  3IDV A;  1VRS D;  4IP6 A;  5ECR B;  1SK1 A;  3VWX A;  1GH2 A;  3HJO A;  4JZQ A;  1KEB A;  5JCU A;  2HSY A;  1FB6 A;  4IVF A;  2VOC A;  5ECQ B;  3M3M A;  3TOU A;  1K3O A;  3D4T A;  4MLY A;  1QXH A;  4G10 A;  3ZTL A;  2E7P A;  2HZE B;  2CVB A;  5F8B A;  3C1S A;  1VGL A;  3CSI A;  2H30 A;  5DBQ A;  3MSZ A;  20GS A;  4Q5F A;  1G0T A;  1MDK A;  4HZ2 A;  5B8A A;  5DAL B;  5B7C A;  3W6G A;  5FWG A;  2DC5 A;  2CVK A;  4D73 B;  4XS4 B;  1Q98 A;  4GQC A;  2YZH A;  3IOS A;  1GSF A;  2O85 A;  3TKS A;  2DSA A;  2YCD A;  2CV4 A;  4GXZ A;  5BMU A;  3TKQ A;  4FYB A;  4GQF A;  1M2A A;  4ZIL A;  3K8N A;  2CZ3 A;  4DSR A;  5DQS A;  2VCQ A;  3GHA A;  2GZP A;  4Q5Q A;  2C4J A;  2MZC A;  4TR1 A;  1ERU A;  5IO2 A;  1YEX A;  4EIQ A;  3TOT A;  4MA9 A;  6GST A;  1T4Y A;  3VI7 A;  4FH8 A;  2EC4 A;  3QMX A;  4KF9 A;  5C00 A;  3IA1 A;  3GL3 A;  5B8B A;  1O8W A;  2LNS A;  1GSS A;  3GUS A;  1BED A;  1JLV A;  2H70 A;  3G9B A;  2GSQ A;  4AJ8 A;  1SJI A;  4RQX A;  3DXB A;  5F0G A;  2RLI A;  2HNL A;  2C80 A;  1T3B A;  3ZVJ A;  2FWG A;  2LRT A;  4WKW A;  2JZT A;  5G5F A;  4ZL9 A;  1FG4 A;  3IC4 A;  2EIQ A;  3QAW A;  2EIR A;  5ELA A;  4TR4 A;  4MJA A;  2IFQ A;  1YKA A;  3TKP A;  2VCV A;  1E6B A;  4JU5 A;  3ZMK A;  4KDY A;  1HNB A;  3ERW A;  5L71 A;  3D21 A;  3F4S A;  2O89 A;  1TRV A;  3FZ4 A;  1SEN A;  2VCT A;  4N0V A;  3HVX A;  3EU3 A;  1XCC A;  5EY6 A;  4OO5 A;  4GF0 A;  1AIU A;  4EC0 A;  2IMI A;  1AUC A;  4ISD A;  5IM9 A;  1SK0 A;  3GST A;  2PER A;  3WGX A;  3F9U A;  1FVK A;  1GLP A;  1B8X A;  2YWN A;  2R5G A;  2H01 A;  2GSS A;  3LSZ A;  4DEJ A;  1FW1 A;  3A5I A;  4IQ1 A;  2IIY A;  3IC8 A;  1PX7 A;  2HT9 A;  4N11 A;  2XC2 A;  2H74 A;  2OE1 A;  3FR6 A;  3GFK A;  2K8S A;  2R3X A;  1C72 A;  2AB6 A;  4XTS A;  2TRX A;  5A5K A;  1AQW A;  2LJA A;  3Q6O A;  3TDG A;  6GSW A;  3GNJ A;  4F82 A;  1S3D A;  3GSS A;  2RII A;  1MD3 A;  2M46 A;  1XOB A;  4LMW A;  4GRF A;  1SL2 B;  5ECH B;  4MZC A;  1YY7 A;  1TI1 A;  4FQU A;  4ZL7 A;  3A3T A;  2H75 A;  2GQL A;  3WYW A;  5CP1 A;  2HLS A;  4HEA 2;  4MPG A;  4MF5 A;  2F8F A;  1M2D A;  2HE3 A;  5IOX A;  2H1A A;  3FW2 A;  4F03 A;  3HVS A;  2JZS A;  5CO3 A;  3P7X A;  16GS A;  2GTU A;  3RHB A;  1NHO A;  2A2S A;  3QCP A;  5IMZ A;  3VWV A;  5DAK B;  4DSQ A;  1TOF A;  2FA8 A;  3QR6 A;  1NW2 A;  2ON7 A;  1QUW A;  2YV9 A;  1X0R A;  3D4M A;  2GT6 A;  2DBC A;  4YKG A;  4FYC A;  2JSY A;  4L8E A;  2DJ2 A;  5IMC A;  1OAZ A;  4HUA A;  1V40 A;  5LD0 A;  1EEJ A;  1B4Q A;  2YWO A;  4NXI A;  4GST A;  2M66 A;  4HJ2 A;  1YF1 A;  1M9B A;  3WT2 A;  1UA5 A;  1TRS A;  2WS2 A;  2V2G A;  1EP7 A;  1JHB A;  3DWV A;  2A2P A;  5HR1 A;  2PVO C;  5INY A;  5E4W A;  2YOI A;  2LQQ A;  4TR1 B;  1B9Y C;  3ZYW A;  4NHW A;  4MCU A;  1BJX A;  4KH7 A;  3VPT A;  4KSM A;  1GTA A;  2FD3 A;  4KUN A;  1X5D A;  3ZVJ D;  2IL3 A;  2LRN A;  1M7T A;  2WFC A;  4GWR A;  2LUS A;  5GAP D;  2KUC A;  2VO4 A;  4I5Q A;  2K9F A;  3GH6 A;  2PGT A;  1AC1 A;  3DYR A;  1EP8 A;  2WGR A;  1A0R P;  3HCZ A;  1UC7 A;  3ED3 A;  4JE1 A;  4EDY A;  4G19 A;  2FA4 A;  1THO A;  3E0U A;  2F51 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...