2C0EA

Structure of pdi-related chaperone, wind with his-tag on c-terminus.
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
228
structure length
228
Chain Sequence
CTGCVDLDELSFEKTVERFPYSVVKFDIAYPYGEKHEAFTAFSKSAHKATKDLLIATVGVKDYGELENKALGDRYKVDDKNFPSIFLFKGNADEYVQLPSHVDVTLDNLKAFVSANTPLYIGRDGCIKEFNEVLKNYANIPDAEQLKLIEKLQAKQEQLTDPEQQQNARAYLIYMRKIHEVGYDFLEEETKRLLRLKAGKVTEAKKEELLRKLNILEVFRVHKVTKTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WINDBEUTEL PROTEIN
publication title Structural Elucidation of the Pdi-Related Chaperone Wind with the Help of Mutants.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Chaperone
total genus 76
structure length 228
sequence length 228
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07749 ERp29 Endoplasmic reticulum protein ERp29, C-terminal domain
A PF07912 ERp29_N ERp29, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1150.12 Mainly Alpha Up-down Bundle Endoplasmic reticulum protein erp29 Endoplasmic reticulum resident protein 29, C-terminal domain 2c0eA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2c0eA01
1N8JA 1WWJA 3VWXA 4V1Ap 3I6AA 4J57E 4FYBA 5IM9A 1X5EA 1TRVA 2HZEA 1XWBA 2XPEA 2IFQB 3O76A 4N0VA 1SENA 2X64A 20GSA 2WGRA 2CVKA 3LYPA 4HUAA 2K8VA 3BJ5A 3ZVJD 4CDOA 3EYTA 3WYWA 1TXXA 3TOUA 4E8HA 2PN8A 1FOVA 1B4PA 2WZ9A 4OCEA 1FG4A 2P5QA 4ZBBA 2JSZA 5LCZA 5B6NA 4TR1B 2XBIA 2OA7A 2VCXA 1K0NA 3IOSA 5C04A 5H5QA 2M72A 3ZIJA 4KSOA 3FW2A 3HA9A 5ID2B 3F9UA 1K0BA 4IKHA 5IMFA 3APOA 1NW2A 1LBKA 3HHVA 5EL8A 5FHIA 1ZZYA 1O73A 3KP9A 2B7JA 3PH9A 3APSA 3C8EA 4K8MA 4P3YB 2DBCA 2LEGA 3W8SA 5IPGA 2WB9A 3LORA 2R3XA 3C71A 4LL1B 4F2IA 3HXSA 3HD5A 5DCGA 5B8BA 2VCVA 1H75A 1R7HA 2H0GA 4OWYA 1MDIA 5IO2A 1O81A 6GSVA 1Z6NA 5ECMB 4I2TA 4KDXA 4ZILA 1GSFA 2RUEA 4XRAA 5AN1A 5DALB 5J9CA 3UEMA 2H6YA 5DCHA 3D5JA 3FR3A 4MPGA 5G1LA 2F3MA 6GSWA 3GSTA 2GSTA 3GKNA 1YDKA 4ZB8A 3QAVA 1SK2A 3DD3A 4FH8A 6GSXA 1EZKA 1GUMA 1A23A 1R4WA 4IGJA 4V2NA 4ZBDA 2K9FA 1JLVA 2VCZA 4HJMA 4MZCA 2HZEB 4L8EA 1MDKA 4ML1A 3UL3A 1JHBA 2DJKA 2WRTA 3EMXA 1T00A 5ECRB 1M2BA 2B5XA 5A4VA 2VD0A 4POLA 3L78A 2XBQA 5DJLA 5GAPD 4G10A 2AUVA 8GSSA 5LD0A 4TOPA 2HYXA 3GH9A 2GLRA 1PN9A 2HFDA 4MH3A 1GTBA 2VM2A 3LGCA 1G6YA 3UOMA 3KH7A 4OMVA 5ECNB 2IL3A 3CTGA 1WOUA 4RQXA 5CRWA 3HVXA 4GXZA 3VWVA 2D2ZA 4YQUA 2PUKC 1FB0A 2H74A 2FWHA 2N5BA 2DC5A 17GSA 1XWAA 3HJPA 2IMDA 4OCFA 4I8BA 3GKKA 5GSSA 4FYCA 2FLSA 4EE0A 4XS4A 4KGIA 1A0RP 3KMNA 1EV4A 3RPPA 2EIRA 2OKAA 1S3CA 1V40A 2V41A 4J56E 4JRRA 5E4WA 3LG6A 3TUEA 2I1UA 2J9HA 1SKRB 3IV4A 2IPAA 1H4OA 2I4AA 3FHKA 2C1YA 4K0NA 2H0HA 2VM1A 1IYHA 1VF3A 4ZB9A 4O5RA 3GUSA 1K0DA 3QAGA 2HRFA 4XCSA 5CRDA 2GTUA 2A2RA 1TK5B 5EPFA 2H70A 5J5NA 3NZNA 1EP8A 4AF2A 5CYYA 2XPDA 4KA0A 3H8QA 4F0BA 2L6CA 4OO5A 3QOUA 1V57A 1QGVA 3D4MA 3WGXA 1T4ZA 4MZWA 3GH6A 4OD7A 5AIXA 3FYGA 2L5LA 3HCZA 1TRWA 1AIUA 2FA4A 5GSTA 5AISA 3L9VA 2I9HA 5CAXA 2R6KA 19GSA 3CRUA 3IAS2 4F0CA 5ECKB 3F4RA 4WBRD 3DXBA 1SYXA 4MF5A 4V2MA 1PRXA 2YJHA 1T3BA 4NWYA 1XCCA 2M66A 2M80A 4NMUA 4F03A 2E2MA 5AGYA 4ECJA 4AJ7A 4IQAA 3CSJA 1BEDA 5IOWA 1DE1A 3M8NA 4GQFA 5J4UA 1URMA 4ML6A 2C3NA 4K7OA 2RIIA 1QUWA 1IYIA 1SU9A 3VPQA 2G0FA 3MDKA 1M7TA 2LS5A 2H0IA 2VAFA 2LQQA 4RI7A 5F05A 1PX6A 5IMVA 1W89A 2VLVA 4ZL8A 1NM3A 4KSMA 4MH2A 2H73A 3QFBC 2DIYA 4XS4B 2FA8A 1HYUA 2RUFA 2LV3A 1FVJA 2FWGA 3ME8A 3VK9A 2ES7A 4YAPA 2K6VA 1MD4A 3D21A 4YQVA 1N2AA 5DQYA 3KTBA 2EC4A 5L71A 1M0UA 3D4TA 4GSSA 4KH7A 4OFMA 3TGZA 3BCIA 4TR0A 2H71A 3L9UA 4CHSA 2BJXA 2V32A 4G2EA 3QFAC 1EGOA 3TKSC 1SJZA 3GL5A 5COHA 1EOGA 2CQ9A 2LJAA 4EDYA 3J7Yk 2IFQA 3L0HA 3M9KA 2LUSA 3WT2A 5INYA 1O85A 3TKSA 1T4YA 1G6WA 2K8SA 4HEA2 4EF0A 1HNCA 2LNSA 1MEKA 5FWGA 5DJMA 3C1RA 2YJ7A 2J23A 4EDZA 4EKZA 3ISOA 2NTOA 5AIVA 1GSSA 3LFLA 3I9V2 1AAZA 4EVMA 4L0WA 2LJKA 3GL3A 2GT6A 1TW9A 3APQA 2PBJA 4GRFA 4EUYA 3K8NA 3IRAA 1PKZA 2C0EA 4AGSA 2PVOC 3RDWA 5ECHB 1VF2A 3TJJA 2GZPA 4HU7A 1UVZA 1YEXA 5ID2A 3EMPA 2L59A 1QMVA 2DJ2A 3M0FA 5KN1A 4JEDA 1X9MB 1XVQA 4MA9A 4NV5A 4BWSA 2MYGA 5KN0A 3VLNA 4WF5A 1TRSA 1ZYEA 4JR4A 5EVOA 3IAM2 4GWRA 3CSHA 2HRNA 3DRNA 1YEPA 1OAZA 3HDCA 3VPTA 2KP1A 2H19A 5D93A 1DUGA 2DLXA 1TK0B 4I97A 5F07A 2GZYA 1VGLA 3IPZA 2TIRA 3RPNA 4MP4A 3UARA 1EP7A 1XBSA 3TB2A 4ZBAA 3IHQA 4PGTA 4XRDA 3FR6A 1BAYA 4WF4A 3IK7A 5ECOB 2QC7A 2QGVA 2JACA 2KP2A 4MJCA 5F0GA 3WT1A 3IBHA 1K0AA 3ME7A 4H86A 1FHEA 2C80A 4TN8A 2CX4A 1ERTA 5ENUA 1M2AA 2EIQA 1KBNA 1GRXA 1PKWA 5IMAA 4G19A 5B8AA 1SD9A 4POKA 1ERWA 2FY6A 6GSYA 1BX9A 3EINA 1XPVA 5ABRA 4HZ4A 4PQIA 4TVEA 1M9BA 3VWUA 1J08A 1ZGNA 4WKWA 9GSSA 4NHWA 1TU8A 1Q98A 4Z7XA 4TKYA 2V2GA 3KEBA 4BA7A 3LEFA 2ZUPA 4XS1A 2CAQA 1QK8A 4K1FA 3GNJA 3LXZA 4WETA 4OFTA 3M9JA 2YANA 2C0FA 3ZMLA 3CMIA 3GA4A 2C0DA 5HFIA 5ECSA 3RBTA 1WIKA 3N9JA 4FIWA 3TKSE 2V6OA 3BCKA 3ERWA 4O32A 2HZFA 4IBPA 2FUG2 2YZHA 22GSA 1BG5A 5C00A 3UBLA 1PL1A 2CZ2A 1YF1A 3D0ZA 2C3QA 2ON5A 2JZTA 4TXOA 2ALBA 3KCMA 2BMXA 2DJ3A 4FO5A 2PERA 1OYJA 4MLYA 1EWXA 1SL2B 1TRUA 1DSBA 2YV7A 3E9JB 5F8BA 1HNBA 1EEMA 1SKSB 4IQ1A 4ZIJA 1EOHA 1FW1A 3KGKA 1GSUA 2OADA 3D22A 3Q18A 1OE8A 3ZREA 5DBQA 3EVIA 5DDLA 3ZLPA 4ECCA 4HZ2A 2HSHA 4XTSA 4L5OA 1HD2A 1RK4A 3ZL5A 2E2GA 2GSRA 4K7IA 2P5RA 1PL2A 2PWJA 3HJMA 3DEXA 4BL7A 2MMZA 2H8LA 2RM6A 1MDJA 4O7HA 2CAIA 4GLTA 4K9ZA 4N10A 3W6GA 2H72A 1GSEA 4WEYA 1EV9A 3NIVA 4PXOA 1YJ6A 5EY6A 3FR9A 3GKXA 4RUVA 5CREA 1QFNA 4HQZA 1Z5YE 5G2ZA 1U87A 3V1WA 3HZ4A 4MMMA 1JZRA 2WS2A 3EWLA 1J0FA 4IJIA 5E59A 3UJ1A 1FB6A 2RLIA 3DWVA 5KN2A 3O3TA 1TU7A 11GSA 2KOKA 3R2QA 2H66A 2YZUA 4POBA 2C4JA 2IJYA 4KB3A 1ST9A 3TJFA 4MCUA 4EC0A 1ERUA 2VCWA 4LLRA 2CZ3A 4MF7A 4AJ8A 4MJBA 2O7KA 2O89A 1F3BA 4V2LA 2X8HA 5JCWA 1ABAA 3ZZXA 1OC3A 3UVHA 1K3YA 3I69A 2RM5A 1OE7A 4ECBA 3WD6A 3PGTA 3U5RE 2ON7A 1GP1A 2IMFA 1AXDA 1B4QA 3F6DA 3Q74A 2TRXA 1PSQA 4L5LA 4TXOB 3HVSA 2YWOA 3MAKA 3F4SA 3FZ4A 3ZYWA 3EU3A 1Z9HA 4JBBA 1A24A 1R5PA 1O8WA 3P7XA 1Z7PA 2P31A 1WP0A 1SD8A 4KUNA 3GV1A 4PQHA 2YP6A 2E7PA 1OC9B 5IO0A 2PVQA 3M3MA 4GSNA 6GSUA 3EURA 4WR4A 1USBA 5HFGA 1K3LA 10GSA 2Z9SA 1I9DA 3C7MA 1E6BA 6GSSA 2B5YA 4HS1A 1V58A 3ZFLA 5G30A 3TKQA 1TI1A 1G7OA 2H1BA 1GTUA 4RI6A 4HU9A 3HYPA 2PGTA 4ILFA 2YPMA 5D9VA 3AY8A 3ZRDA 1GUHA 1S3AA 3G7JA 1XIYA 2OJLA 2NDOA 5KN3A 3CRTA 1YKAA 4LMVA 5HQPA 2JZRA 2JSYA 5ELGA 2H1AA 2ZNMA 3I43A 3HVVA 2HI7A 4PUAA 1EEJA 2CVDA 2H1GA 1DBYA 2VCQA 2LRNA 1XOAA 3TJKA 3SWLA 3LYKA 4FYUA 4Q5FA 2YWNA 1SJIA 2CVBA 1A2LA 1BYEA 4XHMA 2LRTA 3KD0A 1UC7A 3D6IA 5CRGA 3VI5A 1TI3A 5G31A 1WPIA 2R5GA 2V1MA 5IQYA 1MTCA 4N0ZA 5B7CA 3TOTA 4ISDA 3GURA 2AV4A 2AB6A 4PURA 2B5EA 2NPBA 3Q6OA 2B1LA 2IN3A 4IP1A 5B6MA 3TCOA 2I81A 3QPMA 5HFKA 1WMJA 3RAZA 1HQOA 4MDCA 3IXRA 3KZQA 4IJ3A 4EXJA 2PMTA 1GSYA 1X9WB 1OVNA 4KE3A 5H5RA 5A4UA 4HQSA 3QCPA 3GX0A 2TRCP 1J9BA 4LL4B 4IELA 3VWWA 3ZFBA 2ZCTA 3ZVJA 1SK0A 2IWTA 2FWFA 1XVWA 3KM6A 1A8LA 2AYTA 3H79A 1A0FA 3UVTA 1OKDA 4HJ2A 4DVCA 5IPHA 2B1KA 4DSQA 3F0IA 2OACA 4ZL9A 2NVLA 3E0UA 1F9MA 4G9HA 2OE1A 2WJUA 3CYNA 1AC1A 4Q5QA 3KIJA 3F63A 3ERFA 3F3QA 4ZL7A 2OBKA 4KNDA 1W4VA 2IMKA 1PX7A 5D9TA 4BPYA 4KDUA 5D96A 1Y25A 5IOXA 1GULA 2YCDA 3F6FA 4NAXA 2H75A 2OBIA 1V2AA 2GT5A 2EIOA 5JWOB 2HNLA 5GZZB 2B7KA 1SL0B 3CBUA 4RQRA 3IDVA 2C8UA 3P8WA 1AW9A 1AQXA 2FGXA 3KMOA 4DSSB 3QDNA 4PX1A 1B9XC 1OC8A 3G7YA 1ZYQB 2LTKA 2R4VA 4HI7A 5J41A 1O8XA 3IE3A 3FZ5A 4OFNA 1O6JA 2MBSA 4BVYA 2DJJA 2DJ1A 3G9BA 4JU5A 1FVKA 4D73A 1GSQA 4BVXA 4KAEA 2C0GA 3GN3A 4I5QA 4MJEA 2A2SA 4V1Ag 5FT3A 5IMCA 1U3IA 2CX3A 3GX8A 2VLTA 4PUFC 4MABA 2GZZA 2JADA 4F9ZA 3IA1A 1BQ7A 1LJRA 3US3A 1AQVA 1SJ6A 3TKPA 1A2JA 1MD3A 3EC3A 3IC4A 1ML6A 4K6XA 1Z6MA 2JU5A 3SBCA 1GLPA 4HOJA 2K18A 4DEJA 2GQLA 4Q5NA 3RHBA 3P90A 2L6DA 1A8YA 4X43A 3O6TA 2YOIA 3ZMKA 1M99A 1AQWA 5D9WA 1WE0A 1UN2A 4QL9A 3FY7A 3P2AA 3S9FA 2VCTA 2LRCA 3KJYA 2PPTA 1GUKA 3GKMA 5HR1A 3HJOA 2H30A 2DMMA 2VL2C 2AAWA 3GTUA 3LWAA 14GSA 1ZMAA 1JFUA 4N30A 1GNWA 3FZ9A 2VL2A 2YN1A 3ZITA 2MMOA 5IIZA 3FEUA 1GTIA 3FKFA 1Z3EA 16GSA 2FHEA 4NHZA 18GSA 3ERGA 3Q19A 4I2UA 1KEBA 1XFLA 2A4VA 3LQ7A 2GSSA 4NPBA 4GCIA 2IMIA 5JCGA 3CSIA 12GSA 1ZOFA 2HSYA 7GSSA 1UA5A 3U6VA 1T7PB 4WXTA 5HR0A 2FWEA 2WCIA 3UIWA 2YV9A 3TRQA 4D73B 1M2DA 4TR4A 3A2XA 1X5DA 3FRCA 4K2DA 4KDYA 5ECIB 1F3AA 1Z7RA 1ERVA 3C73A 3G7IA 5CNWA 2P0GA 5A4WA 2OE3A 3MWHA 2B3SA 4EO3A 3KH9A 1OC9A 2LNTA 1X0RA 3OR5A 5HR3A 1K0MA 2H6XA 1GWCA 5ECLB 2G2QA 4J2FA 4LMWA 3LJRA 1JZWA 1T8EB 3A2VA 3QD9A 4HDEA 4Q5RA 1M9AA 3H93A 1Q4JA 3DKSA 2VL3A 1GL8A 2QKEA 3F3RA 4X0XA 2F9SA 5IMDA 2VIMA 1ACVA 2VO4A 2H76A 1GTAA 5G5FA 1XW9A 13GSA 1U88A 1TOFA 5H5SA 3WGDA 3H1NA 2GDRA 4E8EA 4PQ1A 1TTZA 3DVXA 2XHFA 4IS0A 3TJGA 4KCAA 4LA1A 4TRXA 3H4KA 3W8JA 4BWQA 4MJAA 1VF1A 1B9YC 3M1GA 1HNAA 3EE2A 1I5GA 1LU4A 5HR2A 5G5EA 3GTUB 3MNGA 5D8IA 4YQMA 1GLQA 4GTUA 4GSTA 5CRHA 2FNOA 3JCML 3QAWA 2MBTA 3GRXA 4XS6A 3F8UA 1SK1A 2L57A 1S3DA 2M46A 4GQCA 4K7NA 1PMTA 4YAVA 1F37A 1PA3A 2WULA 1T1VA 2AJQB 1JLWA 1K3OA 4TW5A 4I6XA 1G7EA 1B8XA 1E2YA 5DAKA 3DMLA 1GNEA 1VF4A 3HKRA 3DVWA 1CQGA 4OO4A 4WBJA 4O92A 3WGEA 1C72A 1G0TA 3KP8A 2MZCA 4ID0A 5JWRB 2DMLA 1XW5A 4MK3A 2DJ0A 4QL7A 5D73A 3DYRA 3GMFA 3HZ8A 1GH2A 1YZXA 4L0UA 5ECQB 1XWKA 2L5OA 1OKTA 4ECIA 4TR3A 1X5CA 3LSZA 4QQ7A 1U6TA 1GSDA 2F51A 1KNGA 1SKWB 2PU9C 4IHUA 3F4TA 1FAAA 4TXVA 2C3TA 4NXIA 2N5AA 4IP6A 1ZL9A 5D9XA 2YWIA 1YY7A 2IMEA 3CXGA 3HY2A 1SL1B 5J3RA 3IR4A 2R2JA 5ECPB 4K0GA 3ED3A 3GIXA 1ZCPA 2FCHA 3CTFA 3KXOA 4DSRA 2KUCA 1TP9A 5JCUA 1PQNA 2MMNA 1G7DA 3J7Yb 3GFKA 4DSSA 3GYKA 5F06A 1THXA 1JZDA 5CP1A 1XWCA 2H1DA 3MSZA 1ILOA 1NHYA 2AHEA 2MMAA 4N11A 1PD21 2NBSA 1R5AA 1F2EA 5A5KA 2LKUA 4JZQA 2YNXA 5KEJA 5LNKe 2DSAA 1V98A 2H01A 1XXUA 2X8GA 5IMZA 4EL1A 5G1KA 2WDUA 4ZB6A 5GAND 2X8CA 2YWMA 2LQOA 4F82A 4KX4A 1K0OA 1XW6A 5DAKB 3UBKA 4GF0A 2VUPA 2GS3A 4PNFA 1QXHA 4JR6A 2CA8A 1K0CA 1V9WA 1WRYA 2GGTA 4X1UA 4ZXGA 3FZAA 3NOFA 1NSWA 4POMA 5CO3A 4KW6A 2VL9A 5JWQB 3RHCA 1O7UA 3N5OA 3TKRA 2N5FA 1TJDA 4MZBA 4IN0A 3BD2A 1QQ2A 1TDIA 3KTLA 3VFIA 1SYRA 2WFCA 4JE1A 2VOCA 1KTEA 2R37A 4ACSA 2HXKA 1EGRA 2DIZA 4XIHA 2HT9A 5DVBA 1BJXA 2O8VB 4NV2A 3QR6A 1DE2A 2GQMA 2E0QA 3BBYA 1Y6EA 3L9SA 4IW9A 3PINA 3UAPA 2LJRA 1JZOA 2L4QA 2L4CA 1WJKA 4IVFA 1YKCA 2JL4A 3TDGA 2QSIA 4AJ6A 1FO5A 1U3AA 4WR5A 2VLUA 2B6MA 3EU4A 1TKDB 2I3YA 3LXTA 3A2WA 3L4NA 2IIYA 4TR1A 2F8FA 3A5WA 2HE3A 2REMA 3BOAA 1RW1A 2CV4A 2KLXA 3PR8A 2JZSA 3A3TA 4KCEA 5ELAA 2H6ZA 1YQ1A 3FK8A 3VI7A 3TJBA 4CW9A 1AUCA 2LSTA 3VURA 1XZOA 1PGTA 2F8AA 1CQHA 2GVPA 2OE0A 2V6KA 1NHOA 1XOBA 1ON4A 1THOA 2GSQA 4PNGA 4ULXA 3DGQA 2CT6A 5DQSA 1RQMA 1VRSD 1TK8B 3QMXA 4MPFA 2X99A 3IK9A 2XC2A 3TRXA 2O87A 2VD1A 3GHAA 2KHPA 3E3EA 4MF6A 1A2MA 1F6MC 5J9BA 3UMAA 3ZIVA 1YF0A 2BTOT 3C1SA 2FD3A 6GSTA 2GQKA 2HLSA 3ZTLA 1R26A 2O85A 5DALA 1B48A 3GSSA 3TRPA 3DIEA 1XWGA 1X9SB 4YH2A
chains in the Genus database with same CATH superfamily
1N8JA 1WWJA 3VWXA 4V1Ap 3I6AA 4J57E 4FYBA 5IM9A 1X5EA 1TRVA 2HZEA 1XWBA 2XPEA 2IFQB 3O76A 4N0VA 1SENA 2X64A 20GSA 2WGRA 2CVKA 3LYPA 4HUAA 2K8VA 3BJ5A 3ZVJD 4CDOA 3EYTA 3WYWA 1TXXA 3TOUA 4E8HA 2PN8A 1FOVA 1B4PA 2WZ9A 4OCEA 1FG4A 2P5QA 4ZBBA 2JSZA 5LCZA 5B6NA 4TR1B 2XBIA 2OA7A 2VCXA 1K0NA 3IOSA 5C04A 5H5QA 2M72A 3ZIJA 4KSOA 3FW2A 3HA9A 5ID2B 3F9UA 1K0BA 4IKHA 5IMFA 3APOA 1NW2A 1LBKA 3HHVA 5EL8A 5FHIA 1ZZYA 1O73A 3KP9A 2B7JA 3PH9A 3APSA 3C8EA 1S3RA 4K8MA 4P3YB 2DBCA 2LEGA 3W8SA 5IPGA 2WB9A 3LORA 2R3XA 3C71A 4LL1B 4F2IA 3IHGA 3HXSA 3HD5A 5DCGA 5B8BA 2VCVA 3LW9A 1H75A 1R7HA 2H0GA 4OWYA 1MDIA 5IO2A 1O81A 6GSVA 1Z6NA 5ECMB 4I2TA 4KDXA 4ZILA 1GSFA 2RUEA 4XRAA 5AN1A 5DALB 5J9CA 3UEMA 2H6YA 5DCHA 3D5JA 3FR3A 4MPGA 5G1LA 2F3MA 6GSWA 3GSTA 2QA2A 2GSTA 3GKNA 1YDKA 4ZB8A 3QAVA 1SK2A 3DD3A 4FH8A 6GSXA 1EZKA 1GUMA 1A23A 2R0GA 1R4WA 4IGJA 4V2NA 4ZBDA 2K9FA 1JLVA 2VCZA 4HJMA 4MZCA 2HZEB 4L8EA 1MDKA 4ML1A 3UL3A 1JHBA 2DJKA 2WRTA 3EMXA 1T00A 5ECRB 1M2BA 2B5XA 5A4VA 2VD0A 4POLA 4BIKA 3L78A 4Z2TA 2R0CA 2XBQA 5DJLA 5GAPD 4G10A 2AUVA 8GSSA 5LD0A 4EIPA 4TOPA 2HYXA 2HSMA 3GH9A 2GLRA 4MNNA 1PN9A 3HVNA 2HFDA 4MH3A 1GTBA 2VM2A 3LGCA 1G6YA 3UOMA 3KH7A 4OMVA 5ECNB 2IL3A 3CTGA 1WOUA 4RQXA 5CRWA 3HVXA 4GXZA 3VWVA 2D2ZA 4YQUA 2PUKC 1FB0A 2H74A 2FWHA 2N5BA 2DC5A 17GSA 1XWAA 3HJPA 2IMDA 4OCFA 4I8BA 3GKKA 5GSSA 4FYCA 2FLSA 4EE0A 4XS4A 4KGIA 1A0RP 3KMNA 1EV4A 3RPPA 2EIRA 2OKAA 1S3CA 1V40A 2V41A 4J56E 4JRRA 5E4WA 3LG6A 3TUEA 2I1UA 2J9HA 1SKRB 3IV4A 2IPAA 1H4OA 2I4AA 3FHKA 2C1YA 4K0NA 2H0HA 2VM1A 1IYHA 1VF3A 4ZB9A 4O5RA 3GUSA 1K0DA 2DKIA 3QAGA 2HRFA 4XCSA 5CRDA 2GTUA 2A2RA 1TK5B 5EPFA 2H70A 5J5NA 3NZNA 1EP8A 4AF2A 5CYYA 2XPDA 4KA0A 3H8QA 4F0BA 2L6CA 4OO5A 3QOUA 3FMWA 1V57A 1QGVA 3D4MA 3WGXA 1T4ZA 4MZWA 3GH6A 4OD7A 5KOWA 5AIXA 3FYGA 2L5LA 3HCZA 1TRWA 1AIUA 2FA4A 5GSTA 5AISA 3L9VA 2I9HA 5CAXA 2R6KA 19GSA 3CRUA 3IAS2 4F0CA 5ECKB 3F4RA 4WBRD 3DXBA 4O5UA 1SYXA 4MF5A 5BMUA 4V2MA 1PRXA 2YJHA 1T3BA 4NWYA 1XCCA 2M66A 2M80A 4NMUA 4F03A 2E2MA 5AGYA 4ECJA 4AJ7A 4IQAA 3CSJA 1BEDA 5IOWA 1DE1A 3M8NA 4GQFA 5J4UA 1URMA 4ML6A 2C3NA 4K7OA 2RIIA 1QUWA 1IYIA 1SU9A 3VPQA 2G0FA 3MDKA 1M7TA 2LS5A 2H0IA 3PPUA 2VAFA 2LQQA 4RI7A 5F05A 1PX6A 4ICYA 5IMVA 2QA1A 1W89A 2VLVA 4ZL8A 1NM3A 4KSMA 4MH2A 2H73A 4X4JA 3QFBC 2DIYA 4XS4B 2FA8A 2R0PA 1HYUA 2RUFA 2LV3A 4CY8A 1FVJA 2FWGA 3ME8A 3VK9A 2ES7A 4YAPA 2K6VA 1MD4A 3D21A 4YQVA 4G0LA 1N2AA 5DQYA 3KTBA 2EC4A 5L71A 1M0UA 3D4TA 4GSSA 4KH7A 4OFMA 3TGZA 3BCIA 4TR0A 2H71A 3L9UA 4CHSA 2BJXA 2V32A 4G2EA 3QFAC 1EGOA 3TKSC 1SJZA 3GL5A 5COHA 1EOGA 2CQ9A 2LJAA 4EDYA 3J7Yk 2IFQA 3L0HA 3M9KA 2LUSA 3WT2A 5INYA 1O85A 3TKSA 1T4YA 1G6WA 2K8SA 4HEA2 4EF0A 1HNCA 2LNSA 1MEKA 5FWGA 5DJMA 3C1RA 2YJ7A 4A5PA 2J23A 4EDZA 4EKZA 3ISOA 2NTOA 5AIVA 1GSSA 3LFLA 3I9V2 1AAZA 4EVMA 4L0WA 2LJKA 3GL3A 3MYDA 2GT6A 1TW9A 3APQA 2PBJA 4GRFA 4EUYA 3K8NA 3IRAA 1PKZA 2C0EA 4AGSA 2PVOC 3RDWA 5ECHB 1PFOA 1VF2A 3TJJA 2GZPA 4HU7A 1UVZA 1YEXA 5ID2A 3EMPA 2L59A 1QMVA 2DJ2A 3M0FA 5KN1A 4JEDA 1X9MB 1XVQA 4MA9A 4NV5A 4BWSA 2MYGA 5KN0A 3VLNA 4WF5A 1TRSA 1ZYEA 4JR4A 5EVOA 3IAM2 4GWRA 3CSHA 2HRNA 3DRNA 1YEPA 1OAZA 3HDCA 3VPTA 2KP1A 2H19A 5D93A 1DUGA 2DLXA 1TK0B 4I97A 5F07A 2GZYA 1VGLA 3IPZA 2TIRA 3RPNA 4MP4A 3UARA 1EP7A 1XBSA 3TB2A 4ZBAA 3IHQA 4PGTA 4XRDA 3FR6A 1BAYA 4WF4A 3IK7A 5ECOB 2QC7A 2QGVA 2JACA 2KP2A 4MJCA 5F0GA 3WT1A 3IBHA 1K0AA 3ME7A 4H86A 1FHEA 2C80A 4TN8A 2CX4A 3EPTA 1ERTA 5ENUA 1M2AA 2EIQA 1KBNA 1GRXA 1PKWA 5IMAA 4G0IA 4G19A 5B8AA 1SD9A 4POKA 1ERWA 2FY6A 6GSYA 1BX9A 3EINA 1XPVA 5ABRA 4HZ4A 4PQIA 4TVEA 1M9BA 3VWUA 1J08A 1ZGNA 4WKWA 9GSSA 4NHWA 1TU8A 1Q98A 4Z7XA 4TKYA 2V2GA 3KEBA 4BA7A 3LEFA 2ZUPA 4XS1A 2CAQA 1QK8A 4K1FA 3GNJA 3LXZA 4WETA 4OFTA 3M9JA 2YANA 2C0FA 3ZMLA 3CMIA 3GA4A 2C0DA 5HFIA 5ECSA 4YKFA 3RBTA 1WIKA 4K5RA 3N9JA 4FIWA 3TKSE 2V6OA 3BCKA 3ERWA 4O32A 2HZFA 4IBPA 2FUG2 2YZHA 4Z2UA 22GSA 1BG5A 5C00A 3UBLA 4FQUA 1PL1A 2CZ2A 1YF1A 3D0ZA 2C3QA 2ON5A 2JZTA 4TXOA 2ALBA 3KCMA 2BMXA 2DJ3A 4FO5A 2PERA 1OYJA 4MLYA 1EWXA 1SL2B 1TRUA 1DSBA 2YV7A 3E9JB 5F8BA 1HNBA 1EEMA 1SKSB 4IQ1A 4ZIJA 1EOHA 1FW1A 3KGKA 1GSUA 2OADA 3D22A 3Q18A 1OE8A 3ZREA 5DBQA 3EVIA 5DDLA 3ZLPA 4ECCA 4HZ2A 2HSHA 4XTSA 4L5OA 1HD2A 1RK4A 3ZL5A 2E2GA 2GSRA 4K7IA 2P5RA 1PL2A 2PWJA 3HJMA 3DEXA 4BL7A 2MMZA 2H8LA 2RM6A 1MDJA 4O7HA 2CAIA 4GLTA 4K9ZA 4N10A 3W6GA 2H72A 1GSEA 4WEYA 1EV9A 3NIVA 4PXOA 1YJ6A 5EY6A 3FR9A 3GKXA 4RUVA 5CREA 1QFNA 4HQZA 1Z5YE 5G2ZA 3A5IA 1U87A 3V1WA 3HZ4A 4MMMA 1JZRA 2WS2A 3EWLA 4PTSA 1J0FA 4IJIA 5E59A 3UJ1A 1FB6A 2RLIA 3DWVA 5KN2A 3O3TA 1TU7A 11GSA 2KOKA 3R2QA 2H66A 2YZUA 4POBA 2C4JA 2IJYA 4KB3A 1ST9A 3TJFA 4MCUA 4EC0A 1ERUA 2VCWA 4LLRA 2CZ3A 4MF7A 4AJ8A 4MJBA 2O7KA 2O89A 1F3BA 4V2LA 2X8HA 5JCWA 1ABAA 3ZZXA 1OC3A 3UVHA 1K3YA 3I69A 2RM5A 1OE7A 4ECBA 3WD6A 3PGTA 3MIXA 3U5RE 2ON7A 1GP1A 2IMFA 1AXDA 1B4QA 3F6DA 3Q74A 2TRXA 1PSQA 4L5LA 4TXOB 3HVSA 2YWOA 3MAKA 3F4SA 3FZ4A 3ZYWA 2A2PA 3EU3A 1Z9HA 4JBBA 1A24A 1R5PA 1O8WA 3P7XA 1Z7PA 2P31A 1WP0A 1SD8A 4KUNA 3GV1A 4PQHA 2YP6A 2E7PA 1OC9B 5IO0A 2PVQA 3M3MA 4GSNA 6GSUA 3EURA 4WR4A 1USBA 5HFGA 1K3LA 10GSA 2Z9SA 1I9DA 3C7MA 1E6BA 4BL7B 6GSSA 4YKGA 2B5YA 4HS1A 1V58A 3ZFLA 5G30A 3TKQA 1TI1A 1G7OA 2H1BA 1GTUA 4RI6A 4HU9A 3HYPA 2PGTA 4ILFA 2YPMA 5D9VA 3AY8A 3ZRDA 1GUHA 1S3AA 3G7JA 1XIYA 2OJLA 2NDOA 5KN3A 3CRTA 1YKAA 4LMVA 5HQPA 2JZRA 2JSYA 5ELGA 2H1AA 2ZNMA 3I43A 3HVVA 2HI7A 1ZYNA 1EEJA 4PUAA 2CVDA 2H1GA 1DBYA 2VCQA 2LRNA 1XOAA 3IC8A 3TJKA 3SWLA 3LYKA 4FYUA 4Q5FA 2YWNA 1SJIA 2CVBA 1A2LA 1BYEA 4XHMA 2LRTA 3KD0A 1UC7A 3D6IA 5CRGA 3VI5A 1TI3A 5G31A 1WPIA 2R5GA 2V1MA 5IQYA 1MTCA 4N0ZA 5B7CA 3TOTA 4ISDA 3GURA 2AV4A 2AB6A 4PURA 2B5EA 2NPBA 3Q6OA 2B1LA 2IN3A 4IP1A 5B6MA 3TCOA 2I81A 3QPMA 5HFKA 1WMJA 3RAZA 1HQOA 4MDCA 3IXRA 3KZQA 4IJ3A 4EXJA 2PMTA 1GSYA 1X9WB 1OVNA 4KE3A 5H5RA 5A4UA 4HQSA 3QCPA 3GX0A 2TRCP 1J9BA 4LL4B 4IELA 3VWWA 3ZFBA 2ZCTA 3ZVJA 1SK0A 2IWTA 2FWFA 1XVWA 3KM6A 1A8LA 2AYTA 3H79A 1A0FA 3UVTA 1OKDA 4HJ2A 4DVCA 5IPHA 2B1KA 4DSQA 3F0IA 2OACA 4G0KA 4ZL9A 2NVLA 3E0UA 1F9MA 4G9HA 2OE1A 2WJUA 3CYNA 1AC1A 4Q5QA 3KIJA 3F63A 3ERFA 3F3QA 4ZL7A 2OBKA 4KNDA 1W4VA 2IMKA 1PX7A 5D9TA 4BPYA 4KDUA 5D96A 1Y25A 5IOXA 1GULA 2YCDA 3F6FA 3CQFA 4NAXA 2H75A 2OBIA 1V2AA 2GT5A 2EIOA 5JWOB 2HNLA 5GZZB 2B7KA 1SL0B 3CBUA 4RQRA 3IDVA 2C8UA 1M3JA 3P8WA 1AW9A 1AQXA 2FGXA 3KMOA 4DSSB 3QDNA 4PX1A 1B9XC 4CY6A 4Z2RA 1OC8A 3G7YA 1ZYQB 2LTKA 2R4VA 4HI7A 5J41A 1FOHA 1O8XA 3IE3A 3FZ5A 4OFNA 5KOXA 1O6JA 1XG8A 2MBSA 4BVYA 2DJJA 2DJ1A 3G9BA 4JU5A 1FVKA 4D73A 1GSQA 4BVXA 4KAEA 1ZYPA 2C0GA 3GN3A 4I5QA 4MJEA 2A2SA 4V1Ag 5FT3A 5IMCA 1U3IA 2CX3A 3GX8A 2VLTA 4PUFC 4MABA 2GZZA 2JADA 4F9ZA 3IA1A 1BQ7A 1LJRA 3US3A 1AQVA 1SJ6A 3TKPA 1A2JA 1MD3A 3EC3A 3IC4A 1ML6A 4K6XA 1Z6MA 2JU5A 3SBCA 4KF9A 1GLPA 4HOJA 2K18A 4DEJA 2GQLA 4Q5NA 3RHBA 3P90A 2L6DA 1A8YA 4X43A 3O6TA 2YOIA 3ZMKA 1M99A 1AQWA 5D9WA 1M3IA 1WE0A 1UN2A 4QL9A 3FY7A 3P2AA 3S9FA 2VCTA 2LRCA 3KJYA 2PPTA 1GUKA 3GKMA 5HR1A 3HJOA 2H30A 2DMMA 2VL2C 2AAWA 3GTUA 3LWAA 14GSA 1ZMAA 1JFUA 4N30A 1GNWA 3FZ9A 2VL2A 2YN1A 3ZITA 2MMOA 5IIZA 3FEUA 1GTIA 3FKFA 1Z3EA 16GSA 2FHEA 4NHZA 18GSA 3ERGA 3Q19A 4I2UA 1KEBA 1XFLA 2A4VA 3LQ7A 2GSSA 4NPBA 4GCIA 2IMIA 5JCGA 3CSIA 4BVYB 12GSA 1ZOFA 2HSYA 7GSSA 1UA5A 3U6VA 1T7PB 4WXTA 5HR0A 2FWEA 2WCIA 3UIWA 2YV9A 3TRQA 4D73B 1M2DA 3R3EA 4TR4A 4BVXB 3A2XA 1X5DA 3FRCA 4K2DA 4KDYA 5ECIB 1F3AA 1Z7RA 1ERVA 3C73A 3G7IA 5CNWA 2P0GA 5A4WA 5BRTA 2OE3A 3MWHA 2B3SA 4EO3A 3KH9A 1OC9A 2LNTA 1X0RA 3OR5A 5HR3A 1K0MA 2H6XA 1GWCA 5ECLB 2G2QA 4J2FA 4LMWA 3LJRA 1JZWA 1T8EB 3A2VA 3QD9A 4HDEA 4Q5RA 1M9AA 3H93A 1Q4JA 3DKSA 2VL3A 1GL8A 2QKEA 3F3RA 4X0XA 2F9SA 5IMDA 2VIMA 1ACVA 2VO4A 2H76A 1GTAA 5G5FA 1XW9A 13GSA 1U88A 1TOFA 5H5SA 3WGDA 3H1NA 2GDRA 4E8EA 4PQ1A 1TTZA 3DVXA 2XHFA 4IS0A 3TJGA 4KCAA 4LA1A 4TRXA 3H4KA 3W8JA 4BWQA 4MJAA 1VF1A 1B9YC 3M1GA 1HNAA 3EE2A 1I5GA 1LU4A 5HR2A 5G5EA 3GTUB 3MNGA 5D8IA 4YQMA 1GLQA 4GTUA 4GSTA 5CRHA 2FNOA 3JCML 3QAWA 2A4HA 2MBTA 3GRXA 4XS6A 3F8UA 1SK1A 2L57A 1S3DA 2M46A 4GQCA 4K7NA 1PMTA 4YAVA 1F37A 1PA3A 2WULA 1T1VA 2AJQB 1JLWA 1K3OA 4TW5A 4I6XA 1G7EA 1B8XA 1E2YA 5DAKA 3DMLA 1GNEA 1VF4A 3HKRA 3DVWA 1CQGA 2DKHA 4OO4A 4WBJA 4O92A 3WGEA 1C72A 1G0TA 3KP8A 2MZCA 4ID0A 2UZ8A 5JWRB 2DMLA 1XW5A 4MK3A 2DJ0A 4QL7A 5D73A 3DYRA 3GMFA 3HZ8A 1GH2A 1YZXA 4L0UA 5ECQB 1XWKA 2L5OA 1OKTA 4ECIA 4TR3A 1X5CA 3LSZA 4QQ7A 1U6TA 1GSDA 1PN0A 2F51A 1KNGA 1SKWB 2PU9C 4IHUA 3F4TA 1FAAA 4TXVA 2HRAA 2C3TA 4K2XA 4NXIA 2N5AA 4IP6A 1ZL9A 4USSA 2YWIA 5D9XA 1YY7A 2IMEA 3CXGA 3HY2A 1SL1B 5J3RA 3IR4A 2R2JA 5ECPB 4K0GA 3ED3A 3GIXA 1ZCPA 2FCHA 3CTFA 3KXOA 4DSRA 2KUCA 1TP9A 5JCUA 1PQNA 2MMNA 1G7DA 3J7Yb 3GFKA 4DSSA 3GYKA 5F06A 1THXA 1JZDA 5CP1A 1XWCA 2H1DA 3MSZA 1ILOA 1NHYA 2AHEA 2MMAA 4N11A 1PD21 2NBSA 1R5AA 1F2EA 5A5KA 2LKUA 4JZQA 2YNXA 5KEJA 5LNKe 2DSAA 1V98A 2H01A 1XXUA 2X8GA 5IMZA 4EL1A 5G1KA 2WDUA 4ZB6A 5GAND 2X8CA 2YWMA 2LQOA 4F82A 2HRKA 4KX4A 1K0OA 1XW6A 5DAKB 3UBKA 4GF0A 2VUPA 2GS3A 4PNFA 1QXHA 4JR6A 2CA8A 1K0CA 1V9WA 1WRYA 2GGTA 4X1UA 4ZXGA 3FZAA 3NOFA 1NSWA 4POMA 5CO3A 4KW6A 2VL9A 5JWQB 3RHCA 1O7UA 3N5OA 3TKRA 2N5FA 1TJDA 4MZBA 4IN0A 3BD2A 1QQ2A 1TDIA 3KTLA 3VFIA 1SYRA 2WFCA 4JE1A 2VOCA 1KTEA 2R37A 4ACSA 2HXKA 1EGRA 2DIZA 4XIHA 2HT9A 5DVBA 1BJXA 4HSCX 2O8VB 4NV2A 3QR6A 1DE2A 4O5QA 2GQMA 2E0QA 2X49A 3BBYA 1Y6EA 3L9SA 4IW9A 3PINA 3UAPA 2LJRA 1JZOA 2L4QA 2L4CA 1WJKA 4IVFA 1YKCA 2JL4A 3TDGA 2QSIA 4AJ6A 1FO5A 1U3AA 4WR5A 4EIQA 2VLUA 2B6MA 3EU4A 4K5SA 1TKDB 2I3YA 3LXTA 3A2WA 3L4NA 2IIYA 4TR1A 2F8FA 3A5WA 2HE3A 2REMA 3BOAA 1RW1A 2CV4A 2KLXA 3PR8A 2JZSA 3A3TA 4KCEA 5ELAA 2H6ZA 1YQ1A 3FK8A 3VI7A 3TJBA 4CW9A 1AUCA 2LSTA 3VURA 1XZOA 1PGTA 2F8AA 1CQHA 2GVPA 2OE0A 2V6KA 1NHOA 1XOBA 1ON4A 1THOA 2GSQA 4PNGA 4ULXA 3DGQA 2CT6A 5DQSA 1RQMA 1VRSD 1TK8B 3QMXA 4MPFA 2X99A 3IK9A 2XC2A 3TRXA 2O87A 2VD1A 3GHAA 2KHPA 3E3EA 4MF6A 1A2MA 1F6MC 5J9BA 3UMAA 3ZIVA 1YF0A 2BTOT 3C1SA 2FD3A 6GSTA 2GQKA 2HLSA 3ZTLA 1R26A 2O85A 5DALA 1B48A 3GSSA 2X4AA 3TRPA 3DIEA 1XWGA 1X9SB 4YH2A
chains in the Genus database with same CATH topology
1N8JA 1WWJA 3VWXA 4V1Ap 3I6AA 4J57E 4FYBA 5IM9A 1X5EA 1TRVA 2HZEA 1XWBA 2XPEA 2IFQB 3O76A 4N0VA 1SENA 2X64A 20GSA 2WGRA 2CVKA 3LYPA 4HUAA 2K8VA 3BJ5A 3ZVJD 4CDOA 3EYTA 3WYWA 1TXXA 3TOUA 4E8HA 2PN8A 1FOVA 1B4PA 2WZ9A 4OCEA 1FG4A 2P5QA 4ZBBA 2JSZA 5LCZA 5B6NA 4TR1B 2XBIA 2OA7A 2VCXA 1K0NA 3IOSA 5C04A 5H5QA 2M72A 3ZIJA 4KSOA 3FW2A 3HA9A 5ID2B 3F9UA 1K0BA 4IKHA 5IMFA 3APOA 1NW2A 1LBKA 3HHVA 5EL8A 5FHIA 1ZZYA 1O73A 3KP9A 2B7JA 3PH9A 3APSA 3C8EA 4K8MA 4P3YB 2DBCA 2LEGA 3W8SA 5IPGA 2WB9A 3LORA 2R3XA 3C71A 4LL1B 4F2IA 3IHGA 3HXSA 3HD5A 5DCGA 5B8BA 2VCVA 3LW9A 1H75A 1R7HA 2H0GA 4OWYA 1MDIA 5IO2A 1O81A 6GSVA 1Z6NA 5ECMB 4I2TA 4KDXA 4ZILA 1GSFA 2RUEA 4XRAA 5AN1A 5DALB 5J9CA 3UEMA 2H6YA 5DCHA 3D5JA 3FR3A 4MPGA 5G1LA 2F3MA 6GSWA 3GSTA 2QA2A 2GSTA 3GKNA 1YDKA 4ZB8A 3QAVA 1SK2A 3DD3A 4FH8A 6GSXA 1EZKA 1GUMA 1A23A 2R0GA 1R4WA 4IGJA 4V2NA 4ZBDA 2K9FA 1JLVA 2VCZA 4HJMA 4MZCA 2HZEB 4L8EA 1MDKA 4ML1A 3UL3A 1JHBA 2DJKA 2WRTA 3EMXA 1T00A 5ECRB 1M2BA 2B5XA 5A4VA 2VD0A 4POLA 3L78A 4Z2TA 2R0CA 2XBQA 5DJLA 5GAPD 4G10A 2AUVA 8GSSA 5LD0A 4EIPA 4TOPA 2HYXA 2HSMA 3GH9A 2GLRA 4MNNA 1PN9A 2HFDA 4MH3A 1GTBA 2VM2A 3LGCA 1G6YA 3UOMA 3KH7A 4OMVA 5ECNB 2IL3A 3CTGA 1WOUA 4RQXA 5CRWA 3HVXA 4GXZA 3VWVA 2D2ZA 4YQUA 2PUKC 1FB0A 2H74A 2FWHA 2N5BA 2DC5A 17GSA 1XWAA 3HJPA 2IMDA 4OCFA 4I8BA 3GKKA 5GSSA 4FYCA 2FLSA 4EE0A 4XS4A 4KGIA 1A0RP 3KMNA 1EV4A 3RPPA 2EIRA 2OKAA 1S3CA 1V40A 2V41A 4J56E 4JRRA 5E4WA 3LG6A 3TUEA 2I1UA 2J9HA 1SKRB 3IV4A 2IPAA 1H4OA 2I4AA 3FHKA 2C1YA 4K0NA 2H0HA 2VM1A 1IYHA 1VF3A 4ZB9A 4O5RA 3GUSA 1K0DA 2DKIA 3QAGA 2HRFA 4XCSA 5CRDA 2GTUA 2A2RA 1TK5B 5EPFA 2H70A 5J5NA 3NZNA 1EP8A 4AF2A 5CYYA 2XPDA 4KA0A 3H8QA 4F0BA 2L6CA 4OO5A 3QOUA 3FMWA 1V57A 1QGVA 3D4MA 3WGXA 1T4ZA 4MZWA 3GH6A 4OD7A 5KOWA 5AIXA 3FYGA 2L5LA 3HCZA 1TRWA 1AIUA 2FA4A 5GSTA 5AISA 3L9VA 2I9HA 5CAXA 2R6KA 19GSA 3CRUA 3IAS2 4F0CA 5ECKB 3F4RA 4WBRD 3DXBA 4O5UA 1SYXA 4MF5A 5BMUA 4V2MA 1PRXA 2YJHA 1T3BA 4NWYA 1XCCA 2M66A 2M80A 4NMUA 4F03A 2E2MA 5AGYA 4ECJA 4AJ7A 4IQAA 3CSJA 1BEDA 5IOWA 1DE1A 3M8NA 4GQFA 5J4UA 1URMA 4ML6A 2C3NA 4K7OA 2RIIA 1QUWA 1IYIA 1SU9A 3VPQA 2G0FA 3MDKA 1M7TA 2LS5A 2H0IA 3PPUA 2VAFA 2LQQA 4RI7A 5F05A 1PX6A 4ICYA 5IMVA 2QA1A 1W89A 2VLVA 4ZL8A 1NM3A 4KSMA 4MH2A 2H73A 4X4JA 3QFBC 2DIYA 4XS4B 2FA8A 2R0PA 1HYUA 2RUFA 2LV3A 4CY8A 1FVJA 2FWGA 3ME8A 3VK9A 2ES7A 4YAPA 2K6VA 1MD4A 3D21A 4YQVA 4G0LA 1N2AA 5DQYA 3KTBA 2EC4A 5L71A 1M0UA 3D4TA 4GSSA 4KH7A 4OFMA 3TGZA 3BCIA 4TR0A 2H71A 3L9UA 4CHSA 2BJXA 2V32A 4G2EA 3QFAC 1EGOA 3TKSC 1SJZA 3GL5A 5COHA 1EOGA 2CQ9A 2LJAA 4EDYA 3J7Yk 2IFQA 3L0HA 3M9KA 2LUSA 3WT2A 5INYA 1O85A 3TKSA 1T4YA 1G6WA 2K8SA 4HEA2 4EF0A 1HNCA 2LNSA 1MEKA 5FWGA 5DJMA 3C1RA 2YJ7A 4A5PA 2J23A 4EDZA 4EKZA 3ISOA 2NTOA 5AIVA 1GSSA 3LFLA 3I9V2 1AAZA 4EVMA 4L0WA 2LJKA 3GL3A 3MYDA 2GT6A 1TW9A 3APQA 2PBJA 4GRFA 4EUYA 3K8NA 3IRAA 1PKZA 2C0EA 4AGSA 2PVOC 3RDWA 5ECHB 1VF2A 3TJJA 2GZPA 4HU7A 1UVZA 1YEXA 5ID2A 3EMPA 2L59A 1QMVA 2DJ2A 3M0FA 5KN1A 4JEDA 1X9MB 1XVQA 4MA9A 4NV5A 4BWSA 2MYGA 5KN0A 3VLNA 4WF5A 1TRSA 1ZYEA 4JR4A 5EVOA 3IAM2 4GWRA 3CSHA 2HRNA 3DRNA 1YEPA 1OAZA 3HDCA 3VPTA 2KP1A 2H19A 5D93A 1DUGA 2DLXA 1TK0B 4I97A 5F07A 2GZYA 1VGLA 3IPZA 2TIRA 3RPNA 4MP4A 3UARA 1EP7A 1XBSA 3TB2A 4ZBAA 3IHQA 4PGTA 4XRDA 3FR6A 1BAYA 4WF4A 3IK7A 5ECOB 2QC7A 2QGVA 2JACA 2KP2A 4MJCA 5F0GA 3WT1A 3IBHA 1K0AA 3ME7A 4H86A 1FHEA 2C80A 4TN8A 2CX4A 3EPTA 1ERTA 5ENUA 1M2AA 2EIQA 1KBNA 1GRXA 1PKWA 5IMAA 4G0IA 4G19A 5B8AA 1SD9A 4POKA 1ERWA 2FY6A 6GSYA 1BX9A 3EINA 1XPVA 5ABRA 4HZ4A 4PQIA 4TVEA 1M9BA 3VWUA 1J08A 1ZGNA 4WKWA 9GSSA 4NHWA 1TU8A 1Q98A 4Z7XA 4TKYA 2V2GA 3KEBA 4BA7A 3LEFA 2ZUPA 4XS1A 2CAQA 1QK8A 4K1FA 3GNJA 3LXZA 4WETA 4OFTA 3M9JA 2YANA 2C0FA 3ZMLA 3CMIA 3GA4A 2C0DA 5HFIA 5ECSA 4YKFA 3RBTA 1WIKA 4K5RA 3N9JA 4FIWA 3TKSE 2V6OA 3BCKA 3ERWA 4O32A 2HZFA 4IBPA 2FUG2 2YZHA 4Z2UA 22GSA 1BG5A 5C00A 3UBLA 4FQUA 1PL1A 2CZ2A 1YF1A 3D0ZA 2C3QA 2ON5A 2JZTA 4TXOA 2ALBA 3KCMA 2BMXA 2DJ3A 4FO5A 2PERA 1OYJA 4MLYA 1EWXA 1SL2B 1TRUA 1DSBA 2YV7A 3E9JB 5F8BA 1HNBA 1EEMA 1SKSB 4IQ1A 4ZIJA 1EOHA 1FW1A 3KGKA 1GSUA 2OADA 3D22A 3Q18A 1OE8A 3ZREA 5DBQA 3EVIA 5DDLA 3ZLPA 4ECCA 4HZ2A 2HSHA 4XTSA 4L5OA 1HD2A 1RK4A 3ZL5A 2E2GA 2GSRA 4K7IA 2P5RA 1PL2A 2PWJA 3HJMA 3DEXA 4BL7A 2MMZA 2H8LA 2RM6A 1MDJA 4O7HA 2CAIA 4GLTA 4K9ZA 4N10A 3W6GA 2H72A 1GSEA 4WEYA 1EV9A 3NIVA 4PXOA 1YJ6A 5EY6A 3FR9A 3GKXA 4RUVA 5CREA 1QFNA 4HQZA 1Z5YE 5G2ZA 3A5IA 1U87A 3V1WA 3HZ4A 4MMMA 1JZRA 2WS2A 3EWLA 4PTSA 1J0FA 4IJIA 5E59A 3UJ1A 1FB6A 2RLIA 3DWVA 5KN2A 3O3TA 1TU7A 11GSA 2KOKA 3R2QA 2H66A 2YZUA 4POBA 2C4JA 2IJYA 4KB3A 1ST9A 3TJFA 4MCUA 4EC0A 1ERUA 2VCWA 4LLRA 2CZ3A 4MF7A 4AJ8A 4MJBA 2O7KA 2O89A 1F3BA 4V2LA 2X8HA 5JCWA 1ABAA 3ZZXA 1OC3A 3UVHA 1K3YA 3I69A 2RM5A 1OE7A 4ECBA 3WD6A 3PGTA 3MIXA 3U5RE 2ON7A 1GP1A 2IMFA 1AXDA 1B4QA 3F6DA 3Q74A 2TRXA 1PSQA 4L5LA 4TXOB 3HVSA 2YWOA 3MAKA 3F4SA 3FZ4A 3ZYWA 2A2PA 3EU3A 1Z9HA 4JBBA 1A24A 1R5PA 1O8WA 3P7XA 1Z7PA 2P31A 1WP0A 1SD8A 4KUNA 3GV1A 4PQHA 2YP6A 2E7PA 1OC9B 5IO0A 2PVQA 3M3MA 4GSNA 6GSUA 3EURA 4WR4A 1USBA 5HFGA 1K3LA 10GSA 2Z9SA 1I9DA 3C7MA 1E6BA 4BL7B 6GSSA 4YKGA 2B5YA 4HS1A 1V58A 3ZFLA 5G30A 3TKQA 1TI1A 1G7OA 2H1BA 1GTUA 4RI6A 4HU9A 3HYPA 2PGTA 4ILFA 2YPMA 5D9VA 3AY8A 3ZRDA 1GUHA 1S3AA 3G7JA 1XIYA 2OJLA 2NDOA 5KN3A 3CRTA 1YKAA 4LMVA 5HQPA 2JZRA 2JSYA 5ELGA 2H1AA 2ZNMA 3I43A 3HVVA 2HI7A 1ZYNA 1EEJA 4PUAA 2CVDA 2H1GA 1DBYA 2VCQA 2LRNA 1XOAA 3IC8A 3TJKA 3SWLA 3LYKA 4FYUA 4Q5FA 2YWNA 1SJIA 2CVBA 1A2LA 1BYEA 4XHMA 2LRTA 3KD0A 1UC7A 3D6IA 5CRGA 3VI5A 1TI3A 5G31A 1WPIA 2R5GA 2V1MA 5IQYA 1MTCA 4N0ZA 5B7CA 3TOTA 4ISDA 3GURA 2AV4A 2AB6A 4PURA 2B5EA 2NPBA 3Q6OA 2B1LA 2IN3A 4IP1A 5B6MA 3TCOA 2I81A 3QPMA 5HFKA 1WMJA 3RAZA 1HQOA 4MDCA 3IXRA 3KZQA 4IJ3A 4EXJA 2PMTA 1GSYA 1X9WB 1OVNA 4KE3A 5H5RA 5A4UA 4HQSA 3QCPA 3GX0A 2TRCP 1J9BA 4LL4B 4IELA 3VWWA 3ZFBA 2ZCTA 3ZVJA 1SK0A 2IWTA 2FWFA 1XVWA 3KM6A 1A8LA 2AYTA 3H79A 1A0FA 3UVTA 1OKDA 4HJ2A 4DVCA 5IPHA 2B1KA 4DSQA 3F0IA 2OACA 4G0KA 4ZL9A 2NVLA 3E0UA 1F9MA 4G9HA 2OE1A 2WJUA 3CYNA 1AC1A 4Q5QA 3KIJA 3F63A 3ERFA 3F3QA 4ZL7A 2OBKA 4KNDA 1W4VA 2IMKA 1PX7A 5D9TA 4BPYA 4KDUA 5D96A 1Y25A 5IOXA 1GULA 2YCDA 3F6FA 4NAXA 2H75A 2OBIA 1V2AA 2GT5A 2EIOA 5JWOB 2HNLA 5GZZB 2B7KA 1SL0B 3CBUA 4RQRA 3IDVA 2C8UA 3P8WA 1AW9A 1AQXA 2FGXA 3KMOA 4DSSB 3QDNA 4PX1A 1B9XC 4CY6A 4Z2RA 1OC8A 3G7YA 1ZYQB 2LTKA 2R4VA 4HI7A 5J41A 1FOHA 1O8XA 3IE3A 3FZ5A 4OFNA 5KOXA 1O6JA 2MBSA 4BVYA 2DJJA 2DJ1A 3G9BA 4JU5A 1FVKA 4D73A 1GSQA 4BVXA 4KAEA 1ZYPA 2C0GA 3GN3A 4I5QA 4MJEA 2A2SA 4V1Ag 5FT3A 5IMCA 1U3IA 2CX3A 3GX8A 2VLTA 4PUFC 4MABA 2GZZA 2JADA 4F9ZA 3IA1A 1BQ7A 1LJRA 3US3A 1AQVA 1SJ6A 3TKPA 1A2JA 1MD3A 3EC3A 3IC4A 1ML6A 4K6XA 1Z6MA 2JU5A 3SBCA 4KF9A 1GLPA 4HOJA 2K18A 4DEJA 2GQLA 4Q5NA 3RHBA 3P90A 2L6DA 1A8YA 4X43A 3O6TA 2YOIA 3ZMKA 1M99A 1AQWA 5D9WA 1WE0A 1UN2A 4QL9A 3FY7A 3P2AA 3S9FA 2VCTA 2LRCA 3KJYA 2PPTA 1GUKA 3GKMA 5HR1A 3HJOA 2H30A 2DMMA 2VL2C 2AAWA 3GTUA 3LWAA 14GSA 1ZMAA 1JFUA 4N30A 1GNWA 3FZ9A 2VL2A 2YN1A 3ZITA 2MMOA 5IIZA 3FEUA 1GTIA 3FKFA 1Z3EA 16GSA 2FHEA 4NHZA 18GSA 3ERGA 3Q19A 4I2UA 1KEBA 1XFLA 2A4VA 3LQ7A 2GSSA 4NPBA 4GCIA 2IMIA 5JCGA 3CSIA 4BVYB 12GSA 1ZOFA 2HSYA 7GSSA 1UA5A 3U6VA 1T7PB 4WXTA 5HR0A 2FWEA 2WCIA 3UIWA 2YV9A 3TRQA 4D73B 1M2DA 3R3EA 4TR4A 4BVXB 3A2XA 1X5DA 3FRCA 4K2DA 4KDYA 5ECIB 1F3AA 1Z7RA 1ERVA 3C73A 3G7IA 5CNWA 2P0GA 5A4WA 5BRTA 2OE3A 3MWHA 2B3SA 4EO3A 3KH9A 1OC9A 2LNTA 1X0RA 3OR5A 5HR3A 1K0MA 2H6XA 1GWCA 5ECLB 2G2QA 4J2FA 4LMWA 3LJRA 1JZWA 1T8EB 3A2VA 3QD9A 4HDEA 4Q5RA 1M9AA 3H93A 1Q4JA 3DKSA 2VL3A 1GL8A 2QKEA 3F3RA 4X0XA 2F9SA 5IMDA 2VIMA 1ACVA 2VO4A 2H76A 1GTAA 5G5FA 1XW9A 13GSA 1U88A 1TOFA 5H5SA 3WGDA 3H1NA 2GDRA 4E8EA 4PQ1A 1TTZA 3DVXA 2XHFA 4IS0A 3TJGA 4KCAA 4LA1A 4TRXA 3H4KA 3W8JA 4BWQA 4MJAA 1VF1A 1B9YC 3M1GA 1HNAA 3EE2A 1I5GA 1LU4A 5HR2A 5G5EA 3GTUB 3MNGA 5D8IA 4YQMA 1GLQA 4GTUA 4GSTA 5CRHA 2FNOA 3JCML 3QAWA 2A4HA 2MBTA 3GRXA 4XS6A 3F8UA 1SK1A 2L57A 1S3DA 2M46A 4GQCA 4K7NA 1PMTA 4YAVA 1F37A 1PA3A 2WULA 1T1VA 2AJQB 1JLWA 1K3OA 4TW5A 4I6XA 1G7EA 1B8XA 1E2YA 5DAKA 3DMLA 1GNEA 1VF4A 3HKRA 3DVWA 1CQGA 2DKHA 4OO4A 4WBJA 4O92A 3WGEA 1C72A 1G0TA 3KP8A 2MZCA 4ID0A 2UZ8A 5JWRB 2DMLA 1XW5A 4MK3A 2DJ0A 4QL7A 5D73A 3DYRA 3GMFA 3HZ8A 1GH2A 1YZXA 4L0UA 5ECQB 1XWKA 2L5OA 1OKTA 4ECIA 4TR3A 1X5CA 3LSZA 4QQ7A 1U6TA 1GSDA 1PN0A 2F51A 1KNGA 1SKWB 2PU9C 4IHUA 3F4TA 1FAAA 4TXVA 2HRAA 2C3TA 4K2XA 4NXIA 2N5AA 4IP6A 1ZL9A 4USSA 2YWIA 5D9XA 1YY7A 2IMEA 3CXGA 3HY2A 1SL1B 5J3RA 3IR4A 2R2JA 5ECPB 4K0GA 3ED3A 3GIXA 1ZCPA 2FCHA 3CTFA 3KXOA 4DSRA 2KUCA 1TP9A 5JCUA 1PQNA 2MMNA 1G7DA 3J7Yb 3GFKA 4DSSA 3GYKA 5F06A 1THXA 1JZDA 5CP1A 1XWCA 2H1DA 3MSZA 1ILOA 1NHYA 2AHEA 2MMAA 4N11A 1PD21 2NBSA 1R5AA 1F2EA 5A5KA 2LKUA 4JZQA 2YNXA 5KEJA 5LNKe 2DSAA 1V98A 2H01A 1XXUA 2X8GA 5IMZA 4EL1A 5G1KA 2WDUA 4ZB6A 5GAND 2X8CA 2YWMA 2LQOA 4F82A 2HRKA 4KX4A 1K0OA 1XW6A 5DAKB 3UBKA 4GF0A 2VUPA 2GS3A 4PNFA 1QXHA 4JR6A 2CA8A 1K0CA 1V9WA 1WRYA 2GGTA 4X1UA 4ZXGA 3FZAA 3NOFA 1NSWA 4POMA 5CO3A 4KW6A 2VL9A 5JWQB 3RHCA 1O7UA 3N5OA 3TKRA 2N5FA 1TJDA 4MZBA 4IN0A 3BD2A 1QQ2A 1TDIA 3KTLA 3VFIA 1SYRA 2WFCA 4JE1A 2VOCA 1KTEA 2R37A 4ACSA 2HXKA 1EGRA 2DIZA 4XIHA 2HT9A 5DVBA 1BJXA 2O8VB 4NV2A 3QR6A 1DE2A 4O5QA 2GQMA 2E0QA 2X49A 3BBYA 1Y6EA 3L9SA 4IW9A 3PINA 3UAPA 2LJRA 1JZOA 2L4QA 2L4CA 1WJKA 4IVFA 1YKCA 2JL4A 3TDGA 2QSIA 4AJ6A 1FO5A 1U3AA 4WR5A 4EIQA 2VLUA 2B6MA 3EU4A 4K5SA 1TKDB 2I3YA 3LXTA 3A2WA 3L4NA 2IIYA 4TR1A 2F8FA 3A5WA 2HE3A 2REMA 3BOAA 1RW1A 2CV4A 2KLXA 3PR8A 2JZSA 3A3TA 4KCEA 5ELAA 2H6ZA 1YQ1A 3FK8A 3VI7A 3TJBA 4CW9A 1AUCA 2LSTA 3VURA 1XZOA 1PGTA 2F8AA 1CQHA 2GVPA 2OE0A 2V6KA 1NHOA 1XOBA 1ON4A 1THOA 2GSQA 4PNGA 4ULXA 3DGQA 2CT6A 5DQSA 1RQMA 1VRSD 1TK8B 3QMXA 4MPFA 2X99A 3IK9A 2XC2A 3TRXA 2O87A 2VD1A 3GHAA 2KHPA 3E3EA 4MF6A 1A2MA 1F6MC 5J9BA 3UMAA 3ZIVA 1YF0A 2BTOT 3C1SA 2FD3A 6GSTA 2GQKA 2HLSA 3ZTLA 1R26A 2O85A 5DALA 1B48A 3GSSA 2X4AA 3TRPA 3DIEA 1XWGA 1X9SB 4YH2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N8J A;  1WWJ A;  3VWX A;  4V1A p;  3I6A A;  4J57 E;  4FYB A;  5IM9 A;  1X5E A;  1TRV A;  2HZE A;  1XWB A;  2XPE A;  2IFQ B;  3O76 A;  4N0V A;  1SEN A;  2X64 A;  20GS A;  2WGR A;  2CVK A;  3LYP A;  4HUA A;  2K8V A;  3BJ5 A;  3ZVJ D;  4CDO A;  3EYT A;  3WYW A;  1TXX A;  3TOU A;  4E8H A;  2PN8 A;  1FOV A;  1B4P A;  2WZ9 A;  4OCE A;  1FG4 A;  2P5Q A;  4ZBB A;  2JSZ A;  5LCZ A;  5B6N A;  4TR1 B;  2XBI A;  2OA7 A;  2VCX A;  1K0N A;  3IOS A;  5C04 A;  5H5Q A;  2M72 A;  3ZIJ A;  4KSO A;  3FW2 A;  3HA9 A;  5ID2 B;  3F9U A;  1K0B A;  4IKH A;  5IMF A;  3APO A;  1NW2 A;  1LBK A;  3HHV A;  5EL8 A;  5FHI A;  1ZZY A;  1O73 A;  3KP9 A;  2B7J A;  3PH9 A;  3APS A;  3C8E A;  4K8M A;  4P3Y B;  2DBC A;  2LEG A;  3W8S A;  5IPG A;  2WB9 A;  3LOR A;  2R3X A;  3C71 A;  4LL1 B;  4F2I A;  3HXS A;  3HD5 A;  5DCG A;  5B8B A;  2VCV A;  1H75 A;  1R7H A;  2H0G A;  4OWY A;  1MDI A;  5IO2 A;  1O81 A;  6GSV A;  1Z6N A;  5ECM B;  4I2T A;  4KDX A;  4ZIL A;  1GSF A;  2RUE A;  4XRA A;  5AN1 A;  5DAL B;  5J9C A;  3UEM A;  2H6Y A;  5DCH A;  3D5J A;  3FR3 A;  4MPG A;  5G1L A;  2F3M A;  6GSW A;  3GST A;  2GST A;  3GKN A;  1YDK A;  4ZB8 A;  3QAV A;  1SK2 A;  3DD3 A;  4FH8 A;  6GSX A;  1EZK A;  1GUM A;  1A23 A;  1R4W A;  4IGJ A;  4V2N A;  4ZBD A;  2K9F A;  1JLV A;  2VCZ A;  4HJM A;  4MZC A;  2HZE B;  4L8E A;  1MDK A;  4ML1 A;  3UL3 A;  1JHB A;  2DJK A;  2WRT A;  3EMX A;  1T00 A;  5ECR B;  1M2B A;  2B5X A;  5A4V A;  2VD0 A;  4POL A;  3L78 A;  2XBQ A;  5DJL A;  5GAP D;  4G10 A;  2AUV A;  8GSS A;  5LD0 A;  4TOP A;  2HYX A;  3GH9 A;  2GLR A;  1PN9 A;  2HFD A;  4MH3 A;  1GTB A;  2VM2 A;  3LGC A;  1G6Y A;  3UOM A;  3KH7 A;  4OMV A;  5ECN B;  2IL3 A;  3CTG A;  1WOU A;  4RQX A;  5CRW A;  3HVX A;  4GXZ A;  3VWV A;  2D2Z A;  4YQU A;  2PUK C;  1FB0 A;  2H74 A;  2FWH A;  2N5B A;  2DC5 A;  17GS A;  1XWA A;  3HJP A;  2IMD A;  4OCF A;  4I8B A;  3GKK A;  5GSS A;  4FYC A;  2FLS A;  4EE0 A;  4XS4 A;  4KGI A;  1A0R P;  3KMN A;  1EV4 A;  3RPP A;  2EIR A;  2OKA A;  1S3C A;  1V40 A;  2V41 A;  4J56 E;  4JRR A;  5E4W A;  3LG6 A;  3TUE A;  2I1U A;  2J9H A;  1SKR B;  3IV4 A;  2IPA A;  1H4O A;  2I4A A;  3FHK A;  2C1Y A;  4K0N A;  2H0H A;  2VM1 A;  1IYH A;  1VF3 A;  4ZB9 A;  4O5R A;  3GUS A;  1K0D A;  3QAG A;  2HRF A;  4XCS A;  5CRD A;  2GTU A;  2A2R A;  1TK5 B;  5EPF A;  2H70 A;  5J5N A;  3NZN A;  1EP8 A;  4AF2 A;  5CYY A;  2XPD A;  4KA0 A;  3H8Q A;  4F0B A;  2L6C A;  4OO5 A;  3QOU A;  1V57 A;  1QGV A;  3D4M A;  3WGX A;  1T4Z A;  4MZW A;  3GH6 A;  4OD7 A;  5AIX A;  3FYG A;  2L5L A;  3HCZ A;  1TRW A;  1AIU A;  2FA4 A;  5GST A;  5AIS A;  3L9V A;  2I9H A;  5CAX A;  2R6K A;  19GS A;  3CRU A;  3IAS 2;  4F0C A;  5ECK B;  3F4R A;  4WBR D;  3DXB A;  1SYX A;  4MF5 A;  4V2M A;  1PRX A;  2YJH A;  1T3B A;  4NWY A;  1XCC A;  2M66 A;  2M80 A;  4NMU A;  4F03 A;  2E2M A;  5AGY A;  4ECJ A;  4AJ7 A;  4IQA A;  3CSJ A;  1BED A;  5IOW A;  1DE1 A;  3M8N A;  4GQF A;  5J4U A;  1URM A;  4ML6 A;  2C3N A;  4K7O A;  2RII A;  1QUW A;  1IYI A;  1SU9 A;  3VPQ A;  2G0F A;  3MDK A;  1M7T A;  2LS5 A;  2H0I A;  2VAF A;  2LQQ A;  4RI7 A;  5F05 A;  1PX6 A;  5IMV A;  1W89 A;  2VLV A;  4ZL8 A;  1NM3 A;  4KSM A;  4MH2 A;  2H73 A;  3QFB C;  2DIY A;  4XS4 B;  2FA8 A;  1HYU A;  2RUF A;  2LV3 A;  1FVJ A;  2FWG A;  3ME8 A;  3VK9 A;  2ES7 A;  4YAP A;  2K6V A;  1MD4 A;  3D21 A;  4YQV A;  1N2A A;  5DQY A;  3KTB A;  2EC4 A;  5L71 A;  1M0U A;  3D4T A;  4GSS A;  4KH7 A;  4OFM A;  3TGZ A;  3BCI A;  4TR0 A;  2H71 A;  3L9U A;  4CHS A;  2BJX A;  2V32 A;  4G2E A;  3QFA C;  1EGO A;  3TKS C;  1SJZ A;  3GL5 A;  5COH A;  1EOG A;  2CQ9 A;  2LJA A;  4EDY A;  3J7Y k;  2IFQ A;  3L0H A;  3M9K A;  2LUS A;  3WT2 A;  5INY A;  1O85 A;  3TKS A;  1T4Y A;  1G6W A;  2K8S A;  4HEA 2;  4EF0 A;  1HNC A;  2LNS A;  1MEK A;  5FWG A;  5DJM A;  3C1R A;  2YJ7 A;  2J23 A;  4EDZ A;  4EKZ A;  3ISO A;  2NTO A;  5AIV A;  1GSS A;  3LFL A;  3I9V 2;  1AAZ A;  4EVM A;  4L0W A;  2LJK A;  3GL3 A;  2GT6 A;  1TW9 A;  3APQ A;  2PBJ A;  4GRF A;  4EUY A;  3K8N A;  3IRA A;  1PKZ A;  2C0E A;  4AGS A;  2PVO C;  3RDW A;  5ECH B;  1VF2 A;  3TJJ A;  2GZP A;  4HU7 A;  1UVZ A;  1YEX A;  5ID2 A;  3EMP A;  2L59 A;  1QMV A;  2DJ2 A;  3M0F A;  5KN1 A;  4JED A;  1X9M B;  1XVQ A;  4MA9 A;  4NV5 A;  4BWS A;  2MYG A;  5KN0 A;  3VLN A;  4WF5 A;  1TRS A;  1ZYE A;  4JR4 A;  5EVO A;  3IAM 2;  4GWR A;  3CSH A;  2HRN A;  3DRN A;  1YEP A;  1OAZ A;  3HDC A;  3VPT A;  2KP1 A;  2H19 A;  5D93 A;  1DUG A;  2DLX A;  1TK0 B;  4I97 A;  5F07 A;  2GZY A;  1VGL A;  3IPZ A;  2TIR A;  3RPN A;  4MP4 A;  3UAR A;  1EP7 A;  1XBS A;  3TB2 A;  4ZBA A;  3IHQ A;  4PGT A;  4XRD A;  3FR6 A;  1BAY A;  4WF4 A;  3IK7 A;  5ECO B;  2QC7 A;  2QGV A;  2JAC A;  2KP2 A;  4MJC A;  5F0G A;  3WT1 A;  3IBH A;  1K0A A;  3ME7 A;  4H86 A;  1FHE A;  2C80 A;  4TN8 A;  2CX4 A;  1ERT A;  5ENU A;  1M2A A;  2EIQ A;  1KBN A;  1GRX A;  1PKW A;  5IMA A;  4G19 A;  5B8A A;  1SD9 A;  4POK A;  1ERW A;  2FY6 A;  6GSY A;  1BX9 A;  3EIN A;  1XPV A;  5ABR A;  4HZ4 A;  4PQI A;  4TVE A;  1M9B A;  3VWU A;  1J08 A;  1ZGN A;  4WKW A;  9GSS A;  4NHW A;  1TU8 A;  1Q98 A;  4Z7X A;  4TKY A;  2V2G A;  3KEB A;  4BA7 A;  3LEF A;  2ZUP A;  4XS1 A;  2CAQ A;  1QK8 A;  4K1F A;  3GNJ A;  3LXZ A;  4WET A;  4OFT A;  3M9J A;  2YAN A;  2C0F A;  3ZML A;  3CMI A;  3GA4 A;  2C0D A;  5HFI A;  5ECS A;  3RBT A;  1WIK A;  3N9J A;  4FIW A;  3TKS E;  2V6O A;  3BCK A;  3ERW A;  4O32 A;  2HZF A;  4IBP A;  2FUG 2;  2YZH A;  22GS A;  1BG5 A;  5C00 A;  3UBL A;  1PL1 A;  2CZ2 A;  1YF1 A;  3D0Z A;  2C3Q A;  2ON5 A;  2JZT A;  4TXO A;  2ALB A;  3KCM A;  2BMX A;  2DJ3 A;  4FO5 A;  2PER A;  1OYJ A;  4MLY A;  1EWX A;  1SL2 B;  1TRU A;  1DSB A;  2YV7 A;  3E9J B;  5F8B A;  1HNB A;  1EEM A;  1SKS B;  4IQ1 A;  4ZIJ A;  1EOH A;  1FW1 A;  3KGK A;  1GSU A;  2OAD A;  3D22 A;  3Q18 A;  1OE8 A;  3ZRE A;  5DBQ A;  3EVI A;  5DDL A;  3ZLP A;  4ECC A;  4HZ2 A;  2HSH A;  4XTS A;  4L5O A;  1HD2 A;  1RK4 A;  3ZL5 A;  2E2G A;  2GSR A;  4K7I A;  2P5R A;  1PL2 A;  2PWJ A;  3HJM A;  3DEX A;  4BL7 A;  2MMZ A;  2H8L A;  2RM6 A;  1MDJ A;  4O7H A;  2CAI A;  4GLT A;  4K9Z A;  4N10 A;  3W6G A;  2H72 A;  1GSE A;  4WEY A;  1EV9 A;  3NIV A;  4PXO A;  1YJ6 A;  5EY6 A;  3FR9 A;  3GKX A;  4RUV A;  5CRE A;  1QFN A;  4HQZ A;  1Z5Y E;  5G2Z A;  1U87 A;  3V1W A;  3HZ4 A;  4MMM A;  1JZR A;  2WS2 A;  3EWL A;  1J0F A;  4IJI A;  5E59 A;  3UJ1 A;  1FB6 A;  2RLI A;  3DWV A;  5KN2 A;  3O3T A;  1TU7 A;  11GS A;  2KOK A;  3R2Q A;  2H66 A;  2YZU A;  4POB A;  2C4J A;  2IJY A;  4KB3 A;  1ST9 A;  3TJF A;  4MCU A;  4EC0 A;  1ERU A;  2VCW A;  4LLR A;  2CZ3 A;  4MF7 A;  4AJ8 A;  4MJB A;  2O7K A;  2O89 A;  1F3B A;  4V2L A;  2X8H A;  5JCW A;  1ABA A;  3ZZX A;  1OC3 A;  3UVH A;  1K3Y A;  3I69 A;  2RM5 A;  1OE7 A;  4ECB A;  3WD6 A;  3PGT A;  3U5R E;  2ON7 A;  1GP1 A;  2IMF A;  1AXD A;  1B4Q A;  3F6D A;  3Q74 A;  2TRX A;  1PSQ A;  4L5L A;  4TXO B;  3HVS A;  2YWO A;  3MAK A;  3F4S A;  3FZ4 A;  3ZYW A;  3EU3 A;  1Z9H A;  4JBB A;  1A24 A;  1R5P A;  1O8W A;  3P7X A;  1Z7P A;  2P31 A;  1WP0 A;  1SD8 A;  4KUN A;  3GV1 A;  4PQH A;  2YP6 A;  2E7P A;  1OC9 B;  5IO0 A;  2PVQ A;  3M3M A;  4GSN A;  6GSU A;  3EUR A;  4WR4 A;  1USB A;  5HFG A;  1K3L A;  10GS A;  2Z9S A;  1I9D A;  3C7M A;  1E6B A;  6GSS A;  2B5Y A;  4HS1 A;  1V58 A;  3ZFL A;  5G30 A;  3TKQ A;  1TI1 A;  1G7O A;  2H1B A;  1GTU A;  4RI6 A;  4HU9 A;  3HYP A;  2PGT A;  4ILF A;  2YPM A;  5D9V A;  3AY8 A;  3ZRD A;  1GUH A;  1S3A A;  3G7J A;  1XIY A;  2OJL A;  2NDO A;  5KN3 A;  3CRT A;  1YKA A;  4LMV A;  5HQP A;  2JZR A;  2JSY A;  5ELG A;  2H1A A;  2ZNM A;  3I43 A;  3HVV A;  2HI7 A;  4PUA A;  1EEJ A;  2CVD A;  2H1G A;  1DBY A;  2VCQ A;  2LRN A;  1XOA A;  3TJK A;  3SWL A;  3LYK A;  4FYU A;  4Q5F A;  2YWN A;  1SJI A;  2CVB A;  1A2L A;  1BYE A;  4XHM A;  2LRT A;  3KD0 A;  1UC7 A;  3D6I A;  5CRG A;  3VI5 A;  1TI3 A;  5G31 A;  1WPI A;  2R5G A;  2V1M A;  5IQY A;  1MTC A;  4N0Z A;  5B7C A;  3TOT A;  4ISD A;  3GUR A;  2AV4 A;  2AB6 A;  4PUR A;  2B5E A;  2NPB A;  3Q6O A;  2B1L A;  2IN3 A;  4IP1 A;  5B6M A;  3TCO A;  2I81 A;  3QPM A;  5HFK A;  1WMJ A;  3RAZ A;  1HQO A;  4MDC A;  3IXR A;  3KZQ A;  4IJ3 A;  4EXJ A;  2PMT A;  1GSY A;  1X9W B;  1OVN A;  4KE3 A;  5H5R A;  5A4U A;  4HQS A;  3QCP A;  3GX0 A;  2TRC P;  1J9B A;  4LL4 B;  4IEL A;  3VWW A;  3ZFB A;  2ZCT A;  3ZVJ A;  1SK0 A;  2IWT A;  2FWF A;  1XVW A;  3KM6 A;  1A8L A;  2AYT A;  3H79 A;  1A0F A;  3UVT A;  1OKD A;  4HJ2 A;  4DVC A;  5IPH A;  2B1K A;  4DSQ A;  3F0I A;  2OAC A;  4ZL9 A;  2NVL A;  3E0U A;  1F9M A;  4G9H A;  2OE1 A;  2WJU A;  3CYN A;  1AC1 A;  4Q5Q A;  3KIJ A;  3F63 A;  3ERF A;  3F3Q A;  4ZL7 A;  2OBK A;  4KND A;  1W4V A;  2IMK A;  1PX7 A;  5D9T A;  4BPY A;  4KDU A;  5D96 A;  1Y25 A;  5IOX A;  1GUL A;  2YCD A;  3F6F A;  4NAX A;  2H75 A;  2OBI A;  1V2A A;  2GT5 A;  2EIO A;  5JWO B;  2HNL A;  5GZZ B;  2B7K A;  1SL0 B;  3CBU A;  4RQR A;  3IDV A;  2C8U A;  3P8W A;  1AW9 A;  1AQX A;  2FGX A;  3KMO A;  4DSS B;  3QDN A;  4PX1 A;  1B9X C;  1OC8 A;  3G7Y A;  1ZYQ B;  2LTK A;  2R4V A;  4HI7 A;  5J41 A;  1O8X A;  3IE3 A;  3FZ5 A;  4OFN A;  1O6J A;  2MBS A;  4BVY A;  2DJJ A;  2DJ1 A;  3G9B A;  4JU5 A;  1FVK A;  4D73 A;  1GSQ A;  4BVX A;  4KAE A;  2C0G A;  3GN3 A;  4I5Q A;  4MJE A;  2A2S A;  4V1A g;  5FT3 A;  5IMC A;  1U3I A;  2CX3 A;  3GX8 A;  2VLT A;  4PUF C;  4MAB A;  2GZZ A;  2JAD A;  4F9Z A;  3IA1 A;  1BQ7 A;  1LJR A;  3US3 A;  1AQV A;  1SJ6 A;  3TKP A;  1A2J A;  1MD3 A;  3EC3 A;  3IC4 A;  1ML6 A;  4K6X A;  1Z6M A;  2JU5 A;  3SBC A;  1GLP A;  4HOJ A;  2K18 A;  4DEJ A;  2GQL A;  4Q5N A;  3RHB A;  3P90 A;  2L6D A;  1A8Y A;  4X43 A;  3O6T A;  2YOI A;  3ZMK A;  1M99 A;  1AQW A;  5D9W A;  1WE0 A;  1UN2 A;  4QL9 A;  3FY7 A;  3P2A A;  3S9F A;  2VCT A;  2LRC A;  3KJY A;  2PPT A;  1GUK A;  3GKM A;  5HR1 A;  3HJO A;  2H30 A;  2DMM A;  2VL2 C;  2AAW A;  3GTU A;  3LWA A;  14GS A;  1ZMA A;  1JFU A;  4N30 A;  1GNW A;  3FZ9 A;  2VL2 A;  2YN1 A;  3ZIT A;  2MMO A;  5IIZ A;  3FEU A;  1GTI A;  3FKF A;  1Z3E A;  16GS A;  2FHE A;  4NHZ A;  18GS A;  3ERG A;  3Q19 A;  4I2U A;  1KEB A;  1XFL A;  2A4V A;  3LQ7 A;  2GSS A;  4NPB A;  4GCI A;  2IMI A;  5JCG A;  3CSI A;  12GS A;  1ZOF A;  2HSY A;  7GSS A;  1UA5 A;  3U6V A;  1T7P B;  4WXT A;  5HR0 A;  2FWE A;  2WCI A;  3UIW A;  2YV9 A;  3TRQ A;  4D73 B;  1M2D A;  4TR4 A;  3A2X A;  1X5D A;  3FRC A;  4K2D A;  4KDY A;  5ECI B;  1F3A A;  1Z7R A;  1ERV A;  3C73 A;  3G7I A;  5CNW A;  2P0G A;  5A4W A;  2OE3 A;  3MWH A;  2B3S A;  4EO3 A;  3KH9 A;  1OC9 A;  2LNT A;  1X0R A;  3OR5 A;  5HR3 A;  1K0M A;  2H6X A;  1GWC A;  5ECL B;  2G2Q A;  4J2F A;  4LMW A;  3LJR A;  1JZW A;  1T8E B;  3A2V A;  3QD9 A;  4HDE A;  4Q5R A;  1M9A A;  3H93 A;  1Q4J A;  3DKS A;  2VL3 A;  1GL8 A;  2QKE A;  3F3R A;  4X0X A;  2F9S A;  5IMD A;  2VIM A;  1ACV A;  2VO4 A;  2H76 A;  1GTA A;  5G5F A;  1XW9 A;  13GS A;  1U88 A;  1TOF A;  5H5S A;  3WGD A;  3H1N A;  2GDR A;  4E8E A;  4PQ1 A;  1TTZ A;  3DVX A;  2XHF A;  4IS0 A;  3TJG A;  4KCA A;  4LA1 A;  4TRX A;  3H4K A;  3W8J A;  4BWQ A;  4MJA A;  1VF1 A;  1B9Y C;  3M1G A;  1HNA A;  3EE2 A;  1I5G A;  1LU4 A;  5HR2 A;  5G5E A;  3GTU B;  3MNG A;  5D8I A;  4YQM A;  1GLQ A;  4GTU A;  4GST A;  5CRH A;  2FNO A;  3JCM L;  3QAW A;  2MBT A;  3GRX A;  4XS6 A;  3F8U A;  1SK1 A;  2L57 A;  1S3D A;  2M46 A;  4GQC A;  4K7N A;  1PMT A;  4YAV A;  1F37 A;  1PA3 A;  2WUL A;  1T1V A;  2AJQ B;  1JLW A;  1K3O A;  4TW5 A;  4I6X A;  1G7E A;  1B8X A;  1E2Y A;  5DAK A;  3DML A;  1GNE A;  1VF4 A;  3HKR A;  3DVW A;  1CQG A;  4OO4 A;  4WBJ A;  4O92 A;  3WGE A;  1C72 A;  1G0T A;  3KP8 A;  2MZC A;  4ID0 A;  5JWR B;  2DML A;  1XW5 A;  4MK3 A;  2DJ0 A;  4QL7 A;  5D73 A;  3DYR A;  3GMF A;  3HZ8 A;  1GH2 A;  1YZX A;  4L0U A;  5ECQ B;  1XWK A;  2L5O A;  1OKT A;  4ECI A;  4TR3 A;  1X5C A;  3LSZ A;  4QQ7 A;  1U6T A;  1GSD A;  2F51 A;  1KNG A;  1SKW B;  2PU9 C;  4IHU A;  3F4T A;  1FAA A;  4TXV A;  2C3T A;  4NXI A;  2N5A A;  4IP6 A;  1ZL9 A;  5D9X A;  2YWI A;  1YY7 A;  2IME A;  3CXG A;  3HY2 A;  1SL1 B;  5J3R A;  3IR4 A;  2R2J A;  5ECP B;  4K0G A;  3ED3 A;  3GIX A;  1ZCP A;  2FCH A;  3CTF A;  3KXO A;  4DSR A;  2KUC A;  1TP9 A;  5JCU A;  1PQN A;  2MMN A;  1G7D A;  3J7Y b;  3GFK A;  4DSS A;  3GYK A;  5F06 A;  1THX A;  1JZD A;  5CP1 A;  1XWC A;  2H1D A;  3MSZ A;  1ILO A;  1NHY A;  2AHE A;  2MMA A;  4N11 A;  1PD2 1;  2NBS A;  1R5A A;  1F2E A;  5A5K A;  2LKU A;  4JZQ A;  2YNX A;  5KEJ A;  5LNK e;  2DSA A;  1V98 A;  2H01 A;  1XXU A;  2X8G A;  5IMZ A;  4EL1 A;  5G1K A;  2WDU A;  4ZB6 A;  5GAN D;  2X8C A;  2YWM A;  2LQO A;  4F82 A;  4KX4 A;  1K0O A;  1XW6 A;  5DAK B;  3UBK A;  4GF0 A;  2VUP A;  2GS3 A;  4PNF A;  1QXH A;  4JR6 A;  2CA8 A;  1K0C A;  1V9W A;  1WRY A;  2GGT A;  4X1U A;  4ZXG A;  3FZA A;  3NOF A;  1NSW A;  4POM A;  5CO3 A;  4KW6 A;  2VL9 A;  5JWQ B;  3RHC A;  1O7U A;  3N5O A;  3TKR A;  2N5F A;  1TJD A;  4MZB A;  4IN0 A;  3BD2 A;  1QQ2 A;  1TDI A;  3KTL A;  3VFI A;  1SYR A;  2WFC A;  4JE1 A;  2VOC A;  1KTE A;  2R37 A;  4ACS A;  2HXK A;  1EGR A;  2DIZ A;  4XIH A;  2HT9 A;  5DVB A;  1BJX A;  2O8V B;  4NV2 A;  3QR6 A;  1DE2 A;  2GQM A;  2E0Q A;  3BBY A;  1Y6E A;  3L9S A;  4IW9 A;  3PIN A;  3UAP A;  2LJR A;  1JZO A;  2L4Q A;  2L4C A;  1WJK A;  4IVF A;  1YKC A;  2JL4 A;  3TDG A;  2QSI A;  4AJ6 A;  1FO5 A;  1U3A A;  4WR5 A;  2VLU A;  2B6M A;  3EU4 A;  1TKD B;  2I3Y A;  3LXT A;  3A2W A;  3L4N A;  2IIY A;  4TR1 A;  2F8F A;  3A5W A;  2HE3 A;  2REM A;  3BOA A;  1RW1 A;  2CV4 A;  2KLX A;  3PR8 A;  2JZS A;  3A3T A;  4KCE A;  5ELA A;  2H6Z A;  1YQ1 A;  3FK8 A;  3VI7 A;  3TJB A;  4CW9 A;  1AUC A;  2LST A;  3VUR A;  1XZO A;  1PGT A;  2F8A A;  1CQH A;  2GVP A;  2OE0 A;  2V6K A;  1NHO A;  1XOB A;  1ON4 A;  1THO A;  2GSQ A;  4PNG A;  4ULX A;  3DGQ A;  2CT6 A;  5DQS A;  1RQM A;  1VRS D;  1TK8 B;  3QMX A;  4MPF A;  2X99 A;  3IK9 A;  2XC2 A;  3TRX A;  2O87 A;  2VD1 A;  3GHA A;  2KHP A;  3E3E A;  4MF6 A;  1A2M A;  1F6M C;  5J9B A;  3UMA A;  3ZIV A;  1YF0 A;  2BTO T;  3C1S A;  2FD3 A;  6GST A;  2GQK A;  2HLS A;  3ZTL A;  1R26 A;  2O85 A;  5DAL A;  1B48 A;  3GSS A;  3TRP A;  3DIE A;  1XWG A;  1X9S B;  4YH2 A; 
#chains in the Genus database with same CATH topology
 1N8J A;  1WWJ A;  3VWX A;  4V1A p;  3I6A A;  4J57 E;  4FYB A;  5IM9 A;  1X5E A;  1TRV A;  2HZE A;  1XWB A;  2XPE A;  2IFQ B;  3O76 A;  4N0V A;  1SEN A;  2X64 A;  20GS A;  2WGR A;  2CVK A;  3LYP A;  4HUA A;  2K8V A;  3BJ5 A;  3ZVJ D;  4CDO A;  3EYT A;  3WYW A;  1TXX A;  3TOU A;  4E8H A;  2PN8 A;  1FOV A;  1B4P A;  2WZ9 A;  4OCE A;  1FG4 A;  2P5Q A;  4ZBB A;  2JSZ A;  5LCZ A;  5B6N A;  4TR1 B;  2XBI A;  2OA7 A;  2VCX A;  1K0N A;  3IOS A;  5C04 A;  5H5Q A;  2M72 A;  3ZIJ A;  4KSO A;  3FW2 A;  3HA9 A;  5ID2 B;  3F9U A;  1K0B A;  4IKH A;  5IMF A;  3APO A;  1NW2 A;  1LBK A;  3HHV A;  5EL8 A;  5FHI A;  1ZZY A;  1O73 A;  3KP9 A;  2B7J A;  3PH9 A;  3APS A;  3C8E A;  1S3R A;  4K8M A;  4P3Y B;  2DBC A;  2LEG A;  3W8S A;  5IPG A;  2WB9 A;  3LOR A;  2R3X A;  3C71 A;  4LL1 B;  4F2I A;  3IHG A;  3HXS A;  3HD5 A;  5DCG A;  5B8B A;  2VCV A;  3LW9 A;  1H75 A;  1R7H A;  2H0G A;  4OWY A;  1MDI A;  5IO2 A;  1O81 A;  6GSV A;  1Z6N A;  5ECM B;  4I2T A;  4KDX A;  4ZIL A;  1GSF A;  2RUE A;  4XRA A;  5AN1 A;  5DAL B;  5J9C A;  3UEM A;  2H6Y A;  5DCH A;  3D5J A;  3FR3 A;  4MPG A;  5G1L A;  2F3M A;  6GSW A;  3GST A;  2QA2 A;  2GST A;  3GKN A;  1YDK A;  4ZB8 A;  3QAV A;  1SK2 A;  3DD3 A;  4FH8 A;  6GSX A;  1EZK A;  1GUM A;  1A23 A;  2R0G A;  1R4W A;  4IGJ A;  4V2N A;  4ZBD A;  2K9F A;  1JLV A;  2VCZ A;  4HJM A;  4MZC A;  2HZE B;  4L8E A;  1MDK A;  4ML1 A;  3UL3 A;  1JHB A;  2DJK A;  2WRT A;  3EMX A;  1T00 A;  5ECR B;  1M2B A;  2B5X A;  5A4V A;  2VD0 A;  4POL A;  4BIK A;  3L78 A;  4Z2T A;  2R0C A;  2XBQ A;  5DJL A;  5GAP D;  4G10 A;  2AUV A;  8GSS A;  5LD0 A;  4EIP A;  4TOP A;  2HYX A;  2HSM A;  3GH9 A;  2GLR A;  4MNN A;  1PN9 A;  3HVN A;  2HFD A;  4MH3 A;  1GTB A;  2VM2 A;  3LGC A;  1G6Y A;  3UOM A;  3KH7 A;  4OMV A;  5ECN B;  2IL3 A;  3CTG A;  1WOU A;  4RQX A;  5CRW A;  3HVX A;  4GXZ A;  3VWV A;  2D2Z A;  4YQU A;  2PUK C;  1FB0 A;  2H74 A;  2FWH A;  2N5B A;  2DC5 A;  17GS A;  1XWA A;  3HJP A;  2IMD A;  4OCF A;  4I8B A;  3GKK A;  5GSS A;  4FYC A;  2FLS A;  4EE0 A;  4XS4 A;  4KGI A;  1A0R P;  3KMN A;  1EV4 A;  3RPP A;  2EIR A;  2OKA A;  1S3C A;  1V40 A;  2V41 A;  4J56 E;  4JRR A;  5E4W A;  3LG6 A;  3TUE A;  2I1U A;  2J9H A;  1SKR B;  3IV4 A;  2IPA A;  1H4O A;  2I4A A;  3FHK A;  2C1Y A;  4K0N A;  2H0H A;  2VM1 A;  1IYH A;  1VF3 A;  4ZB9 A;  4O5R A;  3GUS A;  1K0D A;  2DKI A;  3QAG A;  2HRF A;  4XCS A;  5CRD A;  2GTU A;  2A2R A;  1TK5 B;  5EPF A;  2H70 A;  5J5N A;  3NZN A;  1EP8 A;  4AF2 A;  5CYY A;  2XPD A;  4KA0 A;  3H8Q A;  4F0B A;  2L6C A;  4OO5 A;  3QOU A;  3FMW A;  1V57 A;  1QGV A;  3D4M A;  3WGX A;  1T4Z A;  4MZW A;  3GH6 A;  4OD7 A;  5KOW A;  5AIX A;  3FYG A;  2L5L A;  3HCZ A;  1TRW A;  1AIU A;  2FA4 A;  5GST A;  5AIS A;  3L9V A;  2I9H A;  5CAX A;  2R6K A;  19GS A;  3CRU A;  3IAS 2;  4F0C A;  5ECK B;  3F4R A;  4WBR D;  3DXB A;  4O5U A;  1SYX A;  4MF5 A;  5BMU A;  4V2M A;  1PRX A;  2YJH A;  1T3B A;  4NWY A;  1XCC A;  2M66 A;  2M80 A;  4NMU A;  4F03 A;  2E2M A;  5AGY A;  4ECJ A;  4AJ7 A;  4IQA A;  3CSJ A;  1BED A;  5IOW A;  1DE1 A;  3M8N A;  4GQF A;  5J4U A;  1URM A;  4ML6 A;  2C3N A;  4K7O A;  2RII A;  1QUW A;  1IYI A;  1SU9 A;  3VPQ A;  2G0F A;  3MDK A;  1M7T A;  2LS5 A;  2H0I A;  3PPU A;  2VAF A;  2LQQ A;  4RI7 A;  5F05 A;  1PX6 A;  4ICY A;  5IMV A;  2QA1 A;  1W89 A;  2VLV A;  4ZL8 A;  1NM3 A;  4KSM A;  4MH2 A;  2H73 A;  4X4J A;  3QFB C;  2DIY A;  4XS4 B;  2FA8 A;  2R0P A;  1HYU A;  2RUF A;  2LV3 A;  4CY8 A;  1FVJ A;  2FWG A;  3ME8 A;  3VK9 A;  2ES7 A;  4YAP A;  2K6V A;  1MD4 A;  3D21 A;  4YQV A;  4G0L A;  1N2A A;  5DQY A;  3KTB A;  2EC4 A;  5L71 A;  1M0U A;  3D4T A;  4GSS A;  4KH7 A;  4OFM A;  3TGZ A;  3BCI A;  4TR0 A;  2H71 A;  3L9U A;  4CHS A;  2BJX A;  2V32 A;  4G2E A;  3QFA C;  1EGO A;  3TKS C;  1SJZ A;  3GL5 A;  5COH A;  1EOG A;  2CQ9 A;  2LJA A;  4EDY A;  3J7Y k;  2IFQ A;  3L0H A;  3M9K A;  2LUS A;  3WT2 A;  5INY A;  1O85 A;  3TKS A;  1T4Y A;  1G6W A;  2K8S A;  4HEA 2;  4EF0 A;  1HNC A;  2LNS A;  1MEK A;  5FWG A;  5DJM A;  3C1R A;  2YJ7 A;  4A5P A;  2J23 A;  4EDZ A;  4EKZ A;  3ISO A;  2NTO A;  5AIV A;  1GSS A;  3LFL A;  3I9V 2;  1AAZ A;  4EVM A;  4L0W A;  2LJK A;  3GL3 A;  3MYD A;  2GT6 A;  1TW9 A;  3APQ A;  2PBJ A;  4GRF A;  4EUY A;  3K8N A;  3IRA A;  1PKZ A;  2C0E A;  4AGS A;  2PVO C;  3RDW A;  5ECH B;  1PFO A;  1VF2 A;  3TJJ A;  2GZP A;  4HU7 A;  1UVZ A;  1YEX A;  5ID2 A;  3EMP A;  2L59 A;  1QMV A;  2DJ2 A;  3M0F A;  5KN1 A;  4JED A;  1X9M B;  1XVQ A;  4MA9 A;  4NV5 A;  4BWS A;  2MYG A;  5KN0 A;  3VLN A;  4WF5 A;  1TRS A;  1ZYE A;  4JR4 A;  5EVO A;  3IAM 2;  4GWR A;  3CSH A;  2HRN A;  3DRN A;  1YEP A;  1OAZ A;  3HDC A;  3VPT A;  2KP1 A;  2H19 A;  5D93 A;  1DUG A;  2DLX A;  1TK0 B;  4I97 A;  5F07 A;  2GZY A;  1VGL A;  3IPZ A;  2TIR A;  3RPN A;  4MP4 A;  3UAR A;  1EP7 A;  1XBS A;  3TB2 A;  4ZBA A;  3IHQ A;  4PGT A;  4XRD A;  3FR6 A;  1BAY A;  4WF4 A;  3IK7 A;  5ECO B;  2QC7 A;  2QGV A;  2JAC A;  2KP2 A;  4MJC A;  5F0G A;  3WT1 A;  3IBH A;  1K0A A;  3ME7 A;  4H86 A;  1FHE A;  2C80 A;  4TN8 A;  2CX4 A;  3EPT A;  1ERT A;  5ENU A;  1M2A A;  2EIQ A;  1KBN A;  1GRX A;  1PKW A;  5IMA A;  4G0I A;  4G19 A;  5B8A A;  1SD9 A;  4POK A;  1ERW A;  2FY6 A;  6GSY A;  1BX9 A;  3EIN A;  1XPV A;  5ABR A;  4HZ4 A;  4PQI A;  4TVE A;  1M9B A;  3VWU A;  1J08 A;  1ZGN A;  4WKW A;  9GSS A;  4NHW A;  1TU8 A;  1Q98 A;  4Z7X A;  4TKY A;  2V2G A;  3KEB A;  4BA7 A;  3LEF A;  2ZUP A;  4XS1 A;  2CAQ A;  1QK8 A;  4K1F A;  3GNJ A;  3LXZ A;  4WET A;  4OFT A;  3M9J A;  2YAN A;  2C0F A;  3ZML A;  3CMI A;  3GA4 A;  2C0D A;  5HFI A;  5ECS A;  4YKF A;  3RBT A;  1WIK A;  4K5R A;  3N9J A;  4FIW A;  3TKS E;  2V6O A;  3BCK A;  3ERW A;  4O32 A;  2HZF A;  4IBP A;  2FUG 2;  2YZH A;  4Z2U A;  22GS A;  1BG5 A;  5C00 A;  3UBL A;  4FQU A;  1PL1 A;  2CZ2 A;  1YF1 A;  3D0Z A;  2C3Q A;  2ON5 A;  2JZT A;  4TXO A;  2ALB A;  3KCM A;  2BMX A;  2DJ3 A;  4FO5 A;  2PER A;  1OYJ A;  4MLY A;  1EWX A;  1SL2 B;  1TRU A;  1DSB A;  2YV7 A;  3E9J B;  5F8B A;  1HNB A;  1EEM A;  1SKS B;  4IQ1 A;  4ZIJ A;  1EOH A;  1FW1 A;  3KGK A;  1GSU A;  2OAD A;  3D22 A;  3Q18 A;  1OE8 A;  3ZRE A;  5DBQ A;  3EVI A;  5DDL A;  3ZLP A;  4ECC A;  4HZ2 A;  2HSH A;  4XTS A;  4L5O A;  1HD2 A;  1RK4 A;  3ZL5 A;  2E2G A;  2GSR A;  4K7I A;  2P5R A;  1PL2 A;  2PWJ A;  3HJM A;  3DEX A;  4BL7 A;  2MMZ A;  2H8L A;  2RM6 A;  1MDJ A;  4O7H A;  2CAI A;  4GLT A;  4K9Z A;  4N10 A;  3W6G A;  2H72 A;  1GSE A;  4WEY A;  1EV9 A;  3NIV A;  4PXO A;  1YJ6 A;  5EY6 A;  3FR9 A;  3GKX A;  4RUV A;  5CRE A;  1QFN A;  4HQZ A;  1Z5Y E;  5G2Z A;  3A5I A;  1U87 A;  3V1W A;  3HZ4 A;  4MMM A;  1JZR A;  2WS2 A;  3EWL A;  4PTS A;  1J0F A;  4IJI A;  5E59 A;  3UJ1 A;  1FB6 A;  2RLI A;  3DWV A;  5KN2 A;  3O3T A;  1TU7 A;  11GS A;  2KOK A;  3R2Q A;  2H66 A;  2YZU A;  4POB A;  2C4J A;  2IJY A;  4KB3 A;  1ST9 A;  3TJF A;  4MCU A;  4EC0 A;  1ERU A;  2VCW A;  4LLR A;  2CZ3 A;  4MF7 A;  4AJ8 A;  4MJB A;  2O7K A;  2O89 A;  1F3B A;  4V2L A;  2X8H A;  5JCW A;  1ABA A;  3ZZX A;  1OC3 A;  3UVH A;  1K3Y A;  3I69 A;  2RM5 A;  1OE7 A;  4ECB A;  3WD6 A;  3PGT A;  3MIX A;  3U5R E;  2ON7 A;  1GP1 A;  2IMF A;  1AXD A;  1B4Q A;  3F6D A;  3Q74 A;  2TRX A;  1PSQ A;  4L5L A;  4TXO B;  3HVS A;  2YWO A;  3MAK A;  3F4S A;  3FZ4 A;  3ZYW A;  2A2P A;  3EU3 A;  1Z9H A;  4JBB A;  1A24 A;  1R5P A;  1O8W A;  3P7X A;  1Z7P A;  2P31 A;  1WP0 A;  1SD8 A;  4KUN A;  3GV1 A;  4PQH A;  2YP6 A;  2E7P A;  1OC9 B;  5IO0 A;  2PVQ A;  3M3M A;  4GSN A;  6GSU A;  3EUR A;  4WR4 A;  1USB A;  5HFG A;  1K3L A;  10GS A;  2Z9S A;  1I9D A;  3C7M A;  1E6B A;  4BL7 B;  6GSS A;  4YKG A;  2B5Y A;  4HS1 A;  1V58 A;  3ZFL A;  5G30 A;  3TKQ A;  1TI1 A;  1G7O A;  2H1B A;  1GTU A;  4RI6 A;  4HU9 A;  3HYP A;  2PGT A;  4ILF A;  2YPM A;  5D9V A;  3AY8 A;  3ZRD A;  1GUH A;  1S3A A;  3G7J A;  1XIY A;  2OJL A;  2NDO A;  5KN3 A;  3CRT A;  1YKA A;  4LMV A;  5HQP A;  2JZR A;  2JSY A;  5ELG A;  2H1A A;  2ZNM A;  3I43 A;  3HVV A;  2HI7 A;  1ZYN A;  1EEJ A;  4PUA A;  2CVD A;  2H1G A;  1DBY A;  2VCQ A;  2LRN A;  1XOA A;  3IC8 A;  3TJK A;  3SWL A;  3LYK A;  4FYU A;  4Q5F A;  2YWN A;  1SJI A;  2CVB A;  1A2L A;  1BYE A;  4XHM A;  2LRT A;  3KD0 A;  1UC7 A;  3D6I A;  5CRG A;  3VI5 A;  1TI3 A;  5G31 A;  1WPI A;  2R5G A;  2V1M A;  5IQY A;  1MTC A;  4N0Z A;  5B7C A;  3TOT A;  4ISD A;  3GUR A;  2AV4 A;  2AB6 A;  4PUR A;  2B5E A;  2NPB A;  3Q6O A;  2B1L A;  2IN3 A;  4IP1 A;  5B6M A;  3TCO A;  2I81 A;  3QPM A;  5HFK A;  1WMJ A;  3RAZ A;  1HQO A;  4MDC A;  3IXR A;  3KZQ A;  4IJ3 A;  4EXJ A;  2PMT A;  1GSY A;  1X9W B;  1OVN A;  4KE3 A;  5H5R A;  5A4U A;  4HQS A;  3QCP A;  3GX0 A;  2TRC P;  1J9B A;  4LL4 B;  4IEL A;  3VWW A;  3ZFB A;  2ZCT A;  3ZVJ A;  1SK0 A;  2IWT A;  2FWF A;  1XVW A;  3KM6 A;  1A8L A;  2AYT A;  3H79 A;  1A0F A;  3UVT A;  1OKD A;  4HJ2 A;  4DVC A;  5IPH A;  2B1K A;  4DSQ A;  3F0I A;  2OAC A;  4G0K A;  4ZL9 A;  2NVL A;  3E0U A;  1F9M A;  4G9H A;  2OE1 A;  2WJU A;  3CYN A;  1AC1 A;  4Q5Q A;  3KIJ A;  3F63 A;  3ERF A;  3F3Q A;  4ZL7 A;  2OBK A;  4KND A;  1W4V A;  2IMK A;  1PX7 A;  5D9T A;  4BPY A;  4KDU A;  5D96 A;  1Y25 A;  5IOX A;  1GUL A;  2YCD A;  3F6F A;  3CQF A;  4NAX A;  2H75 A;  2OBI A;  1V2A A;  2GT5 A;  2EIO A;  5JWO B;  2HNL A;  5GZZ B;  2B7K A;  1SL0 B;  3CBU A;  4RQR A;  3IDV A;  2C8U A;  1M3J A;  3P8W A;  1AW9 A;  1AQX A;  2FGX A;  3KMO A;  4DSS B;  3QDN A;  4PX1 A;  1B9X C;  4CY6 A;  4Z2R A;  1OC8 A;  3G7Y A;  1ZYQ B;  2LTK A;  2R4V A;  4HI7 A;  5J41 A;  1FOH A;  1O8X A;  3IE3 A;  3FZ5 A;  4OFN A;  5KOX A;  1O6J A;  1XG8 A;  2MBS A;  4BVY A;  2DJJ A;  2DJ1 A;  3G9B A;  4JU5 A;  1FVK A;  4D73 A;  1GSQ A;  4BVX A;  4KAE A;  1ZYP A;  2C0G A;  3GN3 A;  4I5Q A;  4MJE A;  2A2S A;  4V1A g;  5FT3 A;  5IMC A;  1U3I A;  2CX3 A;  3GX8 A;  2VLT A;  4PUF C;  4MAB A;  2GZZ A;  2JAD A;  4F9Z A;  3IA1 A;  1BQ7 A;  1LJR A;  3US3 A;  1AQV A;  1SJ6 A;  3TKP A;  1A2J A;  1MD3 A;  3EC3 A;  3IC4 A;  1ML6 A;  4K6X A;  1Z6M A;  2JU5 A;  3SBC A;  4KF9 A;  1GLP A;  4HOJ A;  2K18 A;  4DEJ A;  2GQL A;  4Q5N A;  3RHB A;  3P90 A;  2L6D A;  1A8Y A;  4X43 A;  3O6T A;  2YOI A;  3ZMK A;  1M99 A;  1AQW A;  5D9W A;  1M3I A;  1WE0 A;  1UN2 A;  4QL9 A;  3FY7 A;  3P2A A;  3S9F A;  2VCT A;  2LRC A;  3KJY A;  2PPT A;  1GUK A;  3GKM A;  5HR1 A;  3HJO A;  2H30 A;  2DMM A;  2VL2 C;  2AAW A;  3GTU A;  3LWA A;  14GS A;  1ZMA A;  1JFU A;  4N30 A;  1GNW A;  3FZ9 A;  2VL2 A;  2YN1 A;  3ZIT A;  2MMO A;  5IIZ A;  3FEU A;  1GTI A;  3FKF A;  1Z3E A;  16GS A;  2FHE A;  4NHZ A;  18GS A;  3ERG A;  3Q19 A;  4I2U A;  1KEB A;  1XFL A;  2A4V A;  3LQ7 A;  2GSS A;  4NPB A;  4GCI A;  2IMI A;  5JCG A;  3CSI A;  4BVY B;  12GS A;  1ZOF A;  2HSY A;  7GSS A;  1UA5 A;  3U6V A;  1T7P B;  4WXT A;  5HR0 A;  2FWE A;  2WCI A;  3UIW A;  2YV9 A;  3TRQ A;  4D73 B;  1M2D A;  3R3E A;  4TR4 A;  4BVX B;  3A2X A;  1X5D A;  3FRC A;  4K2D A;  4KDY A;  5ECI B;  1F3A A;  1Z7R A;  1ERV A;  3C73 A;  3G7I A;  5CNW A;  2P0G A;  5A4W A;  5BRT A;  2OE3 A;  3MWH A;  2B3S A;  4EO3 A;  3KH9 A;  1OC9 A;  2LNT A;  1X0R A;  3OR5 A;  5HR3 A;  1K0M A;  2H6X A;  1GWC A;  5ECL B;  2G2Q A;  4J2F A;  4LMW A;  3LJR A;  1JZW A;  1T8E B;  3A2V A;  3QD9 A;  4HDE A;  4Q5R A;  1M9A A;  3H93 A;  1Q4J A;  3DKS A;  2VL3 A;  1GL8 A;  2QKE A;  3F3R A;  4X0X A;  2F9S A;  5IMD A;  2VIM A;  1ACV A;  2VO4 A;  2H76 A;  1GTA A;  5G5F A;  1XW9 A;  13GS A;  1U88 A;  1TOF A;  5H5S A;  3WGD A;  3H1N A;  2GDR A;  4E8E A;  4PQ1 A;  1TTZ A;  3DVX A;  2XHF A;  4IS0 A;  3TJG A;  4KCA A;  4LA1 A;  4TRX A;  3H4K A;  3W8J A;  4BWQ A;  4MJA A;  1VF1 A;  1B9Y C;  3M1G A;  1HNA A;  3EE2 A;  1I5G A;  1LU4 A;  5HR2 A;  5G5E A;  3GTU B;  3MNG A;  5D8I A;  4YQM A;  1GLQ A;  4GTU A;  4GST A;  5CRH A;  2FNO A;  3JCM L;  3QAW A;  2A4H A;  2MBT A;  3GRX A;  4XS6 A;  3F8U A;  1SK1 A;  2L57 A;  1S3D A;  2M46 A;  4GQC A;  4K7N A;  1PMT A;  4YAV A;  1F37 A;  1PA3 A;  2WUL A;  1T1V A;  2AJQ B;  1JLW A;  1K3O A;  4TW5 A;  4I6X A;  1G7E A;  1B8X A;  1E2Y A;  5DAK A;  3DML A;  1GNE A;  1VF4 A;  3HKR A;  3DVW A;  1CQG A;  2DKH A;  4OO4 A;  4WBJ A;  4O92 A;  3WGE A;  1C72 A;  1G0T A;  3KP8 A;  2MZC A;  4ID0 A;  2UZ8 A;  5JWR B;  2DML A;  1XW5 A;  4MK3 A;  2DJ0 A;  4QL7 A;  5D73 A;  3DYR A;  3GMF A;  3HZ8 A;  1GH2 A;  1YZX A;  4L0U A;  5ECQ B;  1XWK A;  2L5O A;  1OKT A;  4ECI A;  4TR3 A;  1X5C A;  3LSZ A;  4QQ7 A;  1U6T A;  1GSD A;  1PN0 A;  2F51 A;  1KNG A;  1SKW B;  2PU9 C;  4IHU A;  3F4T A;  1FAA A;  4TXV A;  2HRA A;  2C3T A;  4K2X A;  4NXI A;  2N5A A;  4IP6 A;  1ZL9 A;  4USS A;  2YWI A;  5D9X A;  1YY7 A;  2IME A;  3CXG A;  3HY2 A;  1SL1 B;  5J3R A;  3IR4 A;  2R2J A;  5ECP B;  4K0G A;  3ED3 A;  3GIX A;  1ZCP A;  2FCH A;  3CTF A;  3KXO A;  4DSR A;  2KUC A;  1TP9 A;  5JCU A;  1PQN A;  2MMN A;  1G7D A;  3J7Y b;  3GFK A;  4DSS A;  3GYK A;  5F06 A;  1THX A;  1JZD A;  5CP1 A;  1XWC A;  2H1D A;  3MSZ A;  1ILO A;  1NHY A;  2AHE A;  2MMA A;  4N11 A;  1PD2 1;  2NBS A;  1R5A A;  1F2E A;  5A5K A;  2LKU A;  4JZQ A;  2YNX A;  5KEJ A;  5LNK e;  2DSA A;  1V98 A;  2H01 A;  1XXU A;  2X8G A;  5IMZ A;  4EL1 A;  5G1K A;  2WDU A;  4ZB6 A;  5GAN D;  2X8C A;  2YWM A;  2LQO A;  4F82 A;  2HRK A;  4KX4 A;  1K0O A;  1XW6 A;  5DAK B;  3UBK A;  4GF0 A;  2VUP A;  2GS3 A;  4PNF A;  1QXH A;  4JR6 A;  2CA8 A;  1K0C A;  1V9W A;  1WRY A;  2GGT A;  4X1U A;  4ZXG A;  3FZA A;  3NOF A;  1NSW A;  4POM A;  5CO3 A;  4KW6 A;  2VL9 A;  5JWQ B;  3RHC A;  1O7U A;  3N5O A;  3TKR A;  2N5F A;  1TJD A;  4MZB A;  4IN0 A;  3BD2 A;  1QQ2 A;  1TDI A;  3KTL A;  3VFI A;  1SYR A;  2WFC A;  4JE1 A;  2VOC A;  1KTE A;  2R37 A;  4ACS A;  2HXK A;  1EGR A;  2DIZ A;  4XIH A;  2HT9 A;  5DVB A;  1BJX A;  4HSC X;  2O8V B;  4NV2 A;  3QR6 A;  1DE2 A;  4O5Q A;  2GQM A;  2E0Q A;  2X49 A;  3BBY A;  1Y6E A;  3L9S A;  4IW9 A;  3PIN A;  3UAP A;  2LJR A;  1JZO A;  2L4Q A;  2L4C A;  1WJK A;  4IVF A;  1YKC A;  2JL4 A;  3TDG A;  2QSI A;  4AJ6 A;  1FO5 A;  1U3A A;  4WR5 A;  4EIQ A;  2VLU A;  2B6M A;  3EU4 A;  4K5S A;  1TKD B;  2I3Y A;  3LXT A;  3A2W A;  3L4N A;  2IIY A;  4TR1 A;  2F8F A;  3A5W A;  2HE3 A;  2REM A;  3BOA A;  1RW1 A;  2CV4 A;  2KLX A;  3PR8 A;  2JZS A;  3A3T A;  4KCE A;  5ELA A;  2H6Z A;  1YQ1 A;  3FK8 A;  3VI7 A;  3TJB A;  4CW9 A;  1AUC A;  2LST A;  3VUR A;  1XZO A;  1PGT A;  2F8A A;  1CQH A;  2GVP A;  2OE0 A;  2V6K A;  1NHO A;  1XOB A;  1ON4 A;  1THO A;  2GSQ A;  4PNG A;  4ULX A;  3DGQ A;  2CT6 A;  5DQS A;  1RQM A;  1VRS D;  1TK8 B;  3QMX A;  4MPF A;  2X99 A;  3IK9 A;  2XC2 A;  3TRX A;  2O87 A;  2VD1 A;  3GHA A;  2KHP A;  3E3E A;  4MF6 A;  1A2M A;  1F6M C;  5J9B A;  3UMA A;  3ZIV A;  1YF0 A;  2BTO T;  3C1S A;  2FD3 A;  6GST A;  2GQK A;  2HLS A;  3ZTL A;  1R26 A;  2O85 A;  5DAL A;  1B48 A;  3GSS A;  2X4A A;  3TRP A;  3DIE A;  1XWG A;  1X9S B;  4YH2 A; 
#chains in the Genus database with same CATH homology
 1N8J A;  1WWJ A;  3VWX A;  4V1A p;  3I6A A;  4J57 E;  4FYB A;  5IM9 A;  1X5E A;  1TRV A;  2HZE A;  1XWB A;  2XPE A;  2IFQ B;  3O76 A;  4N0V A;  1SEN A;  2X64 A;  20GS A;  2WGR A;  2CVK A;  3LYP A;  4HUA A;  2K8V A;  3BJ5 A;  3ZVJ D;  4CDO A;  3EYT A;  3WYW A;  1TXX A;  3TOU A;  4E8H A;  2PN8 A;  1FOV A;  1B4P A;  2WZ9 A;  4OCE A;  1FG4 A;  2P5Q A;  4ZBB A;  2JSZ A;  5LCZ A;  5B6N A;  4TR1 B;  2XBI A;  2OA7 A;  2VCX A;  1K0N A;  3IOS A;  5C04 A;  5H5Q A;  2M72 A;  3ZIJ A;  4KSO A;  3FW2 A;  3HA9 A;  5ID2 B;  3F9U A;  1K0B A;  4IKH A;  5IMF A;  3APO A;  1NW2 A;  1LBK A;  3HHV A;  5EL8 A;  5FHI A;  1ZZY A;  1O73 A;  3KP9 A;  2B7J A;  3PH9 A;  3APS A;  3C8E A;  4K8M A;  4P3Y B;  2DBC A;  2LEG A;  3W8S A;  5IPG A;  2WB9 A;  3LOR A;  2R3X A;  3C71 A;  4LL1 B;  4F2I A;  3IHG A;  3HXS A;  3HD5 A;  5DCG A;  5B8B A;  2VCV A;  3LW9 A;  1H75 A;  1R7H A;  2H0G A;  4OWY A;  1MDI A;  5IO2 A;  1O81 A;  6GSV A;  1Z6N A;  5ECM B;  4I2T A;  4KDX A;  4ZIL A;  1GSF A;  2RUE A;  4XRA A;  5AN1 A;  5DAL B;  5J9C A;  3UEM A;  2H6Y A;  5DCH A;  3D5J A;  3FR3 A;  4MPG A;  5G1L A;  2F3M A;  6GSW A;  3GST A;  2QA2 A;  2GST A;  3GKN A;  1YDK A;  4ZB8 A;  3QAV A;  1SK2 A;  3DD3 A;  4FH8 A;  6GSX A;  1EZK A;  1GUM A;  1A23 A;  2R0G A;  1R4W A;  4IGJ A;  4V2N A;  4ZBD A;  2K9F A;  1JLV A;  2VCZ A;  4HJM A;  4MZC A;  2HZE B;  4L8E A;  1MDK A;  4ML1 A;  3UL3 A;  1JHB A;  2DJK A;  2WRT A;  3EMX A;  1T00 A;  5ECR B;  1M2B A;  2B5X A;  5A4V A;  2VD0 A;  4POL A;  3L78 A;  4Z2T A;  2R0C A;  2XBQ A;  5DJL A;  5GAP D;  4G10 A;  2AUV A;  8GSS A;  5LD0 A;  4EIP A;  4TOP A;  2HYX A;  2HSM A;  3GH9 A;  2GLR A;  4MNN A;  1PN9 A;  2HFD A;  4MH3 A;  1GTB A;  2VM2 A;  3LGC A;  1G6Y A;  3UOM A;  3KH7 A;  4OMV A;  5ECN B;  2IL3 A;  3CTG A;  1WOU A;  4RQX A;  5CRW A;  3HVX A;  4GXZ A;  3VWV A;  2D2Z A;  4YQU A;  2PUK C;  1FB0 A;  2H74 A;  2FWH A;  2N5B A;  2DC5 A;  17GS A;  1XWA A;  3HJP A;  2IMD A;  4OCF A;  4I8B A;  3GKK A;  5GSS A;  4FYC A;  2FLS A;  4EE0 A;  4XS4 A;  4KGI A;  1A0R P;  3KMN A;  1EV4 A;  3RPP A;  2EIR A;  2OKA A;  1S3C A;  1V40 A;  2V41 A;  4J56 E;  4JRR A;  5E4W A;  3LG6 A;  3TUE A;  2I1U A;  2J9H A;  1SKR B;  3IV4 A;  2IPA A;  1H4O A;  2I4A A;  3FHK A;  2C1Y A;  4K0N A;  2H0H A;  2VM1 A;  1IYH A;  1VF3 A;  4ZB9 A;  4O5R A;  3GUS A;  1K0D A;  2DKI A;  3QAG A;  2HRF A;  4XCS A;  5CRD A;  2GTU A;  2A2R A;  1TK5 B;  5EPF A;  2H70 A;  5J5N A;  3NZN A;  1EP8 A;  4AF2 A;  5CYY A;  2XPD A;  4KA0 A;  3H8Q A;  4F0B A;  2L6C A;  4OO5 A;  3QOU A;  3FMW A;  1V57 A;  1QGV A;  3D4M A;  3WGX A;  1T4Z A;  4MZW A;  3GH6 A;  4OD7 A;  5KOW A;  5AIX A;  3FYG A;  2L5L A;  3HCZ A;  1TRW A;  1AIU A;  2FA4 A;  5GST A;  5AIS A;  3L9V A;  2I9H A;  5CAX A;  2R6K A;  19GS A;  3CRU A;  3IAS 2;  4F0C A;  5ECK B;  3F4R A;  4WBR D;  3DXB A;  4O5U A;  1SYX A;  4MF5 A;  5BMU A;  4V2M A;  1PRX A;  2YJH A;  1T3B A;  4NWY A;  1XCC A;  2M66 A;  2M80 A;  4NMU A;  4F03 A;  2E2M A;  5AGY A;  4ECJ A;  4AJ7 A;  4IQA A;  3CSJ A;  1BED A;  5IOW A;  1DE1 A;  3M8N A;  4GQF A;  5J4U A;  1URM A;  4ML6 A;  2C3N A;  4K7O A;  2RII A;  1QUW A;  1IYI A;  1SU9 A;  3VPQ A;  2G0F A;  3MDK A;  1M7T A;  2LS5 A;  2H0I A;  3PPU A;  2VAF A;  2LQQ A;  4RI7 A;  5F05 A;  1PX6 A;  4ICY A;  5IMV A;  2QA1 A;  1W89 A;  2VLV A;  4ZL8 A;  1NM3 A;  4KSM A;  4MH2 A;  2H73 A;  4X4J A;  3QFB C;  2DIY A;  4XS4 B;  2FA8 A;  2R0P A;  1HYU A;  2RUF A;  2LV3 A;  4CY8 A;  1FVJ A;  2FWG A;  3ME8 A;  3VK9 A;  2ES7 A;  4YAP A;  2K6V A;  1MD4 A;  3D21 A;  4YQV A;  4G0L A;  1N2A A;  5DQY A;  3KTB A;  2EC4 A;  5L71 A;  1M0U A;  3D4T A;  4GSS A;  4KH7 A;  4OFM A;  3TGZ A;  3BCI A;  4TR0 A;  2H71 A;  3L9U A;  4CHS A;  2BJX A;  2V32 A;  4G2E A;  3QFA C;  1EGO A;  3TKS C;  1SJZ A;  3GL5 A;  5COH A;  1EOG A;  2CQ9 A;  2LJA A;  4EDY A;  3J7Y k;  2IFQ A;  3L0H A;  3M9K A;  2LUS A;  3WT2 A;  5INY A;  1O85 A;  3TKS A;  1T4Y A;  1G6W A;  2K8S A;  4HEA 2;  4EF0 A;  1HNC A;  2LNS A;  1MEK A;  5FWG A;  5DJM A;  3C1R A;  2YJ7 A;  4A5P A;  2J23 A;  4EDZ A;  4EKZ A;  3ISO A;  2NTO A;  5AIV A;  1GSS A;  3LFL A;  3I9V 2;  1AAZ A;  4EVM A;  4L0W A;  2LJK A;  3GL3 A;  3MYD A;  2GT6 A;  1TW9 A;  3APQ A;  2PBJ A;  4GRF A;  4EUY A;  3K8N A;  3IRA A;  1PKZ A;  2C0E A;  4AGS A;  2PVO C;  3RDW A;  5ECH B;  1VF2 A;  3TJJ A;  2GZP A;  4HU7 A;  1UVZ A;  1YEX A;  5ID2 A;  3EMP A;  2L59 A;  1QMV A;  2DJ2 A;  3M0F A;  5KN1 A;  4JED A;  1X9M B;  1XVQ A;  4MA9 A;  4NV5 A;  4BWS A;  2MYG A;  5KN0 A;  3VLN A;  4WF5 A;  1TRS A;  1ZYE A;  4JR4 A;  5EVO A;  3IAM 2;  4GWR A;  3CSH A;  2HRN A;  3DRN A;  1YEP A;  1OAZ A;  3HDC A;  3VPT A;  2KP1 A;  2H19 A;  5D93 A;  1DUG A;  2DLX A;  1TK0 B;  4I97 A;  5F07 A;  2GZY A;  1VGL A;  3IPZ A;  2TIR A;  3RPN A;  4MP4 A;  3UAR A;  1EP7 A;  1XBS A;  3TB2 A;  4ZBA A;  3IHQ A;  4PGT A;  4XRD A;  3FR6 A;  1BAY A;  4WF4 A;  3IK7 A;  5ECO B;  2QC7 A;  2QGV A;  2JAC A;  2KP2 A;  4MJC A;  5F0G A;  3WT1 A;  3IBH A;  1K0A A;  3ME7 A;  4H86 A;  1FHE A;  2C80 A;  4TN8 A;  2CX4 A;  3EPT A;  1ERT A;  5ENU A;  1M2A A;  2EIQ A;  1KBN A;  1GRX A;  1PKW A;  5IMA A;  4G0I A;  4G19 A;  5B8A A;  1SD9 A;  4POK A;  1ERW A;  2FY6 A;  6GSY A;  1BX9 A;  3EIN A;  1XPV A;  5ABR A;  4HZ4 A;  4PQI A;  4TVE A;  1M9B A;  3VWU A;  1J08 A;  1ZGN A;  4WKW A;  9GSS A;  4NHW A;  1TU8 A;  1Q98 A;  4Z7X A;  4TKY A;  2V2G A;  3KEB A;  4BA7 A;  3LEF A;  2ZUP A;  4XS1 A;  2CAQ A;  1QK8 A;  4K1F A;  3GNJ A;  3LXZ A;  4WET A;  4OFT A;  3M9J A;  2YAN A;  2C0F A;  3ZML A;  3CMI A;  3GA4 A;  2C0D A;  5HFI A;  5ECS A;  4YKF A;  3RBT A;  1WIK A;  4K5R A;  3N9J A;  4FIW A;  3TKS E;  2V6O A;  3BCK A;  3ERW A;  4O32 A;  2HZF A;  4IBP A;  2FUG 2;  2YZH A;  4Z2U A;  22GS A;  1BG5 A;  5C00 A;  3UBL A;  4FQU A;  1PL1 A;  2CZ2 A;  1YF1 A;  3D0Z A;  2C3Q A;  2ON5 A;  2JZT A;  4TXO A;  2ALB A;  3KCM A;  2BMX A;  2DJ3 A;  4FO5 A;  2PER A;  1OYJ A;  4MLY A;  1EWX A;  1SL2 B;  1TRU A;  1DSB A;  2YV7 A;  3E9J B;  5F8B A;  1HNB A;  1EEM A;  1SKS B;  4IQ1 A;  4ZIJ A;  1EOH A;  1FW1 A;  3KGK A;  1GSU A;  2OAD A;  3D22 A;  3Q18 A;  1OE8 A;  3ZRE A;  5DBQ A;  3EVI A;  5DDL A;  3ZLP A;  4ECC A;  4HZ2 A;  2HSH A;  4XTS A;  4L5O A;  1HD2 A;  1RK4 A;  3ZL5 A;  2E2G A;  2GSR A;  4K7I A;  2P5R A;  1PL2 A;  2PWJ A;  3HJM A;  3DEX A;  4BL7 A;  2MMZ A;  2H8L A;  2RM6 A;  1MDJ A;  4O7H A;  2CAI A;  4GLT A;  4K9Z A;  4N10 A;  3W6G A;  2H72 A;  1GSE A;  4WEY A;  1EV9 A;  3NIV A;  4PXO A;  1YJ6 A;  5EY6 A;  3FR9 A;  3GKX A;  4RUV A;  5CRE A;  1QFN A;  4HQZ A;  1Z5Y E;  5G2Z A;  3A5I A;  1U87 A;  3V1W A;  3HZ4 A;  4MMM A;  1JZR A;  2WS2 A;  3EWL A;  4PTS A;  1J0F A;  4IJI A;  5E59 A;  3UJ1 A;  1FB6 A;  2RLI A;  3DWV A;  5KN2 A;  3O3T A;  1TU7 A;  11GS A;  2KOK A;  3R2Q A;  2H66 A;  2YZU A;  4POB A;  2C4J A;  2IJY A;  4KB3 A;  1ST9 A;  3TJF A;  4MCU A;  4EC0 A;  1ERU A;  2VCW A;  4LLR A;  2CZ3 A;  4MF7 A;  4AJ8 A;  4MJB A;  2O7K A;  2O89 A;  1F3B A;  4V2L A;  2X8H A;  5JCW A;  1ABA A;  3ZZX A;  1OC3 A;  3UVH A;  1K3Y A;  3I69 A;  2RM5 A;  1OE7 A;  4ECB A;  3WD6 A;  3PGT A;  3MIX A;  3U5R E;  2ON7 A;  1GP1 A;  2IMF A;  1AXD A;  1B4Q A;  3F6D A;  3Q74 A;  2TRX A;  1PSQ A;  4L5L A;  4TXO B;  3HVS A;  2YWO A;  3MAK A;  3F4S A;  3FZ4 A;  3ZYW A;  2A2P A;  3EU3 A;  1Z9H A;  4JBB A;  1A24 A;  1R5P A;  1O8W A;  3P7X A;  1Z7P A;  2P31 A;  1WP0 A;  1SD8 A;  4KUN A;  3GV1 A;  4PQH A;  2YP6 A;  2E7P A;  1OC9 B;  5IO0 A;  2PVQ A;  3M3M A;  4GSN A;  6GSU A;  3EUR A;  4WR4 A;  1USB A;  5HFG A;  1K3L A;  10GS A;  2Z9S A;  1I9D A;  3C7M A;  1E6B A;  4BL7 B;  6GSS A;  4YKG A;  2B5Y A;  4HS1 A;  1V58 A;  3ZFL A;  5G30 A;  3TKQ A;  1TI1 A;  1G7O A;  2H1B A;  1GTU A;  4RI6 A;  4HU9 A;  3HYP A;  2PGT A;  4ILF A;  2YPM A;  5D9V A;  3AY8 A;  3ZRD A;  1GUH A;  1S3A A;  3G7J A;  1XIY A;  2OJL A;  2NDO A;  5KN3 A;  3CRT A;  1YKA A;  4LMV A;  5HQP A;  2JZR A;  2JSY A;  5ELG A;  2H1A A;  2ZNM A;  3I43 A;  3HVV A;  2HI7 A;  1ZYN A;  1EEJ A;  4PUA A;  2CVD A;  2H1G A;  1DBY A;  2VCQ A;  2LRN A;  1XOA A;  3IC8 A;  3TJK A;  3SWL A;  3LYK A;  4FYU A;  4Q5F A;  2YWN A;  1SJI A;  2CVB A;  1A2L A;  1BYE A;  4XHM A;  2LRT A;  3KD0 A;  1UC7 A;  3D6I A;  5CRG A;  3VI5 A;  1TI3 A;  5G31 A;  1WPI A;  2R5G A;  2V1M A;  5IQY A;  1MTC A;  4N0Z A;  5B7C A;  3TOT A;  4ISD A;  3GUR A;  2AV4 A;  2AB6 A;  4PUR A;  2B5E A;  2NPB A;  3Q6O A;  2B1L A;  2IN3 A;  4IP1 A;  5B6M A;  3TCO A;  2I81 A;  3QPM A;  5HFK A;  1WMJ A;  3RAZ A;  1HQO A;  4MDC A;  3IXR A;  3KZQ A;  4IJ3 A;  4EXJ A;  2PMT A;  1GSY A;  1X9W B;  1OVN A;  4KE3 A;  5H5R A;  5A4U A;  4HQS A;  3QCP A;  3GX0 A;  2TRC P;  1J9B A;  4LL4 B;  4IEL A;  3VWW A;  3ZFB A;  2ZCT A;  3ZVJ A;  1SK0 A;  2IWT A;  2FWF A;  1XVW A;  3KM6 A;  1A8L A;  2AYT A;  3H79 A;  1A0F A;  3UVT A;  1OKD A;  4HJ2 A;  4DVC A;  5IPH A;  2B1K A;  4DSQ A;  3F0I A;  2OAC A;  4G0K A;  4ZL9 A;  2NVL A;  3E0U A;  1F9M A;  4G9H A;  2OE1 A;  2WJU A;  3CYN A;  1AC1 A;  4Q5Q A;  3KIJ A;  3F63 A;  3ERF A;  3F3Q A;  4ZL7 A;  2OBK A;  4KND A;  1W4V A;  2IMK A;  1PX7 A;  5D9T A;  4BPY A;  4KDU A;  5D96 A;  1Y25 A;  5IOX A;  1GUL A;  2YCD A;  3F6F A;  4NAX A;  2H75 A;  2OBI A;  1V2A A;  2GT5 A;  2EIO A;  5JWO B;  2HNL A;  5GZZ B;  2B7K A;  1SL0 B;  3CBU A;  4RQR A;  3IDV A;  2C8U A;  3P8W A;  1AW9 A;  1AQX A;  2FGX A;  3KMO A;  4DSS B;  3QDN A;  4PX1 A;  1B9X C;  4CY6 A;  4Z2R A;  1OC8 A;  3G7Y A;  1ZYQ B;  2LTK A;  2R4V A;  4HI7 A;  5J41 A;  1FOH A;  1O8X A;  3IE3 A;  3FZ5 A;  4OFN A;  5KOX A;  1O6J A;  2MBS A;  4BVY A;  2DJJ A;  2DJ1 A;  3G9B A;  4JU5 A;  1FVK A;  4D73 A;  1GSQ A;  4BVX A;  4KAE A;  1ZYP A;  2C0G A;  3GN3 A;  4I5Q A;  4MJE A;  2A2S A;  4V1A g;  5FT3 A;  5IMC A;  1U3I A;  2CX3 A;  3GX8 A;  2VLT A;  4PUF C;  4MAB A;  2GZZ A;  2JAD A;  4F9Z A;  3IA1 A;  1BQ7 A;  1LJR A;  3US3 A;  1AQV A;  1SJ6 A;  3TKP A;  1A2J A;  1MD3 A;  3EC3 A;  3IC4 A;  1ML6 A;  4K6X A;  1Z6M A;  2JU5 A;  3SBC A;  4KF9 A;  1GLP A;  4HOJ A;  2K18 A;  4DEJ A;  2GQL A;  4Q5N A;  3RHB A;  3P90 A;  2L6D A;  1A8Y A;  4X43 A;  3O6T A;  2YOI A;  3ZMK A;  1M99 A;  1AQW A;  5D9W A;  1WE0 A;  1UN2 A;  4QL9 A;  3FY7 A;  3P2A A;  3S9F A;  2VCT A;  2LRC A;  3KJY A;  2PPT A;  1GUK A;  3GKM A;  5HR1 A;  3HJO A;  2H30 A;  2DMM A;  2VL2 C;  2AAW A;  3GTU A;  3LWA A;  14GS A;  1ZMA A;  1JFU A;  4N30 A;  1GNW A;  3FZ9 A;  2VL2 A;  2YN1 A;  3ZIT A;  2MMO A;  5IIZ A;  3FEU A;  1GTI A;  3FKF A;  1Z3E A;  16GS A;  2FHE A;  4NHZ A;  18GS A;  3ERG A;  3Q19 A;  4I2U A;  1KEB A;  1XFL A;  2A4V A;  3LQ7 A;  2GSS A;  4NPB A;  4GCI A;  2IMI A;  5JCG A;  3CSI A;  4BVY B;  12GS A;  1ZOF A;  2HSY A;  7GSS A;  1UA5 A;  3U6V A;  1T7P B;  4WXT A;  5HR0 A;  2FWE A;  2WCI A;  3UIW A;  2YV9 A;  3TRQ A;  4D73 B;  1M2D A;  3R3E A;  4TR4 A;  4BVX B;  3A2X A;  1X5D A;  3FRC A;  4K2D A;  4KDY A;  5ECI B;  1F3A A;  1Z7R A;  1ERV A;  3C73 A;  3G7I A;  5CNW A;  2P0G A;  5A4W A;  5BRT A;  2OE3 A;  3MWH A;  2B3S A;  4EO3 A;  3KH9 A;  1OC9 A;  2LNT A;  1X0R A;  3OR5 A;  5HR3 A;  1K0M A;  2H6X A;  1GWC A;  5ECL B;  2G2Q A;  4J2F A;  4LMW A;  3LJR A;  1JZW A;  1T8E B;  3A2V A;  3QD9 A;  4HDE A;  4Q5R A;  1M9A A;  3H93 A;  1Q4J A;  3DKS A;  2VL3 A;  1GL8 A;  2QKE A;  3F3R A;  4X0X A;  2F9S A;  5IMD A;  2VIM A;  1ACV A;  2VO4 A;  2H76 A;  1GTA A;  5G5F A;  1XW9 A;  13GS A;  1U88 A;  1TOF A;  5H5S A;  3WGD A;  3H1N A;  2GDR A;  4E8E A;  4PQ1 A;  1TTZ A;  3DVX A;  2XHF A;  4IS0 A;  3TJG A;  4KCA A;  4LA1 A;  4TRX A;  3H4K A;  3W8J A;  4BWQ A;  4MJA A;  1VF1 A;  1B9Y C;  3M1G A;  1HNA A;  3EE2 A;  1I5G A;  1LU4 A;  5HR2 A;  5G5E A;  3GTU B;  3MNG A;  5D8I A;  4YQM A;  1GLQ A;  4GTU A;  4GST A;  5CRH A;  2FNO A;  3JCM L;  3QAW A;  2A4H A;  2MBT A;  3GRX A;  4XS6 A;  3F8U A;  1SK1 A;  2L57 A;  1S3D A;  2M46 A;  4GQC A;  4K7N A;  1PMT A;  4YAV A;  1F37 A;  1PA3 A;  2WUL A;  1T1V A;  2AJQ B;  1JLW A;  1K3O A;  4TW5 A;  4I6X A;  1G7E A;  1B8X A;  1E2Y A;  5DAK A;  3DML A;  1GNE A;  1VF4 A;  3HKR A;  3DVW A;  1CQG A;  2DKH A;  4OO4 A;  4WBJ A;  4O92 A;  3WGE A;  1C72 A;  1G0T A;  3KP8 A;  2MZC A;  4ID0 A;  2UZ8 A;  5JWR B;  2DML A;  1XW5 A;  4MK3 A;  2DJ0 A;  4QL7 A;  5D73 A;  3DYR A;  3GMF A;  3HZ8 A;  1GH2 A;  1YZX A;  4L0U A;  5ECQ B;  1XWK A;  2L5O A;  1OKT A;  4ECI A;  4TR3 A;  1X5C A;  3LSZ A;  4QQ7 A;  1U6T A;  1GSD A;  1PN0 A;  2F51 A;  1KNG A;  1SKW B;  2PU9 C;  4IHU A;  3F4T A;  1FAA A;  4TXV A;  2HRA A;  2C3T A;  4K2X A;  4NXI A;  2N5A A;  4IP6 A;  1ZL9 A;  4USS A;  2YWI A;  5D9X A;  1YY7 A;  2IME A;  3CXG A;  3HY2 A;  1SL1 B;  5J3R A;  3IR4 A;  2R2J A;  5ECP B;  4K0G A;  3ED3 A;  3GIX A;  1ZCP A;  2FCH A;  3CTF A;  3KXO A;  4DSR A;  2KUC A;  1TP9 A;  5JCU A;  1PQN A;  2MMN A;  1G7D A;  3J7Y b;  3GFK A;  4DSS A;  3GYK A;  5F06 A;  1THX A;  1JZD A;  5CP1 A;  1XWC A;  2H1D A;  3MSZ A;  1ILO A;  1NHY A;  2AHE A;  2MMA A;  4N11 A;  1PD2 1;  2NBS A;  1R5A A;  1F2E A;  5A5K A;  2LKU A;  4JZQ A;  2YNX A;  5KEJ A;  5LNK e;  2DSA A;  1V98 A;  2H01 A;  1XXU A;  2X8G A;  5IMZ A;  4EL1 A;  5G1K A;  2WDU A;  4ZB6 A;  5GAN D;  2X8C A;  2YWM A;  2LQO A;  4F82 A;  2HRK A;  4KX4 A;  1K0O A;  1XW6 A;  5DAK B;  3UBK A;  4GF0 A;  2VUP A;  2GS3 A;  4PNF A;  1QXH A;  4JR6 A;  2CA8 A;  1K0C A;  1V9W A;  1WRY A;  2GGT A;  4X1U A;  4ZXG A;  3FZA A;  3NOF A;  1NSW A;  4POM A;  5CO3 A;  4KW6 A;  2VL9 A;  5JWQ B;  3RHC A;  1O7U A;  3N5O A;  3TKR A;  2N5F A;  1TJD A;  4MZB A;  4IN0 A;  3BD2 A;  1QQ2 A;  1TDI A;  3KTL A;  3VFI A;  1SYR A;  2WFC A;  4JE1 A;  2VOC A;  1KTE A;  2R37 A;  4ACS A;  2HXK A;  1EGR A;  2DIZ A;  4XIH A;  2HT9 A;  5DVB A;  1BJX A;  2O8V B;  4NV2 A;  3QR6 A;  1DE2 A;  4O5Q A;  2GQM A;  2E0Q A;  2X49 A;  3BBY A;  1Y6E A;  3L9S A;  4IW9 A;  3PIN A;  3UAP A;  2LJR A;  1JZO A;  2L4Q A;  2L4C A;  1WJK A;  4IVF A;  1YKC A;  2JL4 A;  3TDG A;  2QSI A;  4AJ6 A;  1FO5 A;  1U3A A;  4WR5 A;  4EIQ A;  2VLU A;  2B6M A;  3EU4 A;  4K5S A;  1TKD B;  2I3Y A;  3LXT A;  3A2W A;  3L4N A;  2IIY A;  4TR1 A;  2F8F A;  3A5W A;  2HE3 A;  2REM A;  3BOA A;  1RW1 A;  2CV4 A;  2KLX A;  3PR8 A;  2JZS A;  3A3T A;  4KCE A;  5ELA A;  2H6Z A;  1YQ1 A;  3FK8 A;  3VI7 A;  3TJB A;  4CW9 A;  1AUC A;  2LST A;  3VUR A;  1XZO A;  1PGT A;  2F8A A;  1CQH A;  2GVP A;  2OE0 A;  2V6K A;  1NHO A;  1XOB A;  1ON4 A;  1THO A;  2GSQ A;  4PNG A;  4ULX A;  3DGQ A;  2CT6 A;  5DQS A;  1RQM A;  1VRS D;  1TK8 B;  3QMX A;  4MPF A;  2X99 A;  3IK9 A;  2XC2 A;  3TRX A;  2O87 A;  2VD1 A;  3GHA A;  2KHP A;  3E3E A;  4MF6 A;  1A2M A;  1F6M C;  5J9B A;  3UMA A;  3ZIV A;  1YF0 A;  2BTO T;  3C1S A;  2FD3 A;  6GST A;  2GQK A;  2HLS A;  3ZTL A;  1R26 A;  2O85 A;  5DAL A;  1B48 A;  3GSS A;  2X4A A;  3TRP A;  3DIE A;  1XWG A;  1X9S B;  4YH2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...