2C0EA

Structure of pdi-related chaperone, wind with his-tag on c-terminus.
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
228
structure length
228
Chain Sequence
CTGCVDLDELSFEKTVERFPYSVVKFDIAYPYGEKHEAFTAFSKSAHKATKDLLIATVGVKDYGELENKALGDRYKVDDKNFPSIFLFKGNADEYVQLPSHVDVTLDNLKAFVSANTPLYIGRDGCIKEFNEVLKNYANIPDAEQLKLIEKLQAKQEQLTDPEQQQNARAYLIYMRKIHEVGYDFLEEETKRLLRLKAGKVTEAKKEELLRKLNILEVFRVHKVTKTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WINDBEUTEL PROTEIN
publication title Structural Elucidation of the Pdi-Related Chaperone Wind with the Help of Mutants.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Chaperone
total genus 76
structure length 228
sequence length 228
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07749 ERp29 Endoplasmic reticulum protein ERp29, C-terminal domain
A PF07912 ERp29_N ERp29, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1150.12 Mainly Alpha Up-down Bundle Endoplasmic reticulum protein erp29 Endoplasmic reticulum resident protein 29, C-terminal domain 2c0eA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2c0eA01
3K8NA 4KCEA 3HZ8A 3UL3A 1XW6A 4MK3A 4EDYA 1FAAA 1ERWA 4HZ2A 1LBKA 3WYWA 1W4VA 4RI6A 1F2EA 3NIVA 1SK0A 3HCZA 2M66A 3HKRA 3MNGA 1B9YC 3HJMA 3IDVA 2GTUA 3M9JA 2VCWA 3VURA 1PN9A 4IHUA 3WGXA 2H30A 2DIZA 2H70A 3BBYA 3DGQA 1M2BA 1O73A 4NHWA 1YKCA 4RQRA 2PMTA 1ERUA 3KH7A 1M99A 2YZHA 5HR3A 3GRXA 5CAXA 3GV1A 4XS4B 6GSUA 4TW5A 3ZYWA 2O89A 1AW9A 1WWJA 2G2QA 4MLYA 4KE3A 3VI7A 1XXUA 2VL2C 1CQGA 1ILOA 2F8AA 3DWVA 2YV7A 4WR4A 1OE7A 2BJXA 4XS4A 3EYTA 4JZQA 1OC8A 4KDUA 4ZILA 3TKSA 3JCML 1GUHA 3CTFA 2OE1A 4PNFA 4MZCA 4KA0A 2I3YA 2GLRA 3UVTA 2I4AA 3W8JA 1DE1A 5H5QA 19GSA 2HZFA 1SJ6A 1B4QA 2HFDA 1SK2A 1S3CA 3KTLA 1R7HA 1V58A 1BJXA 4KUNA 4TRXA 1R26A 4IQAA 1PQNA 3P2AA 5GAPD 4YQMA 1AC1A 5C00A 4I8BA 4K8MA 1F3AA 5CRHA 1X5DA 3GURA 5HFGA 3O6TA 1EEJA 1K3LA 3L9VA 3MWHA 5ECHB 2B6MA 1GSYA 1PGTA 1SK1A 2HT9A 5CRWA 1GULA 4ECIA 3CSJA 1BX9A 4MJAA 3C8EA 2GSQA 5KN0A 4OO4A 2C4JA 2L5OA 4KAEA 3LQ7A 4L0WA 3WT1A 1JHBA 5HFIA 3EMPA 1EV4A 4PXOA 5DALB 3KP8A 4MH2A 2CAIA 3FW2A 1AQXA 3AY8A 2VCVA 4RQXA 1BAYA 2VL2A 5IO0A 3G9BA 1F6MC 1MD3A 1YY7A 2C3NA 5DALA 3DVWA 1TK5B 4IBPA 1AAZA 2B1LA 2P0GA 1A24A 4I2UA 2HRNA 1ZGNA 4AGSA 1GSDA 5EPFA 2YWMA 1T4ZA 1FOVA 5D9WA 3O3TA 4KGIA 5IM9A 2H1GA 2DMLA 4G19A 5DQSA 5ENUA 2HSYA 4ZB6A 1Z5YE 2AB6A 4XRDA 1V2AA 2P31A 3SWLA 4ZXGA 1XWKA 1G7EA 1AUCA 4N0ZA 4FYUA 2OA7A 1SKWB 16GSA 2CX3A 4MJEA 1XVWA 1YQ1A 4KSOA 1X5EA 2FLSA 1T1VA 1Y6EA 3ED3A 3IK7A 4OCEA 5DVBA 3ZZXA 1GNWA 1RQMA 5HR1A 5CNWA 2F51A 2O87A 3DIEA 1UN2A 1SD9A 5IO2A 1QMVA 1UVZA 3FZ9A 4OMVA 1Z7RA 4HEA2 2H6YA 3QFBC 3EINA 2VCQA 2GSRA 4ZL9A 5IMFA 1Z3EA 3RHCA 4LLRA 2OACA 4WEYA 1YF1A 2AYTA 3F3RA 4WF5A 1SJZA 3PGTA 5A5KA 2VD0A 5IPGA 3ERWA 3OR5A 3C71A 5ID2B 4J57E 1JLVA 2O85A 3IA1A 4PGTA 4XRAA 2OE0A 3KMOA 5IMVA 3F4RA 2QGVA 1NHYA 1E6BA 3GH9A 2K8SA 1USBA 1JZRA 5J41A 3UJ1A 2ALBA 3QDNA 2VD1A 4MJCA 3Q18A 3F9UA 4N11A 2C0EA 3TCOA 2GT5A 3HVSA 2JADA 3G7JA 4FYBA 1F3BA 1TDIA 3HDCA 3GH6A 4NPBA 2LUSA 2XBIA 4GSTA 4TXOA 3RPNA 2K18A 4QL9A 4ML1A 3WGDA 3I43A 3FHKA 5KEJA 2C8UA 1F37A 1SL2B 2LJKA 4GSSA 2EIOA 1S3AA 5HR2A 4K7NA 1UC7A 4K9ZA 1GTAA 2B1KA 3CRUA 2DC5A 1OKDA 2V32A 4JU5A 3GX0A 2E2MA 3IK9A 3IPZA 5B6NA 1FB0A 1U3AA 2EC4A 5CP1A 4V2NA 2N5FA 3M3MA 3Q74A 1Y25A 4BL7A 2YOIA 4TXVA 3A3TA 2YWOA 3HZ4A 2CV4A 1I9DA 3VFIA 3LWAA 4KNDA 4ZIJA 3NOFA 5ECKB 1O8WA 3DVXA 1FG4A 4ZBDA 3HVXA 4TR0A 1VF3A 1HNBA 5L71A 1PMTA 1O81A 3TB2A 1SKRB 4D73A 1T7PB 5ECPB 4EO3A 3TRPA 2H1AA 4I2TA 5B6MA 4QQ7A 1RK4A 2TRCP 3EURA 1HD2A 5LNKe 3VPQA 4F0CA 3DRNA 2NDOA 4IELA 3GX8A 5ECQB 5D9TA 4O32A 3TOTA 4LMWA 3DEXA 1GTIA 4L5OA 4RI7A 3KP9A 4MPFA 1A2JA 3HD5A 5IOXA 5G31A 2HZEA 3QD9A 1QUWA 3UBKA 2GSSA 3ZMKA 1R4WA 4TOPA 4WR5A 4PUFC 2V1MA 4ZB8A 3D4MA 4TKYA 1FB6A 2DLXA 1XOBA 2VO4A 3LORA 2F9SA 5D96A 3ERFA 1J0FA 3UOMA 4LL1B 5ECLB 4XTSA 1HQOA 5DCGA 1XPVA 1AQWA 5GAND 3IAS2 2LKUA 20GSA 4OD7A 2IWTA 1YDKA 4PX1A 5D9XA 3KEBA 2CZ3A 5CREA 2LV3A 3KM6A 5E59A 2DJKA 4OFTA 2H0GA 3GSSA 3KZQA 1EOHA 4Q5QA 1BEDA 3D4TA 4MPGA 3W8SA 3FR9A 2MMZA 1SENA 1QK8A 1K0CA 3IHQA 4KB3A 1GSEA 4HU7A 2CA8A 1U87A 3LXTA 2PUKC 3LFLA 4IVFA 3W6GA 4ACSA 2L59A 2FWFA 3IRAA 2ZNMA 1OE8A 2PGTA 2RUEA 3H79A 3H93A 3L78A 5GSSA 2HNLA 4MA9A 4K2DA 1AXDA 1ACVA 5F07A 3Q6OA 5G30A 4MABA 5DDLA 3EU3A 2YN1A 4TR4A 2WGRA 4ZL8A 2CVDA 1PX7A 2R5GA 4YAPA 2LTKA 3FY7A 1IYIA 3R2QA 1VF1A 3E0UA 1A2LA 2VCXA 5EL8A 3UIWA 1GNEA 1Z6MA 2LNSA 3ZVJD 2CAQA 4GQCA 1ZOFA 4EF0A 3DKSA 1R5AA 2ON7A 1J08A 4BWQA 6GSXA 2WRTA 2H0HA 2WDUA 4AJ8A 3BCIA 3IAM2 3E9JB 3RPPA 2HYXA 1WJKA 2IMEA 2PU9C 2J23A 5B8AA 2QSIA 2CZ2A 3A2VA 4POLA 1R5PA 1XW9A 1T8EB 4JEDA 4V2MA 3LYPA 5ECIB 3APQA 1GSFA 1TJDA 5ECOB 4F82A 3RHBA 2GS3A 3A2WA 3ZIVA 3EMXA 2KUCA 1GSUA 2K8VA 5J9BA 1GSSA 2FWEA 1PA3A 3VWWA 5HR0A 3GTUB 1KEBA 1THOA 4EE0A 3C1RA 4RUVA 3FRCA 1SYRA 5JWQB 2F8FA 1EV9A 1A23A 4MP4A 3HA9A 2B7KA 4IP1A 1O7UA 3GTUA 3TJGA 3IXRA 1WRYA 3FR3A 1TI1A 3ZREA 2GZYA 3IV4A 3V1WA 1FW1A 4GQFA 5CO3A 1ABAA 4K1FA 3Q19A 2R6KA 2C0DA 2EIRA 3TOUA 1TXXA 3J7Yb 3QAVA 3IE3A 2NBSA 2LEGA 4DSQA 1XWAA 1TP9A 2VM2A 3KJYA 1MEKA 3A5WA 1M0UA 1OVNA 4V1Ag 1B48A 4Z7XA 1X9WB 5J4UA 1QQ2A 2YZUA 1ZYQB 3GL3A 3N9JA 3VWUA 4IGJA 4EDZA 4OFNA 5A4VA 4FIWA 1GH2A 5A4WA 5AGYA 3KCMA 1XFLA 2H71A 2V6OA 2JZSA 1TU8A 5IMZA 5IMAA 1A8YA 3F63A 4K6XA 3TDGA 4PNGA 2WS2A 3UEMA 2G0FA 4IP6A 2JZTA 1F9MA 3GYKA 1GTBA 2E2GA 2YV9A 5JCGA 5EY6A 5AN1A 2H72A 4NWYA 3IBHA 3P90A 3VK9A 4DSSB 1NSWA 2X64A 3GNJA 1J9BA 22GSA 2DJJA 2XHFA 4JE1A 2H8LA 2H19A 4X0XA 6GSYA 1MDJA 2FUG2 3CYNA 4V1Ap 2L5LA 1XZOA 5CRGA 1GSQA 2FA4A 4DSSA 3TKQA 1EOGA 5IMCA 4XS6A 1EGOA 2H75A 3EWLA 5IPHA 1A8LA 2CVKA 3F6DA 3C1SA 5IQYA 2K6VA 3APSA 4HUAA 1XWCA 1PKWA 2GZZA 2HXKA 4GCIA 4FO5A 4MDCA 3P7XA 4PQ1A 4IS0A 1PSQA 3BD2A 2I1UA 2HSHA 3GFKA 1TRUA 2C1YA 2C0GA 4EVMA 4NMUA 5KN2A 2V41A 3ISOA 2IMDA 1WOUA 1V9WA 3LXZA 4I97A 1W89A 3C7MA 3QAWA 1B9XC 3D5JA 1EP7A 1OYJA 5G2ZA 4P3YB 3HY2A 2FNOA 3U5RE 2MBSA 5LCZA 4MCUA 3QCPA 5ID2A 3WGEA 4IQ1A 4HQSA 1BYEA 4AJ6A 4J56E 2RM5A 2GT6A 3EC3A 1RW1A 1YZXA 2L57A 2H1DA 3DXBA 2YNXA 4PURA 3GMFA 3FZAA 4IJIA 1T00A 3WT2A 3L4NA 3DYRA 2P5QA 3TJBA 3S9FA 4TR1B 1GUKA 1K0BA 3CSIA 5ECNB 5HFKA 1M9BA 1U6TA 3RDWA 1KBNA 1XOAA 2R2JA 3D6IA 2FGXA 1HYUA 5DJMA 3LG6A 2J9HA 2H0IA 4ZBBA 2F3MA 5DAKB 4JBBA 5FHIA 3TRQA 4TN8A 1GTUA 2LNTA 11GSA 2H1BA 1EGRA 3PH9A 2IIYA 4POKA 4IW9A 3TRXA 17GSA 4X43A 5IIZA 4TVEA 1JZDA 4XS1A 3VPTA 4L0UA 4NAXA 2LJRA 5INYA 1Z7PA 3FZ5A 1MTCA 3IR4A 1HNAA 3CSHA 3MDKA 1JZOA 1XVQA 3QMXA 5D9VA 1DSBA 3VI5A 4ZBAA 3P8WA 1TI3A 2K9FA 2OKAA 3FR6A 2GZPA 3PR8A 1G7DA 12GSA 4G2EA 2FCHA 2LS5A 3GKXA 2ZCTA 3G7IA 3F3QA 1WMJA 2WCIA 2ES7A 3O76A 4KW6A 1THXA 1VF4A 5F8BA 2ZUPA 3ZITA 3UVHA 4BA7A 1O6JA 1FVJA 2OE3A 4EXJA 3BCKA 2YWIA 4GWRA 4MZWA 1S3DA 1K0OA 2HE3A 5H5SA 1URMA 2VUPA 2X8GA 1A0FA 2RM6A 2VCTA 4HJMA 2YJ7A 4X1UA 4WXTA 1EP8A 9GSSA 2N5AA 3L9SA 3ZL5A 4POBA 5F0GA 3NZNA 4MMMA 2A2SA 2L4CA 2C80A 1FO5A 5KN3A 3HXSA 3N5OA 1X9SB 4N10A 5B8BA 2DJ0A 3EE2A 2L4QA 2IJYA 4JR6A 2VL9A 1PL1A 3UMAA 1K0AA 5D93A 1NW2A 1NM3A 2DMMA 4PUAA 3GKKA 2PPTA 2JACA 3CBUA 1TW9A 1WIKA 3LYKA 2LSTA 1TKDB 4GXZA 2GVPA 3UARA 1XWBA 3QAGA 4WETA 1T3BA 3ZFLA 1SJIA 3H4KA 2IMKA 5LD0A 2JSZA 4LL4B 4F2IA 2DIYA 5JCWA 3FZ4A 1K0NA 4G9HA 1U88A 4N30A 1N2AA 3RAZA 5DCHA 2VLTA 1Q98A 1ZCPA 3LJRA 3QFAC 2NVLA 1KTEA 1PX6A 1XW5A 2QKEA 4YQVA 4GRFA 4Q5RA 4V2LA 2FD3A 2IMIA 2MBTA 2R3XA 2IL3A 5JCUA 1XBSA 3LSZA 3FEUA 1O85A 2LQOA 5GZZB 3CMIA 5F05A 1WE0A 2DBCA 5C04A 2X8CA 3GSTA 2OADA 5JWOB 1ERVA 5J5NA 4I5QA 3TUEA 5J3RA 3M1GA 1PL2A 1M2AA 4GTUA 4MJBA 3F6FA 5D8IA 1Z6NA 3WD6A 1ZZYA 3ZRDA 4JR4A 3VWVA 1B4PA 3CTGA 2PN8A 3HJOA 1YF0A 4ECJA 2WB9A 5DBQA 4KCAA 4HJ2A 1WP0A 4O92A 1X5CA 2JSYA 2V2GA 1ZMAA 1HNCA 2NTOA 1SD8A 1KNGA 2H76A 4HZ4A 2XPEA 1SL0B 4LA1A 1XWGA 4POMA 2RIIA 3L9UA 4HDEA 3ERGA 2LRTA 1ERTA 5B7CA 4F9ZA 2PVOC 1WPIA 1Z9HA 1DBYA 2PVQA 2BMXA 2H01A 2YP6A 4KH7A 1PKZA 2WFCA 1FVKA 3MSZA 2V6KA 2D2ZA 5G1LA 1FHEA 2REMA 1A0RP 1GWCA 2WZ9A 1VGLA 3GKMA 2M46A 5FT3A 3H1NA 1TRWA 2L6DA 2IPAA 2P5RA 1VF2A 3RBTA 4I6XA 3A2XA 2LRCA 2VOCA 8GSSA 2YWNA 3L0HA 1C72A 4ULXA 2DJ1A 3HJPA 3QPMA 5G1KA 3TJFA 4KDYA 4MF5A 1K3YA 3M0FA 2X99A 1K0DA 4ISDA 2BTOT 2MYGA 4EUYA 1PD21 4CDOA 1ZL9A 4K0GA 1EEMA 2Z9SA 2KP1A 4WKWA 3PINA 4J2FA 4KX4A 4OWYA 3TJJA 3DD3A 3GKNA 3UAPA 2VAFA 2GQLA 3F4TA 2YPMA 7GSSA 1SYXA 3GUSA 4OCFA 4PQHA 3D22A 5EVOA 2B5XA 2A4VA 5CRDA 2VLUA 4NV5A 4HI7A 2HLSA 2XC2A 4H86A 2KLXA 4CW9A 5ECMB 2DJ3A 1QGVA 5ELGA 4IKHA 1YEPA 2LQQA 3GHAA 4O5RA 3FK8A 1G7OA 3BOAA 2XPDA 1M9AA 5G5FA 2DJ2A 1LJRA 4DEJA 5J9CA 2FWGA 1V40A 2OBKA 3SBCA 5ABRA 1ST9A 2DSAA 2HRFA 1OKTA 4YH2A 3MAKA 3I9V2 2E0QA 4ZL7A 2YCDA 2GSTA 2XBQA 3I69A 3TJKA 4IJ3A 4NV2A 1CQHA 4JRRA 1TK0B 3ME8A 1LU4A 2CX4A 1VRSD 3KH9A 2B3SA 2LJAA 1BQ7A 2JZRA 5JWRB 2AAWA 1GLQA 3TGZA 1G6YA 4IN0A 4O7HA 5KN1A 4BWSA 1JFUA 2R37A 4ECCA 2RLIA 5FWGA 2ON5A 3ZVJA 2OJLA 2C3QA 3E3EA 1OC3A 1JZWA 4ILFA 1YEXA 4WBRD 4FH8A 2JL4A 3GIXA 2B7JA 3LGCA 3TKSE 3TKRA 4WF4A 4MH3A 2MMNA 2FA8A 4HQZA 5COHA 1JLWA 3KTBA 2H6ZA 5H5RA 3KGKA 3CXGA 1XCCA 2O7KA 3U6VA 4ECBA 1GLPA 5AIXA 2LRNA 1OC9B 5G5EA 5DJLA 4L5LA 3VWXA 4L8EA 10GSA 3J7Yk 4AJ7A 1H75A 1SKSB 3F4SA 2B5YA 3DMLA 3EU4A 2CT6A 3KD0A 2KP2A 4Q5NA 1UA5A 4AF2A 1OC9A 3IOSA 2X8HA 2L6CA 2PBJA 4XHMA 2MMAA 2YANA 4MF6A 2VM1A 5IMDA 1GL8A 4TXOB 5AISA 2CVBA 4TR3A 2WULA 3KMNA 3APOA 2RUFA 3LEFA 3ZFBA 2IFQB 1IYHA 2H73A 4OO5A 4TR1A 1YJ6A 6GSTA 4BVYA 2A2RA 18GSA 3US3A 2YJHA 1ML6A 1U3IA 3C73A 2I81A 1G0TA 2VLVA 2TIRA 2N5BA 4KSMA 2M80A 4F03A 2IFQA 2FY6A 5HQPA 13GSA 2O8VB 3ZIJA 5GSTA 1YKAA 2B5EA 3KIJA 1QXHA 5DAKA 3F8UA 1X0RA 3ME7A 5CYYA 2HI7A 5A4UA 4HOJA 4E8EA 2IMFA 5ELAA 2VL3A 4EKZA 2PWJA 2R4VA 2AUVA 3GN3A 2MMOA 1MDIA 1A2MA 1G6WA 2TRXA 4ID0A 1ON4A 3ZTLA 1B8XA 2MZCA 5AIVA 3BJ5A 14GSA 3ZLPA 1OAZA 3D21A 1MD4A 3IC4A 4D73B 3GL5A 1K0MA 1T4YA 2AHEA 4HS1A 1E2YA 2FWHA 2H66A 2GGTA 1XIYA 4MZBA 1TTZA 3QR6A 1N8JA 1EWXA 5DQYA 4GLTA 1ZYEA 2E7PA 6GSVA 3F0IA 1EZKA 4DSRA 3EVIA 4HU9A 1TK8B 4DVCA 2CQ9A 1V98A 2VCZA 1AQVA 2EIQA 1TOFA 3I6AA 2C3TA 2NPBA 3FYGA 2GDRA 2HZEB 4Q5FA 4NXIA 3VLNA 5ECSA 1TRSA 1SU9A 6GSSA 3ZMLA 1GRXA 5IOWA 2PERA 4XIHA 5ECRB 1GP1A 1QFNA 3UBLA 4G10A 1V57A 3HHVA 3KXOA 4K7OA 2KHPA 3CRTA 4E8HA 2OBIA 1I5GA 4KDXA 4ZB9A 1X9MB 4BVXA 3TKPA 3M9KA 3HYPA 4EL1A 4NHZA 2AV4A 1BG5A 4WBJA 1AIUA 4ML6A 3D0ZA 2H74A 4YQUA 1MDKA 4LMVA 1PRXA 3QOUA 4FYCA 4YAVA 4MF7A 4PQIA 2VIMA 2IN3A 5D73A 1TRVA 1O8XA 2FHEA 4EC0A 1DUGA 5E4WA 3G7YA 3GA4A 3M8NA 4GF0A 6GSWA 4K0NA 4F0BA 2M72A 3FKFA 1Q4JA 2H6XA 1TU7A 4XCSA 1DE2A 2QC7A 1K3OA 4N0VA 4CHSA 2JU5A 3TKSC 2AJQB 5F06A 2I9HA 1H4OA 3H8QA 2C0FA 1SL1B 4QL7A 2GQKA 4K7IA 3HVVA 4GSNA 1M2DA 1M7TA 4BPYA 2KOKA 2WJUA 2GQMA 1NHOA 4OFMA 1GUMA
chains in the Genus database with same CATH superfamily
3K8NA 4KCEA 3HZ8A 3UL3A 1XW6A 4MK3A 4EDYA 1FAAA 1ERWA 4HZ2A 1LBKA 3WYWA 1W4VA 4RI6A 1F2EA 3NIVA 1SK0A 3HCZA 2M66A 3HKRA 3MNGA 1B9YC 3HJMA 3IDVA 2GTUA 3M9JA 2VCWA 3VURA 1PN9A 4IHUA 3WGXA 2H30A 2DIZA 2H70A 3BBYA 3DGQA 1M2BA 1O73A 4NHWA 1YKCA 4RQRA 2PMTA 1ERUA 3KH7A 1M99A 2YZHA 5HR3A 3GRXA 5CAXA 3GV1A 4XS4B 6GSUA 4TW5A 3ZYWA 2O89A 1AW9A 1WWJA 2G2QA 4MLYA 4KE3A 3VI7A 1XXUA 2VL2C 1CQGA 1ILOA 2F8AA 3DWVA 2YV7A 4WR4A 1OE7A 2BJXA 4XS4A 4Z2TA 3EYTA 4JZQA 1OC8A 4KDUA 4ZILA 3TKSA 3JCML 1GUHA 3CTFA 2OE1A 4PNFA 4MZCA 1ZYNA 4KA0A 2I3YA 2GLRA 3UVTA 2I4AA 3W8JA 1DE1A 5H5QA 19GSA 2HZFA 1SJ6A 1B4QA 2HFDA 1SK2A 1S3CA 3KTLA 1R7HA 1V58A 1BJXA 4KUNA 4TRXA 1R26A 4IQAA 4EIPA 1PQNA 3P2AA 5GAPD 4YQMA 1AC1A 5C00A 4I8BA 4K8MA 1F3AA 5CRHA 1X5DA 3GURA 5HFGA 3O6TA 1EEJA 1K3LA 3L9VA 3MWHA 5ECHB 2B6MA 1ZYPA 1GSYA 1PGTA 1SK1A 2HT9A 5CRWA 1GULA 4ECIA 3CSJA 5KOXA 1BX9A 4MJAA 3C8EA 2GSQA 5KN0A 4OO4A 2C4JA 2L5OA 4KAEA 3LQ7A 4L0WA 3WT1A 1JHBA 5HFIA 3EMPA 1EV4A 4PXOA 5DALB 3KP8A 4MH2A 2CAIA 3FW2A 1AQXA 3AY8A 2VCVA 4RQXA 1BAYA 2VL2A 5IO0A 3G9BA 1F6MC 1MD3A 1YY7A 2DKHA 2C3NA 5DALA 3DVWA 1TK5B 4IBPA 1AAZA 2B1LA 2P0GA 1A24A 4I2UA 2HRNA 1ZGNA 4AGSA 1GSDA 5EPFA 2YWMA 1T4ZA 1FOVA 5D9WA 3O3TA 4KGIA 5BMUA 5IM9A 2H1GA 2DMLA 3EPTA 2X49A 4G19A 1S3RA 5DQSA 5ENUA 2HSYA 4ZB6A 1Z5YE 2AB6A 4XRDA 1V2AA 2P31A 3SWLA 4ZXGA 1XWKA 1G7EA 1AUCA 4N0ZA 4FYUA 2OA7A 2QA1A 1SKWB 16GSA 2CX3A 4MJEA 1XVWA 1YQ1A 4KSOA 1X5EA 2FLSA 1T1VA 1Y6EA 3ED3A 3IK7A 4OCEA 5DVBA 3ZZXA 1GNWA 1RQMA 5HR1A 5CNWA 2F51A 2O87A 3DIEA 1UN2A 1SD9A 5IO2A 1QMVA 1UVZA 3FZ9A 4OMVA 1Z7RA 4HEA2 2H6YA 3QFBC 3EINA 2VCQA 2GSRA 4ZL9A 5IMFA 1Z3EA 3RHCA 4LLRA 4YKGA 2OACA 4WEYA 1YF1A 2AYTA 3F3RA 4WF5A 1SJZA 3PGTA 5A5KA 2VD0A 5IPGA 3ERWA 3OR5A 3C71A 5ID2B 4J57E 1JLVA 2O85A 3IA1A 4PGTA 4XRAA 2OE0A 3KMOA 5IMVA 3F4RA 2QGVA 1NHYA 1E6BA 3GH9A 2K8SA 1USBA 1JZRA 5J41A 3UJ1A 2ALBA 3QDNA 2VD1A 4MJCA 3Q18A 3F9UA 4N11A 2C0EA 3TCOA 2GT5A 3IHGA 3HVSA 2JADA 3G7JA 4FYBA 1F3BA 1TDIA 3HDCA 3GH6A 4NPBA 2LUSA 2XBIA 4GSTA 4TXOA 3RPNA 2K18A 4QL9A 4ML1A 3WGDA 3I43A 3FHKA 5KEJA 2C8UA 1F37A 1SL2B 2LJKA 4GSSA 2EIOA 1S3AA 5HR2A 4K7NA 1UC7A 4K9ZA 1GTAA 2B1KA 3CRUA 2DC5A 1OKDA 2V32A 4K5RA 4JU5A 3GX0A 2E2MA 3IK9A 3IPZA 5B6NA 1FB0A 1U3AA 2EC4A 5CP1A 4V2NA 2N5FA 3M3MA 3Q74A 1Y25A 4BL7A 2YOIA 4TXVA 3A3TA 2YWOA 3HZ4A 2CV4A 1I9DA 3VFIA 3LWAA 4KNDA 4ZIJA 3NOFA 5ECKB 1O8WA 3DVXA 1FG4A 4ZBDA 3HVXA 4TR0A 1VF3A 1HNBA 5L71A 1PMTA 1O81A 3TB2A 1SKRB 4D73A 1T7PB 5ECPB 4EO3A 3TRPA 2H1AA 4I2TA 5B6MA 4QQ7A 1RK4A 2TRCP 3EURA 1HD2A 5LNKe 3VPQA 4F0CA 4G0KA 3DRNA 2NDOA 4IELA 3GX8A 5ECQB 5D9TA 4O32A 3TOTA 4LMWA 3DEXA 4G0LA 1GTIA 4L5OA 2QA2A 4RI7A 3KP9A 4MPFA 1A2JA 3HD5A 5IOXA 5KOWA 5G31A 2HZEA 3QD9A 1QUWA 3UBKA 2GSSA 3ZMKA 1R4WA 4TOPA 4WR5A 4PUFC 2V1MA 4ZB8A 3D4MA 4TKYA 1FB6A 2DLXA 1XOBA 2VO4A 3LORA 2F9SA 5D96A 3ERFA 1J0FA 3UOMA 4LL1B 5ECLB 4XTSA 1HQOA 5DCGA 1XPVA 2A4HA 1PFOA 1AQWA 5GAND 3IAS2 2LKUA 20GSA 4OD7A 2IWTA 1YDKA 4KF9A 4PX1A 5D9XA 3KEBA 2CZ3A 5CREA 2LV3A 3KM6A 5E59A 2DJKA 4OFTA 2H0GA 3GSSA 3KZQA 1EOHA 4Q5QA 1BEDA 3D4TA 4MPGA 3W8SA 3FR9A 2MMZA 1SENA 1QK8A 3PPUA 1K0CA 3IHQA 4KB3A 1GSEA 4HU7A 2CA8A 1U87A 3LXTA 2PUKC 3LFLA 4IVFA 3W6GA 4ACSA 2L59A 4CY6A 2FWFA 3IRAA 2ZNMA 1OE8A 2PGTA 2RUEA 3H79A 3H93A 3L78A 5GSSA 2HNLA 4MA9A 4K2DA 1AXDA 1ACVA 5F07A 3Q6OA 5G30A 4MABA 5DDLA 3EU3A 2YN1A 4TR4A 2WGRA 4ZL8A 2CVDA 1PX7A 2R5GA 4YAPA 2LTKA 3FY7A 3A5IA 1IYIA 3R2QA 1VF1A 3E0UA 1A2LA 2VCXA 5EL8A 3UIWA 1GNEA 1Z6MA 2LNSA 3ZVJD 2CAQA 4GQCA 1ZOFA 4EF0A 3DKSA 1R5AA 2ON7A 1J08A 4BWQA 6GSXA 2WRTA 2H0HA 2WDUA 4AJ8A 3BCIA 4YKFA 3IAM2 3E9JB 3RPPA 2HYXA 1WJKA 2IMEA 2PU9C 2J23A 5B8AA 2QSIA 2CZ2A 3A2VA 4POLA 1R5PA 1XW9A 1T8EB 4JEDA 4V2MA 3LYPA 5ECIB 3APQA 1GSFA 1TJDA 3CQFA 5ECOB 4F82A 3RHBA 2GS3A 3A2WA 3ZIVA 3EMXA 2KUCA 1GSUA 2K8VA 5J9BA 1GSSA 3MYDA 4BIKA 2FWEA 1PA3A 3VWWA 5HR0A 3GTUB 1KEBA 1THOA 4USSA 4EE0A 3C1RA 4RUVA 3FRCA 1SYRA 5JWQB 2F8FA 1EV9A 1A23A 4MP4A 3HA9A 2B7KA 4IP1A 1O7UA 3GTUA 3TJGA 3IXRA 1WRYA 3FR3A 1TI1A 3ZREA 2GZYA 3IV4A 3V1WA 1FW1A 4GQFA 5CO3A 1ABAA 4K1FA 3Q19A 2R6KA 2C0DA 2EIRA 3TOUA 1TXXA 3J7Yb 3QAVA 3IE3A 2NBSA 2LEGA 4DSQA 1XWAA 1TP9A 2VM2A 3KJYA 1MEKA 3A5WA 1M0UA 1OVNA 4V1Ag 1B48A 4Z7XA 1X9WB 4X4JA 5J4UA 1QQ2A 2YZUA 1ZYQB 3GL3A 3N9JA 3VWUA 4IGJA 4EDZA 4OFNA 5A4VA 4FIWA 1GH2A 5A4WA 5AGYA 3KCMA 1XFLA 2H71A 2V6OA 2JZSA 1TU8A 5IMZA 5IMAA 1A8YA 3F63A 4K6XA 3TDGA 4PNGA 2WS2A 3UEMA 2G0FA 4IP6A 2JZTA 1F9MA 3GYKA 1GTBA 2E2GA 2YV9A 5JCGA 5EY6A 5AN1A 2H72A 4NWYA 3IBHA 3P90A 3VK9A 4DSSB 1NSWA 2X64A 3GNJA 1J9BA 22GSA 2DJJA 2XHFA 4JE1A 2H8LA 2H19A 4X0XA 6GSYA 1MDJA 2FUG2 3CYNA 4V1Ap 2L5LA 1XZOA 5CRGA 1GSQA 2FA4A 4DSSA 3TKQA 1EOGA 5IMCA 4XS6A 1EGOA 2H75A 3EWLA 5IPHA 1A8LA 2CVKA 3F6DA 3C1SA 5IQYA 2K6VA 3APSA 4HUAA 1XWCA 1PKWA 2GZZA 2HXKA 4GCIA 4FO5A 4MDCA 3P7XA 4PQ1A 4IS0A 1PSQA 3BD2A 2I1UA 2HSHA 3GFKA 1TRUA 2C1YA 2C0GA 4EVMA 4NMUA 5KN2A 2V41A 3ISOA 2IMDA 1WOUA 1V9WA 3LXZA 4I97A 1W89A 3C7MA 3QAWA 1B9XC 3D5JA 1EP7A 2R0PA 1OYJA 5G2ZA 4P3YB 3HY2A 2FNOA 3U5RE 2MBSA 5LCZA 4MCUA 3QCPA 5ID2A 3WGEA 4IQ1A 4HQSA 1BYEA 4AJ6A 4J56E 2RM5A 2GT6A 3EC3A 1RW1A 1YZXA 2L57A 2H1DA 3DXBA 2YNXA 4PURA 3GMFA 3FZAA 4IJIA 1T00A 3WT2A 3L4NA 3DYRA 2P5QA 3TJBA 3S9FA 4TR1B 1GUKA 4BVYB 1K0BA 3CSIA 5ECNB 5HFKA 1M9BA 1U6TA 3RDWA 1KBNA 1XOAA 2R2JA 3D6IA 2FGXA 1HYUA 5DJMA 3LG6A 2J9HA 2H0IA 4ZBBA 2F3MA 5DAKB 4JBBA 5FHIA 3TRQA 4TN8A 1GTUA 2LNTA 11GSA 2H1BA 1EGRA 3PH9A 2IIYA 4POKA 4IW9A 3TRXA 17GSA 4X43A 5IIZA 4TVEA 1JZDA 4XS1A 3VPTA 4L0UA 4NAXA 2LJRA 5INYA 1Z7PA 4FQUA 3FZ5A 1MTCA 3IR4A 1HNAA 3CSHA 3MDKA 1JZOA 1XVQA 3QMXA 5D9VA 1DSBA 3VI5A 4ZBAA 3P8WA 1TI3A 2K9FA 2OKAA 3FR6A 2GZPA 3PR8A 1G7DA 12GSA 4G2EA 2FCHA 2LS5A 3GKXA 2ZCTA 3G7IA 3F3QA 1FOHA 1WMJA 2WCIA 2ES7A 3HVNA 3O76A 4KW6A 1THXA 1VF4A 5F8BA 2ZUPA 3ZITA 3UVHA 4BA7A 1O6JA 1FVJA 2OE3A 4EXJA 3BCKA 2YWIA 4GWRA 4MZWA 1S3DA 1K0OA 2HE3A 5H5SA 1URMA 2VUPA 2X8GA 1A0FA 2RM6A 2VCTA 4HJMA 2YJ7A 4X1UA 4WXTA 1EP8A 9GSSA 2N5AA 2DKIA 3L9SA 3ZL5A 4POBA 5F0GA 3NZNA 4MMMA 2A2SA 2L4CA 2C80A 1FO5A 5KN3A 3HXSA 3N5OA 1X9SB 4N10A 5B8BA 2DJ0A 3EE2A 4K5SA 2L4QA 2IJYA 4JR6A 2VL9A 1PL1A 3UMAA 1K0AA 5D93A 1NW2A 1NM3A 2DMMA 4PUAA 3GKKA 2PPTA 2JACA 3CBUA 1TW9A 1WIKA 3LYKA 2LSTA 1TKDB 4GXZA 2GVPA 3UARA 1XWBA 3QAGA 4WETA 1T3BA 3ZFLA 1SJIA 3H4KA 2IMKA 5LD0A 2JSZA 4LL4B 4F2IA 2DIYA 5JCWA 3FZ4A 1K0NA 4G9HA 1U88A 2X4AA 4N30A 1N2AA 4ICYA 3RAZA 5DCHA 2VLTA 1Q98A 1ZCPA 3LJRA 3QFAC 2NVLA 1KTEA 1PX6A 1XW5A 2QKEA 4YQVA 4GRFA 4Q5RA 4V2LA 2FD3A 2IMIA 2MBTA 2R3XA 2IL3A 5JCUA 1XBSA 3LSZA 3FEUA 1O85A 2HRKA 2LQOA 5GZZB 3CMIA 5F05A 1WE0A 2DBCA 5C04A 2X8CA 3GSTA 2OADA 5JWOB 1ERVA 5J5NA 4I5QA 3TUEA 5J3RA 3M1GA 1PL2A 1M2AA 4GTUA 4MJBA 3F6FA 5D8IA 1Z6NA 3WD6A 1ZZYA 3ZRDA 4JR4A 3VWVA 1B4PA 3CTGA 2PN8A 3HJOA 1YF0A 4ECJA 2WB9A 5DBQA 4KCAA 4HJ2A 1M3JA 1WP0A 4O92A 1X5CA 2JSYA 2V2GA 1ZMAA 1HNCA 2NTOA 1SD8A 1KNGA 2H76A 4HZ4A 2XPEA 1SL0B 4LA1A 1XWGA 4POMA 2RIIA 3L9UA 4HDEA 3ERGA 2LRTA 1ERTA 5B7CA 4F9ZA 2PVOC 1WPIA 1Z9HA 1DBYA 2PVQA 2BMXA 2H01A 2YP6A 4KH7A 1PKZA 2R0CA 2WFCA 1FVKA 3MSZA 2V6KA 2D2ZA 5G1LA 1FHEA 2REMA 1A0RP 1GWCA 2WZ9A 1VGLA 3GKMA 2M46A 5FT3A 3H1NA 1TRWA 2L6DA 2IPAA 2P5RA 1VF2A 3RBTA 4I6XA 3A2XA 2LRCA 2VOCA 8GSSA 2YWNA 3L0HA 1C72A 4ULXA 2HRAA 2DJ1A 3HJPA 3QPMA 5G1KA 3TJFA 4KDYA 4MF5A 1K3YA 3M0FA 2X99A 1K0DA 4ISDA 2BTOT 2MYGA 4EUYA 5BRTA 1PD21 4CDOA 1ZL9A 4K0GA 1M3IA 1EEMA 2Z9SA 2KP1A 4WKWA 3PINA 4J2FA 4KX4A 4OWYA 3TJJA 3DD3A 3GKNA 3UAPA 2VAFA 2GQLA 3F4TA 2YPMA 7GSSA 1SYXA 3GUSA 4OCFA 4PQHA 3D22A 5EVOA 2B5XA 2A4VA 5CRDA 2VLUA 4NV5A 4HI7A 2HLSA 2XC2A 4H86A 2KLXA 3LW9A 4CW9A 5ECMB 2DJ3A 1QGVA 5ELGA 4IKHA 1YEPA 2LQQA 4MNNA 3GHAA 3IC8A 4O5RA 3FK8A 1G7OA 3BOAA 2XPDA 1M9AA 5G5FA 2DJ2A 1LJRA 4DEJA 5J9CA 2FWGA 1V40A 2OBKA 3SBCA 5ABRA 1ST9A 2DSAA 2HRFA 1OKTA 4YH2A 3MAKA 3I9V2 2E0QA 4ZL7A 2YCDA 2GSTA 2XBQA 3I69A 3TJKA 4IJ3A 4NV2A 4G0IA 1CQHA 4JRRA 1TK0B 3ME8A 1LU4A 2CX4A 1VRSD 3KH9A 2B3SA 2LJAA 1BQ7A 2JZRA 5JWRB 2AAWA 1GLQA 3TGZA 1G6YA 4IN0A 4O7HA 5KN1A 4BWSA 1JFUA 2R37A 4O5UA 4ECCA 2RLIA 5FWGA 2ON5A 3ZVJA 2OJLA 2C3QA 3E3EA 1OC3A 1JZWA 4ILFA 2R0GA 1YEXA 4WBRD 4FH8A 2JL4A 3GIXA 2B7JA 3LGCA 3TKSE 2UZ8A 3TKRA 4WF4A 4MH3A 2MMNA 2FA8A 4HQZA 5COHA 1JLWA 3KTBA 2H6ZA 5H5RA 3KGKA 3CXGA 2A2PA 1XCCA 2O7KA 3U6VA 4ECBA 1GLPA 5AIXA 2LRNA 1OC9B 5G5EA 5DJLA 4L5LA 3VWXA 4L8EA 10GSA 3J7Yk 4AJ7A 1H75A 1SKSB 3F4SA 2B5YA 3DMLA 3EU4A 2CT6A 3KD0A 2KP2A 4Q5NA 1UA5A 4AF2A 1OC9A 3IOSA 4K2XA 2X8HA 2L6CA 2PBJA 4XHMA 2MMAA 2YANA 4MF6A 2VM1A 5IMDA 3R3EA 1GL8A 4TXOB 5AISA 2CVBA 4TR3A 2WULA 3KMNA 3APOA 2RUFA 3LEFA 3ZFBA 2IFQB 1IYHA 2H73A 4OO5A 4TR1A 1YJ6A 6GSTA 4BVYA 2A2RA 18GSA 3US3A 2YJHA 1ML6A 1U3IA 3C73A 3FMWA 2I81A 1G0TA 2VLVA 2TIRA 2N5BA 4KSMA 2M80A 4F03A 2IFQA 2FY6A 5HQPA 13GSA 2O8VB 3ZIJA 5GSTA 1PN0A 1YKAA 2B5EA 3KIJA 1QXHA 5DAKA 3F8UA 1X0RA 3ME7A 5CYYA 2HI7A 5A4UA 4HOJA 4E8EA 2IMFA 5ELAA 2VL3A 4CY8A 4EKZA 2PWJA 2R4VA 4BL7B 2AUVA 3GN3A 2MMOA 1MDIA 1A2MA 1G6WA 2TRXA 4ID0A 1ON4A 3ZTLA 1B8XA 2MZCA 5AIVA 4Z2RA 3BJ5A 14GSA 3ZLPA 1OAZA 3D21A 1MD4A 3IC4A 4D73B 3GL5A 1K0MA 1T4YA 2AHEA 4HS1A 1E2YA 2FWHA 2H66A 2GGTA 1XIYA 4MZBA 1TTZA 3QR6A 1N8JA 1EWXA 5DQYA 4GLTA 1ZYEA 2E7PA 6GSVA 3F0IA 1EZKA 4DSRA 3EVIA 4HU9A 1TK8B 4DVCA 2CQ9A 1V98A 2VCZA 1AQVA 4HSCX 2EIQA 1TOFA 3I6AA 2C3TA 2NPBA 3FYGA 2GDRA 2HZEB 4Q5FA 4Z2UA 4NXIA 3VLNA 5ECSA 1TRSA 1SU9A 6GSSA 3ZMLA 1GRXA 5IOWA 2PERA 4XIHA 5ECRB 4BVXB 1GP1A 1QFNA 3UBLA 3MIXA 4G10A 1V57A 3HHVA 3KXOA 4K7OA 4O5QA 2KHPA 3CRTA 4E8HA 2OBIA 1I5GA 4KDXA 4ZB9A 1X9MB 4BVXA 3TKPA 3M9KA 3HYPA 4EL1A 4NHZA 2AV4A 1BG5A 4WBJA 1AIUA 4EIQA 4ML6A 3D0ZA 2H74A 4YQUA 1MDKA 4LMVA 1PRXA 3QOUA 4FYCA 4YAVA 4MF7A 4PQIA 2VIMA 2IN3A 5D73A 1TRVA 1O8XA 1XG8A 2FHEA 4EC0A 1DUGA 5E4WA 3G7YA 3GA4A 3M8NA 4GF0A 6GSWA 4K0NA 4F0BA 2M72A 3FKFA 1Q4JA 2H6XA 1TU7A 4XCSA 1DE2A 2QC7A 4A5PA 1K3OA 4N0VA 4CHSA 2JU5A 3TKSC 2AJQB 5F06A 2I9HA 1H4OA 3H8QA 2C0FA 1SL1B 4QL7A 2GQKA 4K7IA 3HVVA 4GSNA 1M2DA 1M7TA 4PTSA 2HSMA 4BPYA 2KOKA 2WJUA 2GQMA 1NHOA 4OFMA 1GUMA
chains in the Genus database with same CATH topology
3K8NA 4KCEA 3HZ8A 3UL3A 1XW6A 4MK3A 4EDYA 1FAAA 1ERWA 4HZ2A 1LBKA 3WYWA 1W4VA 4RI6A 1F2EA 3NIVA 1SK0A 3HCZA 2M66A 3HKRA 3MNGA 1B9YC 3HJMA 3IDVA 2GTUA 3M9JA 2VCWA 3VURA 1PN9A 4IHUA 3WGXA 2H30A 2DIZA 2H70A 3BBYA 3DGQA 1M2BA 1O73A 4NHWA 1YKCA 4RQRA 2PMTA 1ERUA 3KH7A 1M99A 2YZHA 5HR3A 3GRXA 5CAXA 3GV1A 4XS4B 6GSUA 4TW5A 3ZYWA 2O89A 1AW9A 1WWJA 2G2QA 4MLYA 4KE3A 3VI7A 1XXUA 2VL2C 1CQGA 1ILOA 2F8AA 3DWVA 2YV7A 4WR4A 1OE7A 2BJXA 4XS4A 4Z2TA 3EYTA 4JZQA 1OC8A 4KDUA 4ZILA 3TKSA 3JCML 1GUHA 3CTFA 2OE1A 4PNFA 4MZCA 1ZYNA 4KA0A 2I3YA 2GLRA 3UVTA 2I4AA 3W8JA 1DE1A 5H5QA 19GSA 2HZFA 1SJ6A 1B4QA 2HFDA 1SK2A 1S3CA 3KTLA 1R7HA 1V58A 1BJXA 4KUNA 4TRXA 1R26A 4IQAA 4EIPA 1PQNA 3P2AA 5GAPD 4YQMA 1AC1A 5C00A 4I8BA 4K8MA 1F3AA 5CRHA 1X5DA 3GURA 5HFGA 3O6TA 1EEJA 1K3LA 3L9VA 3MWHA 5ECHB 2B6MA 1ZYPA 1GSYA 1PGTA 1SK1A 2HT9A 5CRWA 1GULA 4ECIA 3CSJA 5KOXA 1BX9A 4MJAA 3C8EA 2GSQA 5KN0A 4OO4A 2C4JA 2L5OA 4KAEA 3LQ7A 4L0WA 3WT1A 1JHBA 5HFIA 3EMPA 1EV4A 4PXOA 5DALB 3KP8A 4MH2A 2CAIA 3FW2A 1AQXA 3AY8A 2VCVA 4RQXA 1BAYA 2VL2A 5IO0A 3G9BA 1F6MC 1MD3A 1YY7A 2DKHA 2C3NA 5DALA 3DVWA 1TK5B 4IBPA 1AAZA 2B1LA 2P0GA 1A24A 4I2UA 2HRNA 1ZGNA 4AGSA 1GSDA 5EPFA 2YWMA 1T4ZA 1FOVA 5D9WA 3O3TA 4KGIA 5BMUA 5IM9A 2H1GA 2DMLA 3EPTA 2X49A 4G19A 5DQSA 5ENUA 2HSYA 4ZB6A 1Z5YE 2AB6A 4XRDA 1V2AA 2P31A 3SWLA 4ZXGA 1XWKA 1G7EA 1AUCA 4N0ZA 4FYUA 2OA7A 2QA1A 1SKWB 16GSA 2CX3A 4MJEA 1XVWA 1YQ1A 4KSOA 1X5EA 2FLSA 1T1VA 1Y6EA 3ED3A 3IK7A 4OCEA 5DVBA 3ZZXA 1GNWA 1RQMA 5HR1A 5CNWA 2F51A 2O87A 3DIEA 1UN2A 1SD9A 5IO2A 1QMVA 1UVZA 3FZ9A 4OMVA 1Z7RA 4HEA2 2H6YA 3QFBC 3EINA 2VCQA 2GSRA 4ZL9A 5IMFA 1Z3EA 3RHCA 4LLRA 4YKGA 2OACA 4WEYA 1YF1A 2AYTA 3F3RA 4WF5A 1SJZA 3PGTA 5A5KA 2VD0A 5IPGA 3ERWA 3OR5A 3C71A 5ID2B 4J57E 1JLVA 2O85A 3IA1A 4PGTA 4XRAA 2OE0A 3KMOA 5IMVA 3F4RA 2QGVA 1NHYA 1E6BA 3GH9A 2K8SA 1USBA 1JZRA 5J41A 3UJ1A 2ALBA 3QDNA 2VD1A 4MJCA 3Q18A 3F9UA 4N11A 2C0EA 3TCOA 2GT5A 3IHGA 3HVSA 2JADA 3G7JA 4FYBA 1F3BA 1TDIA 3HDCA 3GH6A 4NPBA 2LUSA 2XBIA 4GSTA 4TXOA 3RPNA 2K18A 4QL9A 4ML1A 3WGDA 3I43A 3FHKA 5KEJA 2C8UA 1F37A 1SL2B 2LJKA 4GSSA 2EIOA 1S3AA 5HR2A 4K7NA 1UC7A 4K9ZA 1GTAA 2B1KA 3CRUA 2DC5A 1OKDA 2V32A 4K5RA 4JU5A 3GX0A 2E2MA 3IK9A 3IPZA 5B6NA 1FB0A 1U3AA 2EC4A 5CP1A 4V2NA 2N5FA 3M3MA 3Q74A 1Y25A 4BL7A 2YOIA 4TXVA 3A3TA 2YWOA 3HZ4A 2CV4A 1I9DA 3VFIA 3LWAA 4KNDA 4ZIJA 3NOFA 5ECKB 1O8WA 3DVXA 1FG4A 4ZBDA 3HVXA 4TR0A 1VF3A 1HNBA 5L71A 1PMTA 1O81A 3TB2A 1SKRB 4D73A 1T7PB 5ECPB 4EO3A 3TRPA 2H1AA 4I2TA 5B6MA 4QQ7A 1RK4A 2TRCP 3EURA 1HD2A 5LNKe 3VPQA 4F0CA 4G0KA 3DRNA 2NDOA 4IELA 3GX8A 5ECQB 5D9TA 4O32A 3TOTA 4LMWA 3DEXA 4G0LA 1GTIA 4L5OA 2QA2A 4RI7A 3KP9A 4MPFA 1A2JA 3HD5A 5IOXA 5KOWA 5G31A 2HZEA 3QD9A 1QUWA 3UBKA 2GSSA 3ZMKA 1R4WA 4TOPA 4WR5A 4PUFC 2V1MA 4ZB8A 3D4MA 4TKYA 1FB6A 2DLXA 1XOBA 2VO4A 3LORA 2F9SA 5D96A 3ERFA 1J0FA 3UOMA 4LL1B 5ECLB 4XTSA 1HQOA 5DCGA 1XPVA 2A4HA 1AQWA 5GAND 3IAS2 2LKUA 20GSA 4OD7A 2IWTA 1YDKA 4KF9A 4PX1A 5D9XA 3KEBA 2CZ3A 5CREA 2LV3A 3KM6A 5E59A 2DJKA 4OFTA 2H0GA 3GSSA 3KZQA 1EOHA 4Q5QA 1BEDA 3D4TA 4MPGA 3W8SA 3FR9A 2MMZA 1SENA 1QK8A 3PPUA 1K0CA 3IHQA 4KB3A 1GSEA 4HU7A 2CA8A 1U87A 3LXTA 2PUKC 3LFLA 4IVFA 3W6GA 4ACSA 2L59A 4CY6A 2FWFA 3IRAA 2ZNMA 1OE8A 2PGTA 2RUEA 3H79A 3H93A 3L78A 5GSSA 2HNLA 4MA9A 4K2DA 1AXDA 1ACVA 5F07A 3Q6OA 5G30A 4MABA 5DDLA 3EU3A 2YN1A 4TR4A 2WGRA 4ZL8A 2CVDA 1PX7A 2R5GA 4YAPA 2LTKA 3FY7A 3A5IA 1IYIA 3R2QA 1VF1A 3E0UA 1A2LA 2VCXA 5EL8A 3UIWA 1GNEA 1Z6MA 2LNSA 3ZVJD 2CAQA 4GQCA 1ZOFA 4EF0A 3DKSA 1R5AA 2ON7A 1J08A 4BWQA 6GSXA 2WRTA 2H0HA 2WDUA 4AJ8A 3BCIA 4YKFA 3IAM2 3E9JB 3RPPA 2HYXA 1WJKA 2IMEA 2PU9C 2J23A 5B8AA 2QSIA 2CZ2A 3A2VA 4POLA 1R5PA 1XW9A 1T8EB 4JEDA 4V2MA 3LYPA 5ECIB 3APQA 1GSFA 1TJDA 5ECOB 4F82A 3RHBA 2GS3A 3A2WA 3ZIVA 3EMXA 2KUCA 1GSUA 2K8VA 5J9BA 1GSSA 3MYDA 2FWEA 1PA3A 3VWWA 5HR0A 3GTUB 1KEBA 1THOA 4USSA 4EE0A 3C1RA 4RUVA 3FRCA 1SYRA 5JWQB 2F8FA 1EV9A 1A23A 4MP4A 3HA9A 2B7KA 4IP1A 1O7UA 3GTUA 3TJGA 3IXRA 1WRYA 3FR3A 1TI1A 3ZREA 2GZYA 3IV4A 3V1WA 1FW1A 4GQFA 5CO3A 1ABAA 4K1FA 3Q19A 2R6KA 2C0DA 2EIRA 3TOUA 1TXXA 3J7Yb 3QAVA 3IE3A 2NBSA 2LEGA 4DSQA 1XWAA 1TP9A 2VM2A 3KJYA 1MEKA 3A5WA 1M0UA 1OVNA 4V1Ag 1B48A 4Z7XA 1X9WB 4X4JA 5J4UA 1QQ2A 2YZUA 1ZYQB 3GL3A 3N9JA 3VWUA 4IGJA 4EDZA 4OFNA 5A4VA 4FIWA 1GH2A 5A4WA 5AGYA 3KCMA 1XFLA 2H71A 2V6OA 2JZSA 1TU8A 5IMZA 5IMAA 1A8YA 3F63A 4K6XA 3TDGA 4PNGA 2WS2A 3UEMA 2G0FA 4IP6A 2JZTA 1F9MA 3GYKA 1GTBA 2E2GA 2YV9A 5JCGA 5EY6A 5AN1A 2H72A 4NWYA 3IBHA 3P90A 3VK9A 4DSSB 1NSWA 2X64A 3GNJA 1J9BA 22GSA 2DJJA 2XHFA 4JE1A 2H8LA 2H19A 4X0XA 6GSYA 1MDJA 2FUG2 3CYNA 4V1Ap 2L5LA 1XZOA 5CRGA 1GSQA 2FA4A 4DSSA 3TKQA 1EOGA 5IMCA 4XS6A 1EGOA 2H75A 3EWLA 5IPHA 1A8LA 2CVKA 3F6DA 3C1SA 5IQYA 2K6VA 3APSA 4HUAA 1XWCA 1PKWA 2GZZA 2HXKA 4GCIA 4FO5A 4MDCA 3P7XA 4PQ1A 4IS0A 1PSQA 3BD2A 2I1UA 2HSHA 3GFKA 1TRUA 2C1YA 2C0GA 4EVMA 4NMUA 5KN2A 2V41A 3ISOA 2IMDA 1WOUA 1V9WA 3LXZA 4I97A 1W89A 3C7MA 3QAWA 1B9XC 3D5JA 1EP7A 2R0PA 1OYJA 5G2ZA 4P3YB 3HY2A 2FNOA 3U5RE 2MBSA 5LCZA 4MCUA 3QCPA 5ID2A 3WGEA 4IQ1A 4HQSA 1BYEA 4AJ6A 4J56E 2RM5A 2GT6A 3EC3A 1RW1A 1YZXA 2L57A 2H1DA 3DXBA 2YNXA 4PURA 3GMFA 3FZAA 4IJIA 1T00A 3WT2A 3L4NA 3DYRA 2P5QA 3TJBA 3S9FA 4TR1B 1GUKA 4BVYB 1K0BA 3CSIA 5ECNB 5HFKA 1M9BA 1U6TA 3RDWA 1KBNA 1XOAA 2R2JA 3D6IA 2FGXA 1HYUA 5DJMA 3LG6A 2J9HA 2H0IA 4ZBBA 2F3MA 5DAKB 4JBBA 5FHIA 3TRQA 4TN8A 1GTUA 2LNTA 11GSA 2H1BA 1EGRA 3PH9A 2IIYA 4POKA 4IW9A 3TRXA 17GSA 4X43A 5IIZA 4TVEA 1JZDA 4XS1A 3VPTA 4L0UA 4NAXA 2LJRA 5INYA 1Z7PA 4FQUA 3FZ5A 1MTCA 3IR4A 1HNAA 3CSHA 3MDKA 1JZOA 1XVQA 3QMXA 5D9VA 1DSBA 3VI5A 4ZBAA 3P8WA 1TI3A 2K9FA 2OKAA 3FR6A 2GZPA 3PR8A 1G7DA 12GSA 4G2EA 2FCHA 2LS5A 3GKXA 2ZCTA 3G7IA 3F3QA 1FOHA 1WMJA 2WCIA 2ES7A 3O76A 4KW6A 1THXA 1VF4A 5F8BA 2ZUPA 3ZITA 3UVHA 4BA7A 1O6JA 1FVJA 2OE3A 4EXJA 3BCKA 2YWIA 4GWRA 4MZWA 1S3DA 1K0OA 2HE3A 5H5SA 1URMA 2VUPA 2X8GA 1A0FA 2RM6A 2VCTA 4HJMA 2YJ7A 4X1UA 4WXTA 1EP8A 9GSSA 2N5AA 2DKIA 3L9SA 3ZL5A 4POBA 5F0GA 3NZNA 4MMMA 2A2SA 2L4CA 2C80A 1FO5A 5KN3A 3HXSA 3N5OA 1X9SB 4N10A 5B8BA 2DJ0A 3EE2A 4K5SA 2L4QA 2IJYA 4JR6A 2VL9A 1PL1A 3UMAA 1K0AA 5D93A 1NW2A 1NM3A 2DMMA 4PUAA 3GKKA 2PPTA 2JACA 3CBUA 1TW9A 1WIKA 3LYKA 2LSTA 1TKDB 4GXZA 2GVPA 3UARA 1XWBA 3QAGA 4WETA 1T3BA 3ZFLA 1SJIA 3H4KA 2IMKA 5LD0A 2JSZA 4LL4B 4F2IA 2DIYA 5JCWA 3FZ4A 1K0NA 4G9HA 1U88A 2X4AA 4N30A 1N2AA 4ICYA 3RAZA 5DCHA 2VLTA 1Q98A 1ZCPA 3LJRA 3QFAC 2NVLA 1KTEA 1PX6A 1XW5A 2QKEA 4YQVA 4GRFA 4Q5RA 4V2LA 2FD3A 2IMIA 2MBTA 2R3XA 2IL3A 5JCUA 1XBSA 3LSZA 3FEUA 1O85A 2HRKA 2LQOA 5GZZB 3CMIA 5F05A 1WE0A 2DBCA 5C04A 2X8CA 3GSTA 2OADA 5JWOB 1ERVA 5J5NA 4I5QA 3TUEA 5J3RA 3M1GA 1PL2A 1M2AA 4GTUA 4MJBA 3F6FA 5D8IA 1Z6NA 3WD6A 1ZZYA 3ZRDA 4JR4A 3VWVA 1B4PA 3CTGA 2PN8A 3HJOA 1YF0A 4ECJA 2WB9A 5DBQA 4KCAA 4HJ2A 1WP0A 4O92A 1X5CA 2JSYA 2V2GA 1ZMAA 1HNCA 2NTOA 1SD8A 1KNGA 2H76A 4HZ4A 2XPEA 1SL0B 4LA1A 1XWGA 4POMA 2RIIA 3L9UA 4HDEA 3ERGA 2LRTA 1ERTA 5B7CA 4F9ZA 2PVOC 1WPIA 1Z9HA 1DBYA 2PVQA 2BMXA 2H01A 2YP6A 4KH7A 1PKZA 2R0CA 2WFCA 1FVKA 3MSZA 2V6KA 2D2ZA 5G1LA 1FHEA 2REMA 1A0RP 1GWCA 2WZ9A 1VGLA 3GKMA 2M46A 5FT3A 3H1NA 1TRWA 2L6DA 2IPAA 2P5RA 1VF2A 3RBTA 4I6XA 3A2XA 2LRCA 2VOCA 8GSSA 2YWNA 3L0HA 1C72A 4ULXA 2HRAA 2DJ1A 3HJPA 3QPMA 5G1KA 3TJFA 4KDYA 4MF5A 1K3YA 3M0FA 2X99A 1K0DA 4ISDA 2BTOT 2MYGA 4EUYA 5BRTA 1PD21 4CDOA 1ZL9A 4K0GA 1EEMA 2Z9SA 2KP1A 4WKWA 3PINA 4J2FA 4KX4A 4OWYA 3TJJA 3DD3A 3GKNA 3UAPA 2VAFA 2GQLA 3F4TA 2YPMA 7GSSA 1SYXA 3GUSA 4OCFA 4PQHA 3D22A 5EVOA 2B5XA 2A4VA 5CRDA 2VLUA 4NV5A 4HI7A 2HLSA 2XC2A 4H86A 2KLXA 3LW9A 4CW9A 5ECMB 2DJ3A 1QGVA 5ELGA 4IKHA 1YEPA 2LQQA 4MNNA 3GHAA 3IC8A 4O5RA 3FK8A 1G7OA 3BOAA 2XPDA 1M9AA 5G5FA 2DJ2A 1LJRA 4DEJA 5J9CA 2FWGA 1V40A 2OBKA 3SBCA 5ABRA 1ST9A 2DSAA 2HRFA 1OKTA 4YH2A 3MAKA 3I9V2 2E0QA 4ZL7A 2YCDA 2GSTA 2XBQA 3I69A 3TJKA 4IJ3A 4NV2A 4G0IA 1CQHA 4JRRA 1TK0B 3ME8A 1LU4A 2CX4A 1VRSD 3KH9A 2B3SA 2LJAA 1BQ7A 2JZRA 5JWRB 2AAWA 1GLQA 3TGZA 1G6YA 4IN0A 4O7HA 5KN1A 4BWSA 1JFUA 2R37A 4O5UA 4ECCA 2RLIA 5FWGA 2ON5A 3ZVJA 2OJLA 2C3QA 3E3EA 1OC3A 1JZWA 4ILFA 2R0GA 1YEXA 4WBRD 4FH8A 2JL4A 3GIXA 2B7JA 3LGCA 3TKSE 2UZ8A 3TKRA 4WF4A 4MH3A 2MMNA 2FA8A 4HQZA 5COHA 1JLWA 3KTBA 2H6ZA 5H5RA 3KGKA 3CXGA 2A2PA 1XCCA 2O7KA 3U6VA 4ECBA 1GLPA 5AIXA 2LRNA 1OC9B 5G5EA 5DJLA 4L5LA 3VWXA 4L8EA 10GSA 3J7Yk 4AJ7A 1H75A 1SKSB 3F4SA 2B5YA 3DMLA 3EU4A 2CT6A 3KD0A 2KP2A 4Q5NA 1UA5A 4AF2A 1OC9A 3IOSA 4K2XA 2X8HA 2L6CA 2PBJA 4XHMA 2MMAA 2YANA 4MF6A 2VM1A 5IMDA 3R3EA 1GL8A 4TXOB 5AISA 2CVBA 4TR3A 2WULA 3KMNA 3APOA 2RUFA 3LEFA 3ZFBA 2IFQB 1IYHA 2H73A 4OO5A 4TR1A 1YJ6A 6GSTA 4BVYA 2A2RA 18GSA 3US3A 2YJHA 1ML6A 1U3IA 3C73A 3FMWA 2I81A 1G0TA 2VLVA 2TIRA 2N5BA 4KSMA 2M80A 4F03A 2IFQA 2FY6A 5HQPA 13GSA 2O8VB 3ZIJA 5GSTA 1PN0A 1YKAA 2B5EA 3KIJA 1QXHA 5DAKA 3F8UA 1X0RA 3ME7A 5CYYA 2HI7A 5A4UA 4HOJA 4E8EA 2IMFA 5ELAA 2VL3A 4CY8A 4EKZA 2PWJA 2R4VA 4BL7B 2AUVA 3GN3A 2MMOA 1MDIA 1A2MA 1G6WA 2TRXA 4ID0A 1ON4A 3ZTLA 1B8XA 2MZCA 5AIVA 4Z2RA 3BJ5A 14GSA 3ZLPA 1OAZA 3D21A 1MD4A 3IC4A 4D73B 3GL5A 1K0MA 1T4YA 2AHEA 4HS1A 1E2YA 2FWHA 2H66A 2GGTA 1XIYA 4MZBA 1TTZA 3QR6A 1N8JA 1EWXA 5DQYA 4GLTA 1ZYEA 2E7PA 6GSVA 3F0IA 1EZKA 4DSRA 3EVIA 4HU9A 1TK8B 4DVCA 2CQ9A 1V98A 2VCZA 1AQVA 2EIQA 1TOFA 3I6AA 2C3TA 2NPBA 3FYGA 2GDRA 2HZEB 4Q5FA 4Z2UA 4NXIA 3VLNA 5ECSA 1TRSA 1SU9A 6GSSA 3ZMLA 1GRXA 5IOWA 2PERA 4XIHA 5ECRB 4BVXB 1GP1A 1QFNA 3UBLA 3MIXA 4G10A 1V57A 3HHVA 3KXOA 4K7OA 4O5QA 2KHPA 3CRTA 4E8HA 2OBIA 1I5GA 4KDXA 4ZB9A 1X9MB 4BVXA 3TKPA 3M9KA 3HYPA 4EL1A 4NHZA 2AV4A 1BG5A 4WBJA 1AIUA 4EIQA 4ML6A 3D0ZA 2H74A 4YQUA 1MDKA 4LMVA 1PRXA 3QOUA 4FYCA 4YAVA 4MF7A 4PQIA 2VIMA 2IN3A 5D73A 1TRVA 1O8XA 2FHEA 4EC0A 1DUGA 5E4WA 3G7YA 3GA4A 3M8NA 4GF0A 6GSWA 4K0NA 4F0BA 2M72A 3FKFA 1Q4JA 2H6XA 1TU7A 4XCSA 1DE2A 2QC7A 4A5PA 1K3OA 4N0VA 4CHSA 2JU5A 3TKSC 2AJQB 5F06A 2I9HA 1H4OA 3H8QA 2C0FA 1SL1B 4QL7A 2GQKA 4K7IA 3HVVA 4GSNA 1M2DA 1M7TA 4PTSA 2HSMA 4BPYA 2KOKA 2WJUA 2GQMA 1NHOA 4OFMA 1GUMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K8N A;  4KCE A;  3HZ8 A;  3UL3 A;  1XW6 A;  4MK3 A;  4EDY A;  1FAA A;  1ERW A;  4HZ2 A;  1LBK A;  3WYW A;  1W4V A;  4RI6 A;  1F2E A;  3NIV A;  1SK0 A;  3HCZ A;  2M66 A;  3HKR A;  3MNG A;  1B9Y C;  3HJM A;  3IDV A;  2GTU A;  3M9J A;  2VCW A;  3VUR A;  1PN9 A;  4IHU A;  3WGX A;  2H30 A;  2DIZ A;  2H70 A;  3BBY A;  3DGQ A;  1M2B A;  1O73 A;  4NHW A;  1YKC A;  4RQR A;  2PMT A;  1ERU A;  3KH7 A;  1M99 A;  2YZH A;  5HR3 A;  3GRX A;  5CAX A;  3GV1 A;  4XS4 B;  6GSU A;  4TW5 A;  3ZYW A;  2O89 A;  1AW9 A;  1WWJ A;  2G2Q A;  4MLY A;  4KE3 A;  3VI7 A;  1XXU A;  2VL2 C;  1CQG A;  1ILO A;  2F8A A;  3DWV A;  2YV7 A;  4WR4 A;  1OE7 A;  2BJX A;  4XS4 A;  3EYT A;  4JZQ A;  1OC8 A;  4KDU A;  4ZIL A;  3TKS A;  3JCM L;  1GUH A;  3CTF A;  2OE1 A;  4PNF A;  4MZC A;  4KA0 A;  2I3Y A;  2GLR A;  3UVT A;  2I4A A;  3W8J A;  1DE1 A;  5H5Q A;  19GS A;  2HZF A;  1SJ6 A;  1B4Q A;  2HFD A;  1SK2 A;  1S3C A;  3KTL A;  1R7H A;  1V58 A;  1BJX A;  4KUN A;  4TRX A;  1R26 A;  4IQA A;  1PQN A;  3P2A A;  5GAP D;  4YQM A;  1AC1 A;  5C00 A;  4I8B A;  4K8M A;  1F3A A;  5CRH A;  1X5D A;  3GUR A;  5HFG A;  3O6T A;  1EEJ A;  1K3L A;  3L9V A;  3MWH A;  5ECH B;  2B6M A;  1GSY A;  1PGT A;  1SK1 A;  2HT9 A;  5CRW A;  1GUL A;  4ECI A;  3CSJ A;  1BX9 A;  4MJA A;  3C8E A;  2GSQ A;  5KN0 A;  4OO4 A;  2C4J A;  2L5O A;  4KAE A;  3LQ7 A;  4L0W A;  3WT1 A;  1JHB A;  5HFI A;  3EMP A;  1EV4 A;  4PXO A;  5DAL B;  3KP8 A;  4MH2 A;  2CAI A;  3FW2 A;  1AQX A;  3AY8 A;  2VCV A;  4RQX A;  1BAY A;  2VL2 A;  5IO0 A;  3G9B A;  1F6M C;  1MD3 A;  1YY7 A;  2C3N A;  5DAL A;  3DVW A;  1TK5 B;  4IBP A;  1AAZ A;  2B1L A;  2P0G A;  1A24 A;  4I2U A;  2HRN A;  1ZGN A;  4AGS A;  1GSD A;  5EPF A;  2YWM A;  1T4Z A;  1FOV A;  5D9W A;  3O3T A;  4KGI A;  5IM9 A;  2H1G A;  2DML A;  4G19 A;  5DQS A;  5ENU A;  2HSY A;  4ZB6 A;  1Z5Y E;  2AB6 A;  4XRD A;  1V2A A;  2P31 A;  3SWL A;  4ZXG A;  1XWK A;  1G7E A;  1AUC A;  4N0Z A;  4FYU A;  2OA7 A;  1SKW B;  16GS A;  2CX3 A;  4MJE A;  1XVW A;  1YQ1 A;  4KSO A;  1X5E A;  2FLS A;  1T1V A;  1Y6E A;  3ED3 A;  3IK7 A;  4OCE A;  5DVB A;  3ZZX A;  1GNW A;  1RQM A;  5HR1 A;  5CNW A;  2F51 A;  2O87 A;  3DIE A;  1UN2 A;  1SD9 A;  5IO2 A;  1QMV A;  1UVZ A;  3FZ9 A;  4OMV A;  1Z7R A;  4HEA 2;  2H6Y A;  3QFB C;  3EIN A;  2VCQ A;  2GSR A;  4ZL9 A;  5IMF A;  1Z3E A;  3RHC A;  4LLR A;  2OAC A;  4WEY A;  1YF1 A;  2AYT A;  3F3R A;  4WF5 A;  1SJZ A;  3PGT A;  5A5K A;  2VD0 A;  5IPG A;  3ERW A;  3OR5 A;  3C71 A;  5ID2 B;  4J57 E;  1JLV A;  2O85 A;  3IA1 A;  4PGT A;  4XRA A;  2OE0 A;  3KMO A;  5IMV A;  3F4R A;  2QGV A;  1NHY A;  1E6B A;  3GH9 A;  2K8S A;  1USB A;  1JZR A;  5J41 A;  3UJ1 A;  2ALB A;  3QDN A;  2VD1 A;  4MJC A;  3Q18 A;  3F9U A;  4N11 A;  2C0E A;  3TCO A;  2GT5 A;  3HVS A;  2JAD A;  3G7J A;  4FYB A;  1F3B A;  1TDI A;  3HDC A;  3GH6 A;  4NPB A;  2LUS A;  2XBI A;  4GST A;  4TXO A;  3RPN A;  2K18 A;  4QL9 A;  4ML1 A;  3WGD A;  3I43 A;  3FHK A;  5KEJ A;  2C8U A;  1F37 A;  1SL2 B;  2LJK A;  4GSS A;  2EIO A;  1S3A A;  5HR2 A;  4K7N A;  1UC7 A;  4K9Z A;  1GTA A;  2B1K A;  3CRU A;  2DC5 A;  1OKD A;  2V32 A;  4JU5 A;  3GX0 A;  2E2M A;  3IK9 A;  3IPZ A;  5B6N A;  1FB0 A;  1U3A A;  2EC4 A;  5CP1 A;  4V2N A;  2N5F A;  3M3M A;  3Q74 A;  1Y25 A;  4BL7 A;  2YOI A;  4TXV A;  3A3T A;  2YWO A;  3HZ4 A;  2CV4 A;  1I9D A;  3VFI A;  3LWA A;  4KND A;  4ZIJ A;  3NOF A;  5ECK B;  1O8W A;  3DVX A;  1FG4 A;  4ZBD A;  3HVX A;  4TR0 A;  1VF3 A;  1HNB A;  5L71 A;  1PMT A;  1O81 A;  3TB2 A;  1SKR B;  4D73 A;  1T7P B;  5ECP B;  4EO3 A;  3TRP A;  2H1A A;  4I2T A;  5B6M A;  4QQ7 A;  1RK4 A;  2TRC P;  3EUR A;  1HD2 A;  5LNK e;  3VPQ A;  4F0C A;  3DRN A;  2NDO A;  4IEL A;  3GX8 A;  5ECQ B;  5D9T A;  4O32 A;  3TOT A;  4LMW A;  3DEX A;  1GTI A;  4L5O A;  4RI7 A;  3KP9 A;  4MPF A;  1A2J A;  3HD5 A;  5IOX A;  5G31 A;  2HZE A;  3QD9 A;  1QUW A;  3UBK A;  2GSS A;  3ZMK A;  1R4W A;  4TOP A;  4WR5 A;  4PUF C;  2V1M A;  4ZB8 A;  3D4M A;  4TKY A;  1FB6 A;  2DLX A;  1XOB A;  2VO4 A;  3LOR A;  2F9S A;  5D96 A;  3ERF A;  1J0F A;  3UOM A;  4LL1 B;  5ECL B;  4XTS A;  1HQO A;  5DCG A;  1XPV A;  1AQW A;  5GAN D;  3IAS 2;  2LKU A;  20GS A;  4OD7 A;  2IWT A;  1YDK A;  4PX1 A;  5D9X A;  3KEB A;  2CZ3 A;  5CRE A;  2LV3 A;  3KM6 A;  5E59 A;  2DJK A;  4OFT A;  2H0G A;  3GSS A;  3KZQ A;  1EOH A;  4Q5Q A;  1BED A;  3D4T A;  4MPG A;  3W8S A;  3FR9 A;  2MMZ A;  1SEN A;  1QK8 A;  1K0C A;  3IHQ A;  4KB3 A;  1GSE A;  4HU7 A;  2CA8 A;  1U87 A;  3LXT A;  2PUK C;  3LFL A;  4IVF A;  3W6G A;  4ACS A;  2L59 A;  2FWF A;  3IRA A;  2ZNM A;  1OE8 A;  2PGT A;  2RUE A;  3H79 A;  3H93 A;  3L78 A;  5GSS A;  2HNL A;  4MA9 A;  4K2D A;  1AXD A;  1ACV A;  5F07 A;  3Q6O A;  5G30 A;  4MAB A;  5DDL A;  3EU3 A;  2YN1 A;  4TR4 A;  2WGR A;  4ZL8 A;  2CVD A;  1PX7 A;  2R5G A;  4YAP A;  2LTK A;  3FY7 A;  1IYI A;  3R2Q A;  1VF1 A;  3E0U A;  1A2L A;  2VCX A;  5EL8 A;  3UIW A;  1GNE A;  1Z6M A;  2LNS A;  3ZVJ D;  2CAQ A;  4GQC A;  1ZOF A;  4EF0 A;  3DKS A;  1R5A A;  2ON7 A;  1J08 A;  4BWQ A;  6GSX A;  2WRT A;  2H0H A;  2WDU A;  4AJ8 A;  3BCI A;  3IAM 2;  3E9J B;  3RPP A;  2HYX A;  1WJK A;  2IME A;  2PU9 C;  2J23 A;  5B8A A;  2QSI A;  2CZ2 A;  3A2V A;  4POL A;  1R5P A;  1XW9 A;  1T8E B;  4JED A;  4V2M A;  3LYP A;  5ECI B;  3APQ A;  1GSF A;  1TJD A;  5ECO B;  4F82 A;  3RHB A;  2GS3 A;  3A2W A;  3ZIV A;  3EMX A;  2KUC A;  1GSU A;  2K8V A;  5J9B A;  1GSS A;  2FWE A;  1PA3 A;  3VWW A;  5HR0 A;  3GTU B;  1KEB A;  1THO A;  4EE0 A;  3C1R A;  4RUV A;  3FRC A;  1SYR A;  5JWQ B;  2F8F A;  1EV9 A;  1A23 A;  4MP4 A;  3HA9 A;  2B7K A;  4IP1 A;  1O7U A;  3GTU A;  3TJG A;  3IXR A;  1WRY A;  3FR3 A;  1TI1 A;  3ZRE A;  2GZY A;  3IV4 A;  3V1W A;  1FW1 A;  4GQF A;  5CO3 A;  1ABA A;  4K1F A;  3Q19 A;  2R6K A;  2C0D A;  2EIR A;  3TOU A;  1TXX A;  3J7Y b;  3QAV A;  3IE3 A;  2NBS A;  2LEG A;  4DSQ A;  1XWA A;  1TP9 A;  2VM2 A;  3KJY A;  1MEK A;  3A5W A;  1M0U A;  1OVN A;  4V1A g;  1B48 A;  4Z7X A;  1X9W B;  5J4U A;  1QQ2 A;  2YZU A;  1ZYQ B;  3GL3 A;  3N9J A;  3VWU A;  4IGJ A;  4EDZ A;  4OFN A;  5A4V A;  4FIW A;  1GH2 A;  5A4W A;  5AGY A;  3KCM A;  1XFL A;  2H71 A;  2V6O A;  2JZS A;  1TU8 A;  5IMZ A;  5IMA A;  1A8Y A;  3F63 A;  4K6X A;  3TDG A;  4PNG A;  2WS2 A;  3UEM A;  2G0F A;  4IP6 A;  2JZT A;  1F9M A;  3GYK A;  1GTB A;  2E2G A;  2YV9 A;  5JCG A;  5EY6 A;  5AN1 A;  2H72 A;  4NWY A;  3IBH A;  3P90 A;  3VK9 A;  4DSS B;  1NSW A;  2X64 A;  3GNJ A;  1J9B A;  22GS A;  2DJJ A;  2XHF A;  4JE1 A;  2H8L A;  2H19 A;  4X0X A;  6GSY A;  1MDJ A;  2FUG 2;  3CYN A;  4V1A p;  2L5L A;  1XZO A;  5CRG A;  1GSQ A;  2FA4 A;  4DSS A;  3TKQ A;  1EOG A;  5IMC A;  4XS6 A;  1EGO A;  2H75 A;  3EWL A;  5IPH A;  1A8L A;  2CVK A;  3F6D A;  3C1S A;  5IQY A;  2K6V A;  3APS A;  4HUA A;  1XWC A;  1PKW A;  2GZZ A;  2HXK A;  4GCI A;  4FO5 A;  4MDC A;  3P7X A;  4PQ1 A;  4IS0 A;  1PSQ A;  3BD2 A;  2I1U A;  2HSH A;  3GFK A;  1TRU A;  2C1Y A;  2C0G A;  4EVM A;  4NMU A;  5KN2 A;  2V41 A;  3ISO A;  2IMD A;  1WOU A;  1V9W A;  3LXZ A;  4I97 A;  1W89 A;  3C7M A;  3QAW A;  1B9X C;  3D5J A;  1EP7 A;  1OYJ A;  5G2Z A;  4P3Y B;  3HY2 A;  2FNO A;  3U5R E;  2MBS A;  5LCZ A;  4MCU A;  3QCP A;  5ID2 A;  3WGE A;  4IQ1 A;  4HQS A;  1BYE A;  4AJ6 A;  4J56 E;  2RM5 A;  2GT6 A;  3EC3 A;  1RW1 A;  1YZX A;  2L57 A;  2H1D A;  3DXB A;  2YNX A;  4PUR A;  3GMF A;  3FZA A;  4IJI A;  1T00 A;  3WT2 A;  3L4N A;  3DYR A;  2P5Q A;  3TJB A;  3S9F A;  4TR1 B;  1GUK A;  1K0B A;  3CSI A;  5ECN B;  5HFK A;  1M9B A;  1U6T A;  3RDW A;  1KBN A;  1XOA A;  2R2J A;  3D6I A;  2FGX A;  1HYU A;  5DJM A;  3LG6 A;  2J9H A;  2H0I A;  4ZBB A;  2F3M A;  5DAK B;  4JBB A;  5FHI A;  3TRQ A;  4TN8 A;  1GTU A;  2LNT A;  11GS A;  2H1B A;  1EGR A;  3PH9 A;  2IIY A;  4POK A;  4IW9 A;  3TRX A;  17GS A;  4X43 A;  5IIZ A;  4TVE A;  1JZD A;  4XS1 A;  3VPT A;  4L0U A;  4NAX A;  2LJR A;  5INY A;  1Z7P A;  3FZ5 A;  1MTC A;  3IR4 A;  1HNA A;  3CSH A;  3MDK A;  1JZO A;  1XVQ A;  3QMX A;  5D9V A;  1DSB A;  3VI5 A;  4ZBA A;  3P8W A;  1TI3 A;  2K9F A;  2OKA A;  3FR6 A;  2GZP A;  3PR8 A;  1G7D A;  12GS A;  4G2E A;  2FCH A;  2LS5 A;  3GKX A;  2ZCT A;  3G7I A;  3F3Q A;  1WMJ A;  2WCI A;  2ES7 A;  3O76 A;  4KW6 A;  1THX A;  1VF4 A;  5F8B A;  2ZUP A;  3ZIT A;  3UVH A;  4BA7 A;  1O6J A;  1FVJ A;  2OE3 A;  4EXJ A;  3BCK A;  2YWI A;  4GWR A;  4MZW A;  1S3D A;  1K0O A;  2HE3 A;  5H5S A;  1URM A;  2VUP A;  2X8G A;  1A0F A;  2RM6 A;  2VCT A;  4HJM A;  2YJ7 A;  4X1U A;  4WXT A;  1EP8 A;  9GSS A;  2N5A A;  3L9S A;  3ZL5 A;  4POB A;  5F0G A;  3NZN A;  4MMM A;  2A2S A;  2L4C A;  2C80 A;  1FO5 A;  5KN3 A;  3HXS A;  3N5O A;  1X9S B;  4N10 A;  5B8B A;  2DJ0 A;  3EE2 A;  2L4Q A;  2IJY A;  4JR6 A;  2VL9 A;  1PL1 A;  3UMA A;  1K0A A;  5D93 A;  1NW2 A;  1NM3 A;  2DMM A;  4PUA A;  3GKK A;  2PPT A;  2JAC A;  3CBU A;  1TW9 A;  1WIK A;  3LYK A;  2LST A;  1TKD B;  4GXZ A;  2GVP A;  3UAR A;  1XWB A;  3QAG A;  4WET A;  1T3B A;  3ZFL A;  1SJI A;  3H4K A;  2IMK A;  5LD0 A;  2JSZ A;  4LL4 B;  4F2I A;  2DIY A;  5JCW A;  3FZ4 A;  1K0N A;  4G9H A;  1U88 A;  4N30 A;  1N2A A;  3RAZ A;  5DCH A;  2VLT A;  1Q98 A;  1ZCP A;  3LJR A;  3QFA C;  2NVL A;  1KTE A;  1PX6 A;  1XW5 A;  2QKE A;  4YQV A;  4GRF A;  4Q5R A;  4V2L A;  2FD3 A;  2IMI A;  2MBT A;  2R3X A;  2IL3 A;  5JCU A;  1XBS A;  3LSZ A;  3FEU A;  1O85 A;  2LQO A;  5GZZ B;  3CMI A;  5F05 A;  1WE0 A;  2DBC A;  5C04 A;  2X8C A;  3GST A;  2OAD A;  5JWO B;  1ERV A;  5J5N A;  4I5Q A;  3TUE A;  5J3R A;  3M1G A;  1PL2 A;  1M2A A;  4GTU A;  4MJB A;  3F6F A;  5D8I A;  1Z6N A;  3WD6 A;  1ZZY A;  3ZRD A;  4JR4 A;  3VWV A;  1B4P A;  3CTG A;  2PN8 A;  3HJO A;  1YF0 A;  4ECJ A;  2WB9 A;  5DBQ A;  4KCA A;  4HJ2 A;  1WP0 A;  4O92 A;  1X5C A;  2JSY A;  2V2G A;  1ZMA A;  1HNC A;  2NTO A;  1SD8 A;  1KNG A;  2H76 A;  4HZ4 A;  2XPE A;  1SL0 B;  4LA1 A;  1XWG A;  4POM A;  2RII A;  3L9U A;  4HDE A;  3ERG A;  2LRT A;  1ERT A;  5B7C A;  4F9Z A;  2PVO C;  1WPI A;  1Z9H A;  1DBY A;  2PVQ A;  2BMX A;  2H01 A;  2YP6 A;  4KH7 A;  1PKZ A;  2WFC A;  1FVK A;  3MSZ A;  2V6K A;  2D2Z A;  5G1L A;  1FHE A;  2REM A;  1A0R P;  1GWC A;  2WZ9 A;  1VGL A;  3GKM A;  2M46 A;  5FT3 A;  3H1N A;  1TRW A;  2L6D A;  2IPA A;  2P5R A;  1VF2 A;  3RBT A;  4I6X A;  3A2X A;  2LRC A;  2VOC A;  8GSS A;  2YWN A;  3L0H A;  1C72 A;  4ULX A;  2DJ1 A;  3HJP A;  3QPM A;  5G1K A;  3TJF A;  4KDY A;  4MF5 A;  1K3Y A;  3M0F A;  2X99 A;  1K0D A;  4ISD A;  2BTO T;  2MYG A;  4EUY A;  1PD2 1;  4CDO A;  1ZL9 A;  4K0G A;  1EEM A;  2Z9S A;  2KP1 A;  4WKW A;  3PIN A;  4J2F A;  4KX4 A;  4OWY A;  3TJJ A;  3DD3 A;  3GKN A;  3UAP A;  2VAF A;  2GQL A;  3F4T A;  2YPM A;  7GSS A;  1SYX A;  3GUS A;  4OCF A;  4PQH A;  3D22 A;  5EVO A;  2B5X A;  2A4V A;  5CRD A;  2VLU A;  4NV5 A;  4HI7 A;  2HLS A;  2XC2 A;  4H86 A;  2KLX A;  4CW9 A;  5ECM B;  2DJ3 A;  1QGV A;  5ELG A;  4IKH A;  1YEP A;  2LQQ A;  3GHA A;  4O5R A;  3FK8 A;  1G7O A;  3BOA A;  2XPD A;  1M9A A;  5G5F A;  2DJ2 A;  1LJR A;  4DEJ A;  5J9C A;  2FWG A;  1V40 A;  2OBK A;  3SBC A;  5ABR A;  1ST9 A;  2DSA A;  2HRF A;  1OKT A;  4YH2 A;  3MAK A;  3I9V 2;  2E0Q A;  4ZL7 A;  2YCD A;  2GST A;  2XBQ A;  3I69 A;  3TJK A;  4IJ3 A;  4NV2 A;  1CQH A;  4JRR A;  1TK0 B;  3ME8 A;  1LU4 A;  2CX4 A;  1VRS D;  3KH9 A;  2B3S A;  2LJA A;  1BQ7 A;  2JZR A;  5JWR B;  2AAW A;  1GLQ A;  3TGZ A;  1G6Y A;  4IN0 A;  4O7H A;  5KN1 A;  4BWS A;  1JFU A;  2R37 A;  4ECC A;  2RLI A;  5FWG A;  2ON5 A;  3ZVJ A;  2OJL A;  2C3Q A;  3E3E A;  1OC3 A;  1JZW A;  4ILF A;  1YEX A;  4WBR D;  4FH8 A;  2JL4 A;  3GIX A;  2B7J A;  3LGC A;  3TKS E;  3TKR A;  4WF4 A;  4MH3 A;  2MMN A;  2FA8 A;  4HQZ A;  5COH A;  1JLW A;  3KTB A;  2H6Z A;  5H5R A;  3KGK A;  3CXG A;  1XCC A;  2O7K A;  3U6V A;  4ECB A;  1GLP A;  5AIX A;  2LRN A;  1OC9 B;  5G5E A;  5DJL A;  4L5L A;  3VWX A;  4L8E A;  10GS A;  3J7Y k;  4AJ7 A;  1H75 A;  1SKS B;  3F4S A;  2B5Y A;  3DML A;  3EU4 A;  2CT6 A;  3KD0 A;  2KP2 A;  4Q5N A;  1UA5 A;  4AF2 A;  1OC9 A;  3IOS A;  2X8H A;  2L6C A;  2PBJ A;  4XHM A;  2MMA A;  2YAN A;  4MF6 A;  2VM1 A;  5IMD A;  1GL8 A;  4TXO B;  5AIS A;  2CVB A;  4TR3 A;  2WUL A;  3KMN A;  3APO A;  2RUF A;  3LEF A;  3ZFB A;  2IFQ B;  1IYH A;  2H73 A;  4OO5 A;  4TR1 A;  1YJ6 A;  6GST A;  4BVY A;  2A2R A;  18GS A;  3US3 A;  2YJH A;  1ML6 A;  1U3I A;  3C73 A;  2I81 A;  1G0T A;  2VLV A;  2TIR A;  2N5B A;  4KSM A;  2M80 A;  4F03 A;  2IFQ A;  2FY6 A;  5HQP A;  13GS A;  2O8V B;  3ZIJ A;  5GST A;  1YKA A;  2B5E A;  3KIJ A;  1QXH A;  5DAK A;  3F8U A;  1X0R A;  3ME7 A;  5CYY A;  2HI7 A;  5A4U A;  4HOJ A;  4E8E A;  2IMF A;  5ELA A;  2VL3 A;  4EKZ A;  2PWJ A;  2R4V A;  2AUV A;  3GN3 A;  2MMO A;  1MDI A;  1A2M A;  1G6W A;  2TRX A;  4ID0 A;  1ON4 A;  3ZTL A;  1B8X A;  2MZC A;  5AIV A;  3BJ5 A;  14GS A;  3ZLP A;  1OAZ A;  3D21 A;  1MD4 A;  3IC4 A;  4D73 B;  3GL5 A;  1K0M A;  1T4Y A;  2AHE A;  4HS1 A;  1E2Y A;  2FWH A;  2H66 A;  2GGT A;  1XIY A;  4MZB A;  1TTZ A;  3QR6 A;  1N8J A;  1EWX A;  5DQY A;  4GLT A;  1ZYE A;  2E7P A;  6GSV A;  3F0I A;  1EZK A;  4DSR A;  3EVI A;  4HU9 A;  1TK8 B;  4DVC A;  2CQ9 A;  1V98 A;  2VCZ A;  1AQV A;  2EIQ A;  1TOF A;  3I6A A;  2C3T A;  2NPB A;  3FYG A;  2GDR A;  2HZE B;  4Q5F A;  4NXI A;  3VLN A;  5ECS A;  1TRS A;  1SU9 A;  6GSS A;  3ZML A;  1GRX A;  5IOW A;  2PER A;  4XIH A;  5ECR B;  1GP1 A;  1QFN A;  3UBL A;  4G10 A;  1V57 A;  3HHV A;  3KXO A;  4K7O A;  2KHP A;  3CRT A;  4E8H A;  2OBI A;  1I5G A;  4KDX A;  4ZB9 A;  1X9M B;  4BVX A;  3TKP A;  3M9K A;  3HYP A;  4EL1 A;  4NHZ A;  2AV4 A;  1BG5 A;  4WBJ A;  1AIU A;  4ML6 A;  3D0Z A;  2H74 A;  4YQU A;  1MDK A;  4LMV A;  1PRX A;  3QOU A;  4FYC A;  4YAV A;  4MF7 A;  4PQI A;  2VIM A;  2IN3 A;  5D73 A;  1TRV A;  1O8X A;  2FHE A;  4EC0 A;  1DUG A;  5E4W A;  3G7Y A;  3GA4 A;  3M8N A;  4GF0 A;  6GSW A;  4K0N A;  4F0B A;  2M72 A;  3FKF A;  1Q4J A;  2H6X A;  1TU7 A;  4XCS A;  1DE2 A;  2QC7 A;  1K3O A;  4N0V A;  4CHS A;  2JU5 A;  3TKS C;  2AJQ B;  5F06 A;  2I9H A;  1H4O A;  3H8Q A;  2C0F A;  1SL1 B;  4QL7 A;  2GQK A;  4K7I A;  3HVV A;  4GSN A;  1M2D A;  1M7T A;  4BPY A;  2KOK A;  2WJU A;  2GQM A;  1NHO A;  4OFM A;  1GUM A; 
#chains in the Genus database with same CATH topology
 3K8N A;  4KCE A;  3HZ8 A;  3UL3 A;  1XW6 A;  4MK3 A;  4EDY A;  1FAA A;  1ERW A;  4HZ2 A;  1LBK A;  3WYW A;  1W4V A;  4RI6 A;  1F2E A;  3NIV A;  1SK0 A;  3HCZ A;  2M66 A;  3HKR A;  3MNG A;  1B9Y C;  3HJM A;  3IDV A;  2GTU A;  3M9J A;  2VCW A;  3VUR A;  1PN9 A;  4IHU A;  3WGX A;  2H30 A;  2DIZ A;  2H70 A;  3BBY A;  3DGQ A;  1M2B A;  1O73 A;  4NHW A;  1YKC A;  4RQR A;  2PMT A;  1ERU A;  3KH7 A;  1M99 A;  2YZH A;  5HR3 A;  3GRX A;  5CAX A;  3GV1 A;  4XS4 B;  6GSU A;  4TW5 A;  3ZYW A;  2O89 A;  1AW9 A;  1WWJ A;  2G2Q A;  4MLY A;  4KE3 A;  3VI7 A;  1XXU A;  2VL2 C;  1CQG A;  1ILO A;  2F8A A;  3DWV A;  2YV7 A;  4WR4 A;  1OE7 A;  2BJX A;  4XS4 A;  4Z2T A;  3EYT A;  4JZQ A;  1OC8 A;  4KDU A;  4ZIL A;  3TKS A;  3JCM L;  1GUH A;  3CTF A;  2OE1 A;  4PNF A;  4MZC A;  1ZYN A;  4KA0 A;  2I3Y A;  2GLR A;  3UVT A;  2I4A A;  3W8J A;  1DE1 A;  5H5Q A;  19GS A;  2HZF A;  1SJ6 A;  1B4Q A;  2HFD A;  1SK2 A;  1S3C A;  3KTL A;  1R7H A;  1V58 A;  1BJX A;  4KUN A;  4TRX A;  1R26 A;  4IQA A;  4EIP A;  1PQN A;  3P2A A;  5GAP D;  4YQM A;  1AC1 A;  5C00 A;  4I8B A;  4K8M A;  1F3A A;  5CRH A;  1X5D A;  3GUR A;  5HFG A;  3O6T A;  1EEJ A;  1K3L A;  3L9V A;  3MWH A;  5ECH B;  2B6M A;  1ZYP A;  1GSY A;  1PGT A;  1SK1 A;  2HT9 A;  5CRW A;  1GUL A;  4ECI A;  3CSJ A;  5KOX A;  1BX9 A;  4MJA A;  3C8E A;  2GSQ A;  5KN0 A;  4OO4 A;  2C4J A;  2L5O A;  4KAE A;  3LQ7 A;  4L0W A;  3WT1 A;  1JHB A;  5HFI A;  3EMP A;  1EV4 A;  4PXO A;  5DAL B;  3KP8 A;  4MH2 A;  2CAI A;  3FW2 A;  1AQX A;  3AY8 A;  2VCV A;  4RQX A;  1BAY A;  2VL2 A;  5IO0 A;  3G9B A;  1F6M C;  1MD3 A;  1YY7 A;  2DKH A;  2C3N A;  5DAL A;  3DVW A;  1TK5 B;  4IBP A;  1AAZ A;  2B1L A;  2P0G A;  1A24 A;  4I2U A;  2HRN A;  1ZGN A;  4AGS A;  1GSD A;  5EPF A;  2YWM A;  1T4Z A;  1FOV A;  5D9W A;  3O3T A;  4KGI A;  5BMU A;  5IM9 A;  2H1G A;  2DML A;  3EPT A;  2X49 A;  4G19 A;  1S3R A;  5DQS A;  5ENU A;  2HSY A;  4ZB6 A;  1Z5Y E;  2AB6 A;  4XRD A;  1V2A A;  2P31 A;  3SWL A;  4ZXG A;  1XWK A;  1G7E A;  1AUC A;  4N0Z A;  4FYU A;  2OA7 A;  2QA1 A;  1SKW B;  16GS A;  2CX3 A;  4MJE A;  1XVW A;  1YQ1 A;  4KSO A;  1X5E A;  2FLS A;  1T1V A;  1Y6E A;  3ED3 A;  3IK7 A;  4OCE A;  5DVB A;  3ZZX A;  1GNW A;  1RQM A;  5HR1 A;  5CNW A;  2F51 A;  2O87 A;  3DIE A;  1UN2 A;  1SD9 A;  5IO2 A;  1QMV A;  1UVZ A;  3FZ9 A;  4OMV A;  1Z7R A;  4HEA 2;  2H6Y A;  3QFB C;  3EIN A;  2VCQ A;  2GSR A;  4ZL9 A;  5IMF A;  1Z3E A;  3RHC A;  4LLR A;  4YKG A;  2OAC A;  4WEY A;  1YF1 A;  2AYT A;  3F3R A;  4WF5 A;  1SJZ A;  3PGT A;  5A5K A;  2VD0 A;  5IPG A;  3ERW A;  3OR5 A;  3C71 A;  5ID2 B;  4J57 E;  1JLV A;  2O85 A;  3IA1 A;  4PGT A;  4XRA A;  2OE0 A;  3KMO A;  5IMV A;  3F4R A;  2QGV A;  1NHY A;  1E6B A;  3GH9 A;  2K8S A;  1USB A;  1JZR A;  5J41 A;  3UJ1 A;  2ALB A;  3QDN A;  2VD1 A;  4MJC A;  3Q18 A;  3F9U A;  4N11 A;  2C0E A;  3TCO A;  2GT5 A;  3IHG A;  3HVS A;  2JAD A;  3G7J A;  4FYB A;  1F3B A;  1TDI A;  3HDC A;  3GH6 A;  4NPB A;  2LUS A;  2XBI A;  4GST A;  4TXO A;  3RPN A;  2K18 A;  4QL9 A;  4ML1 A;  3WGD A;  3I43 A;  3FHK A;  5KEJ A;  2C8U A;  1F37 A;  1SL2 B;  2LJK A;  4GSS A;  2EIO A;  1S3A A;  5HR2 A;  4K7N A;  1UC7 A;  4K9Z A;  1GTA A;  2B1K A;  3CRU A;  2DC5 A;  1OKD A;  2V32 A;  4K5R A;  4JU5 A;  3GX0 A;  2E2M A;  3IK9 A;  3IPZ A;  5B6N A;  1FB0 A;  1U3A A;  2EC4 A;  5CP1 A;  4V2N A;  2N5F A;  3M3M A;  3Q74 A;  1Y25 A;  4BL7 A;  2YOI A;  4TXV A;  3A3T A;  2YWO A;  3HZ4 A;  2CV4 A;  1I9D A;  3VFI A;  3LWA A;  4KND A;  4ZIJ A;  3NOF A;  5ECK B;  1O8W A;  3DVX A;  1FG4 A;  4ZBD A;  3HVX A;  4TR0 A;  1VF3 A;  1HNB A;  5L71 A;  1PMT A;  1O81 A;  3TB2 A;  1SKR B;  4D73 A;  1T7P B;  5ECP B;  4EO3 A;  3TRP A;  2H1A A;  4I2T A;  5B6M A;  4QQ7 A;  1RK4 A;  2TRC P;  3EUR A;  1HD2 A;  5LNK e;  3VPQ A;  4F0C A;  4G0K A;  3DRN A;  2NDO A;  4IEL A;  3GX8 A;  5ECQ B;  5D9T A;  4O32 A;  3TOT A;  4LMW A;  3DEX A;  4G0L A;  1GTI A;  4L5O A;  2QA2 A;  4RI7 A;  3KP9 A;  4MPF A;  1A2J A;  3HD5 A;  5IOX A;  5KOW A;  5G31 A;  2HZE A;  3QD9 A;  1QUW A;  3UBK A;  2GSS A;  3ZMK A;  1R4W A;  4TOP A;  4WR5 A;  4PUF C;  2V1M A;  4ZB8 A;  3D4M A;  4TKY A;  1FB6 A;  2DLX A;  1XOB A;  2VO4 A;  3LOR A;  2F9S A;  5D96 A;  3ERF A;  1J0F A;  3UOM A;  4LL1 B;  5ECL B;  4XTS A;  1HQO A;  5DCG A;  1XPV A;  2A4H A;  1PFO A;  1AQW A;  5GAN D;  3IAS 2;  2LKU A;  20GS A;  4OD7 A;  2IWT A;  1YDK A;  4KF9 A;  4PX1 A;  5D9X A;  3KEB A;  2CZ3 A;  5CRE A;  2LV3 A;  3KM6 A;  5E59 A;  2DJK A;  4OFT A;  2H0G A;  3GSS A;  3KZQ A;  1EOH A;  4Q5Q A;  1BED A;  3D4T A;  4MPG A;  3W8S A;  3FR9 A;  2MMZ A;  1SEN A;  1QK8 A;  3PPU A;  1K0C A;  3IHQ A;  4KB3 A;  1GSE A;  4HU7 A;  2CA8 A;  1U87 A;  3LXT A;  2PUK C;  3LFL A;  4IVF A;  3W6G A;  4ACS A;  2L59 A;  4CY6 A;  2FWF A;  3IRA A;  2ZNM A;  1OE8 A;  2PGT A;  2RUE A;  3H79 A;  3H93 A;  3L78 A;  5GSS A;  2HNL A;  4MA9 A;  4K2D A;  1AXD A;  1ACV A;  5F07 A;  3Q6O A;  5G30 A;  4MAB A;  5DDL A;  3EU3 A;  2YN1 A;  4TR4 A;  2WGR A;  4ZL8 A;  2CVD A;  1PX7 A;  2R5G A;  4YAP A;  2LTK A;  3FY7 A;  3A5I A;  1IYI A;  3R2Q A;  1VF1 A;  3E0U A;  1A2L A;  2VCX A;  5EL8 A;  3UIW A;  1GNE A;  1Z6M A;  2LNS A;  3ZVJ D;  2CAQ A;  4GQC A;  1ZOF A;  4EF0 A;  3DKS A;  1R5A A;  2ON7 A;  1J08 A;  4BWQ A;  6GSX A;  2WRT A;  2H0H A;  2WDU A;  4AJ8 A;  3BCI A;  4YKF A;  3IAM 2;  3E9J B;  3RPP A;  2HYX A;  1WJK A;  2IME A;  2PU9 C;  2J23 A;  5B8A A;  2QSI A;  2CZ2 A;  3A2V A;  4POL A;  1R5P A;  1XW9 A;  1T8E B;  4JED A;  4V2M A;  3LYP A;  5ECI B;  3APQ A;  1GSF A;  1TJD A;  3CQF A;  5ECO B;  4F82 A;  3RHB A;  2GS3 A;  3A2W A;  3ZIV A;  3EMX A;  2KUC A;  1GSU A;  2K8V A;  5J9B A;  1GSS A;  3MYD A;  4BIK A;  2FWE A;  1PA3 A;  3VWW A;  5HR0 A;  3GTU B;  1KEB A;  1THO A;  4USS A;  4EE0 A;  3C1R A;  4RUV A;  3FRC A;  1SYR A;  5JWQ B;  2F8F A;  1EV9 A;  1A23 A;  4MP4 A;  3HA9 A;  2B7K A;  4IP1 A;  1O7U A;  3GTU A;  3TJG A;  3IXR A;  1WRY A;  3FR3 A;  1TI1 A;  3ZRE A;  2GZY A;  3IV4 A;  3V1W A;  1FW1 A;  4GQF A;  5CO3 A;  1ABA A;  4K1F A;  3Q19 A;  2R6K A;  2C0D A;  2EIR A;  3TOU A;  1TXX A;  3J7Y b;  3QAV A;  3IE3 A;  2NBS A;  2LEG A;  4DSQ A;  1XWA A;  1TP9 A;  2VM2 A;  3KJY A;  1MEK A;  3A5W A;  1M0U A;  1OVN A;  4V1A g;  1B48 A;  4Z7X A;  1X9W B;  4X4J A;  5J4U A;  1QQ2 A;  2YZU A;  1ZYQ B;  3GL3 A;  3N9J A;  3VWU A;  4IGJ A;  4EDZ A;  4OFN A;  5A4V A;  4FIW A;  1GH2 A;  5A4W A;  5AGY A;  3KCM A;  1XFL A;  2H71 A;  2V6O A;  2JZS A;  1TU8 A;  5IMZ A;  5IMA A;  1A8Y A;  3F63 A;  4K6X A;  3TDG A;  4PNG A;  2WS2 A;  3UEM A;  2G0F A;  4IP6 A;  2JZT A;  1F9M A;  3GYK A;  1GTB A;  2E2G A;  2YV9 A;  5JCG A;  5EY6 A;  5AN1 A;  2H72 A;  4NWY A;  3IBH A;  3P90 A;  3VK9 A;  4DSS B;  1NSW A;  2X64 A;  3GNJ A;  1J9B A;  22GS A;  2DJJ A;  2XHF A;  4JE1 A;  2H8L A;  2H19 A;  4X0X A;  6GSY A;  1MDJ A;  2FUG 2;  3CYN A;  4V1A p;  2L5L A;  1XZO A;  5CRG A;  1GSQ A;  2FA4 A;  4DSS A;  3TKQ A;  1EOG A;  5IMC A;  4XS6 A;  1EGO A;  2H75 A;  3EWL A;  5IPH A;  1A8L A;  2CVK A;  3F6D A;  3C1S A;  5IQY A;  2K6V A;  3APS A;  4HUA A;  1XWC A;  1PKW A;  2GZZ A;  2HXK A;  4GCI A;  4FO5 A;  4MDC A;  3P7X A;  4PQ1 A;  4IS0 A;  1PSQ A;  3BD2 A;  2I1U A;  2HSH A;  3GFK A;  1TRU A;  2C1Y A;  2C0G A;  4EVM A;  4NMU A;  5KN2 A;  2V41 A;  3ISO A;  2IMD A;  1WOU A;  1V9W A;  3LXZ A;  4I97 A;  1W89 A;  3C7M A;  3QAW A;  1B9X C;  3D5J A;  1EP7 A;  2R0P A;  1OYJ A;  5G2Z A;  4P3Y B;  3HY2 A;  2FNO A;  3U5R E;  2MBS A;  5LCZ A;  4MCU A;  3QCP A;  5ID2 A;  3WGE A;  4IQ1 A;  4HQS A;  1BYE A;  4AJ6 A;  4J56 E;  2RM5 A;  2GT6 A;  3EC3 A;  1RW1 A;  1YZX A;  2L57 A;  2H1D A;  3DXB A;  2YNX A;  4PUR A;  3GMF A;  3FZA A;  4IJI A;  1T00 A;  3WT2 A;  3L4N A;  3DYR A;  2P5Q A;  3TJB A;  3S9F A;  4TR1 B;  1GUK A;  4BVY B;  1K0B A;  3CSI A;  5ECN B;  5HFK A;  1M9B A;  1U6T A;  3RDW A;  1KBN A;  1XOA A;  2R2J A;  3D6I A;  2FGX A;  1HYU A;  5DJM A;  3LG6 A;  2J9H A;  2H0I A;  4ZBB A;  2F3M A;  5DAK B;  4JBB A;  5FHI A;  3TRQ A;  4TN8 A;  1GTU A;  2LNT A;  11GS A;  2H1B A;  1EGR A;  3PH9 A;  2IIY A;  4POK A;  4IW9 A;  3TRX A;  17GS A;  4X43 A;  5IIZ A;  4TVE A;  1JZD A;  4XS1 A;  3VPT A;  4L0U A;  4NAX A;  2LJR A;  5INY A;  1Z7P A;  4FQU A;  3FZ5 A;  1MTC A;  3IR4 A;  1HNA A;  3CSH A;  3MDK A;  1JZO A;  1XVQ A;  3QMX A;  5D9V A;  1DSB A;  3VI5 A;  4ZBA A;  3P8W A;  1TI3 A;  2K9F A;  2OKA A;  3FR6 A;  2GZP A;  3PR8 A;  1G7D A;  12GS A;  4G2E A;  2FCH A;  2LS5 A;  3GKX A;  2ZCT A;  3G7I A;  3F3Q A;  1FOH A;  1WMJ A;  2WCI A;  2ES7 A;  3HVN A;  3O76 A;  4KW6 A;  1THX A;  1VF4 A;  5F8B A;  2ZUP A;  3ZIT A;  3UVH A;  4BA7 A;  1O6J A;  1FVJ A;  2OE3 A;  4EXJ A;  3BCK A;  2YWI A;  4GWR A;  4MZW A;  1S3D A;  1K0O A;  2HE3 A;  5H5S A;  1URM A;  2VUP A;  2X8G A;  1A0F A;  2RM6 A;  2VCT A;  4HJM A;  2YJ7 A;  4X1U A;  4WXT A;  1EP8 A;  9GSS A;  2N5A A;  2DKI A;  3L9S A;  3ZL5 A;  4POB A;  5F0G A;  3NZN A;  4MMM A;  2A2S A;  2L4C A;  2C80 A;  1FO5 A;  5KN3 A;  3HXS A;  3N5O A;  1X9S B;  4N10 A;  5B8B A;  2DJ0 A;  3EE2 A;  4K5S A;  2L4Q A;  2IJY A;  4JR6 A;  2VL9 A;  1PL1 A;  3UMA A;  1K0A A;  5D93 A;  1NW2 A;  1NM3 A;  2DMM A;  4PUA A;  3GKK A;  2PPT A;  2JAC A;  3CBU A;  1TW9 A;  1WIK A;  3LYK A;  2LST A;  1TKD B;  4GXZ A;  2GVP A;  3UAR A;  1XWB A;  3QAG A;  4WET A;  1T3B A;  3ZFL A;  1SJI A;  3H4K A;  2IMK A;  5LD0 A;  2JSZ A;  4LL4 B;  4F2I A;  2DIY A;  5JCW A;  3FZ4 A;  1K0N A;  4G9H A;  1U88 A;  2X4A A;  4N30 A;  1N2A A;  4ICY A;  3RAZ A;  5DCH A;  2VLT A;  1Q98 A;  1ZCP A;  3LJR A;  3QFA C;  2NVL A;  1KTE A;  1PX6 A;  1XW5 A;  2QKE A;  4YQV A;  4GRF A;  4Q5R A;  4V2L A;  2FD3 A;  2IMI A;  2MBT A;  2R3X A;  2IL3 A;  5JCU A;  1XBS A;  3LSZ A;  3FEU A;  1O85 A;  2HRK A;  2LQO A;  5GZZ B;  3CMI A;  5F05 A;  1WE0 A;  2DBC A;  5C04 A;  2X8C A;  3GST A;  2OAD A;  5JWO B;  1ERV A;  5J5N A;  4I5Q A;  3TUE A;  5J3R A;  3M1G A;  1PL2 A;  1M2A A;  4GTU A;  4MJB A;  3F6F A;  5D8I A;  1Z6N A;  3WD6 A;  1ZZY A;  3ZRD A;  4JR4 A;  3VWV A;  1B4P A;  3CTG A;  2PN8 A;  3HJO A;  1YF0 A;  4ECJ A;  2WB9 A;  5DBQ A;  4KCA A;  4HJ2 A;  1M3J A;  1WP0 A;  4O92 A;  1X5C A;  2JSY A;  2V2G A;  1ZMA A;  1HNC A;  2NTO A;  1SD8 A;  1KNG A;  2H76 A;  4HZ4 A;  2XPE A;  1SL0 B;  4LA1 A;  1XWG A;  4POM A;  2RII A;  3L9U A;  4HDE A;  3ERG A;  2LRT A;  1ERT A;  5B7C A;  4F9Z A;  2PVO C;  1WPI A;  1Z9H A;  1DBY A;  2PVQ A;  2BMX A;  2H01 A;  2YP6 A;  4KH7 A;  1PKZ A;  2R0C A;  2WFC A;  1FVK A;  3MSZ A;  2V6K A;  2D2Z A;  5G1L A;  1FHE A;  2REM A;  1A0R P;  1GWC A;  2WZ9 A;  1VGL A;  3GKM A;  2M46 A;  5FT3 A;  3H1N A;  1TRW A;  2L6D A;  2IPA A;  2P5R A;  1VF2 A;  3RBT A;  4I6X A;  3A2X A;  2LRC A;  2VOC A;  8GSS A;  2YWN A;  3L0H A;  1C72 A;  4ULX A;  2HRA A;  2DJ1 A;  3HJP A;  3QPM A;  5G1K A;  3TJF A;  4KDY A;  4MF5 A;  1K3Y A;  3M0F A;  2X99 A;  1K0D A;  4ISD A;  2BTO T;  2MYG A;  4EUY A;  5BRT A;  1PD2 1;  4CDO A;  1ZL9 A;  4K0G A;  1M3I A;  1EEM A;  2Z9S A;  2KP1 A;  4WKW A;  3PIN A;  4J2F A;  4KX4 A;  4OWY A;  3TJJ A;  3DD3 A;  3GKN A;  3UAP A;  2VAF A;  2GQL A;  3F4T A;  2YPM A;  7GSS A;  1SYX A;  3GUS A;  4OCF A;  4PQH A;  3D22 A;  5EVO A;  2B5X A;  2A4V A;  5CRD A;  2VLU A;  4NV5 A;  4HI7 A;  2HLS A;  2XC2 A;  4H86 A;  2KLX A;  3LW9 A;  4CW9 A;  5ECM B;  2DJ3 A;  1QGV A;  5ELG A;  4IKH A;  1YEP A;  2LQQ A;  4MNN A;  3GHA A;  3IC8 A;  4O5R A;  3FK8 A;  1G7O A;  3BOA A;  2XPD A;  1M9A A;  5G5F A;  2DJ2 A;  1LJR A;  4DEJ A;  5J9C A;  2FWG A;  1V40 A;  2OBK A;  3SBC A;  5ABR A;  1ST9 A;  2DSA A;  2HRF A;  1OKT A;  4YH2 A;  3MAK A;  3I9V 2;  2E0Q A;  4ZL7 A;  2YCD A;  2GST A;  2XBQ A;  3I69 A;  3TJK A;  4IJ3 A;  4NV2 A;  4G0I A;  1CQH A;  4JRR A;  1TK0 B;  3ME8 A;  1LU4 A;  2CX4 A;  1VRS D;  3KH9 A;  2B3S A;  2LJA A;  1BQ7 A;  2JZR A;  5JWR B;  2AAW A;  1GLQ A;  3TGZ A;  1G6Y A;  4IN0 A;  4O7H A;  5KN1 A;  4BWS A;  1JFU A;  2R37 A;  4O5U A;  4ECC A;  2RLI A;  5FWG A;  2ON5 A;  3ZVJ A;  2OJL A;  2C3Q A;  3E3E A;  1OC3 A;  1JZW A;  4ILF A;  2R0G A;  1YEX A;  4WBR D;  4FH8 A;  2JL4 A;  3GIX A;  2B7J A;  3LGC A;  3TKS E;  2UZ8 A;  3TKR A;  4WF4 A;  4MH3 A;  2MMN A;  2FA8 A;  4HQZ A;  5COH A;  1JLW A;  3KTB A;  2H6Z A;  5H5R A;  3KGK A;  3CXG A;  2A2P A;  1XCC A;  2O7K A;  3U6V A;  4ECB A;  1GLP A;  5AIX A;  2LRN A;  1OC9 B;  5G5E A;  5DJL A;  4L5L A;  3VWX A;  4L8E A;  10GS A;  3J7Y k;  4AJ7 A;  1H75 A;  1SKS B;  3F4S A;  2B5Y A;  3DML A;  3EU4 A;  2CT6 A;  3KD0 A;  2KP2 A;  4Q5N A;  1UA5 A;  4AF2 A;  1OC9 A;  3IOS A;  4K2X A;  2X8H A;  2L6C A;  2PBJ A;  4XHM A;  2MMA A;  2YAN A;  4MF6 A;  2VM1 A;  5IMD A;  3R3E A;  1GL8 A;  4TXO B;  5AIS A;  2CVB A;  4TR3 A;  2WUL A;  3KMN A;  3APO A;  2RUF A;  3LEF A;  3ZFB A;  2IFQ B;  1IYH A;  2H73 A;  4OO5 A;  4TR1 A;  1YJ6 A;  6GST A;  4BVY A;  2A2R A;  18GS A;  3US3 A;  2YJH A;  1ML6 A;  1U3I A;  3C73 A;  3FMW A;  2I81 A;  1G0T A;  2VLV A;  2TIR A;  2N5B A;  4KSM A;  2M80 A;  4F03 A;  2IFQ A;  2FY6 A;  5HQP A;  13GS A;  2O8V B;  3ZIJ A;  5GST A;  1PN0 A;  1YKA A;  2B5E A;  3KIJ A;  1QXH A;  5DAK A;  3F8U A;  1X0R A;  3ME7 A;  5CYY A;  2HI7 A;  5A4U A;  4HOJ A;  4E8E A;  2IMF A;  5ELA A;  2VL3 A;  4CY8 A;  4EKZ A;  2PWJ A;  2R4V A;  4BL7 B;  2AUV A;  3GN3 A;  2MMO A;  1MDI A;  1A2M A;  1G6W A;  2TRX A;  4ID0 A;  1ON4 A;  3ZTL A;  1B8X A;  2MZC A;  5AIV A;  4Z2R A;  3BJ5 A;  14GS A;  3ZLP A;  1OAZ A;  3D21 A;  1MD4 A;  3IC4 A;  4D73 B;  3GL5 A;  1K0M A;  1T4Y A;  2AHE A;  4HS1 A;  1E2Y A;  2FWH A;  2H66 A;  2GGT A;  1XIY A;  4MZB A;  1TTZ A;  3QR6 A;  1N8J A;  1EWX A;  5DQY A;  4GLT A;  1ZYE A;  2E7P A;  6GSV A;  3F0I A;  1EZK A;  4DSR A;  3EVI A;  4HU9 A;  1TK8 B;  4DVC A;  2CQ9 A;  1V98 A;  2VCZ A;  1AQV A;  4HSC X;  2EIQ A;  1TOF A;  3I6A A;  2C3T A;  2NPB A;  3FYG A;  2GDR A;  2HZE B;  4Q5F A;  4Z2U A;  4NXI A;  3VLN A;  5ECS A;  1TRS A;  1SU9 A;  6GSS A;  3ZML A;  1GRX A;  5IOW A;  2PER A;  4XIH A;  5ECR B;  4BVX B;  1GP1 A;  1QFN A;  3UBL A;  3MIX A;  4G10 A;  1V57 A;  3HHV A;  3KXO A;  4K7O A;  4O5Q A;  2KHP A;  3CRT A;  4E8H A;  2OBI A;  1I5G A;  4KDX A;  4ZB9 A;  1X9M B;  4BVX A;  3TKP A;  3M9K A;  3HYP A;  4EL1 A;  4NHZ A;  2AV4 A;  1BG5 A;  4WBJ A;  1AIU A;  4EIQ A;  4ML6 A;  3D0Z A;  2H74 A;  4YQU A;  1MDK A;  4LMV A;  1PRX A;  3QOU A;  4FYC A;  4YAV A;  4MF7 A;  4PQI A;  2VIM A;  2IN3 A;  5D73 A;  1TRV A;  1O8X A;  1XG8 A;  2FHE A;  4EC0 A;  1DUG A;  5E4W A;  3G7Y A;  3GA4 A;  3M8N A;  4GF0 A;  6GSW A;  4K0N A;  4F0B A;  2M72 A;  3FKF A;  1Q4J A;  2H6X A;  1TU7 A;  4XCS A;  1DE2 A;  2QC7 A;  4A5P A;  1K3O A;  4N0V A;  4CHS A;  2JU5 A;  3TKS C;  2AJQ B;  5F06 A;  2I9H A;  1H4O A;  3H8Q A;  2C0F A;  1SL1 B;  4QL7 A;  2GQK A;  4K7I A;  3HVV A;  4GSN A;  1M2D A;  1M7T A;  4PTS A;  2HSM A;  4BPY A;  2KOK A;  2WJU A;  2GQM A;  1NHO A;  4OFM A;  1GUM A; 
#chains in the Genus database with same CATH homology
 3K8N A;  4KCE A;  3HZ8 A;  3UL3 A;  1XW6 A;  4MK3 A;  4EDY A;  1FAA A;  1ERW A;  4HZ2 A;  1LBK A;  3WYW A;  1W4V A;  4RI6 A;  1F2E A;  3NIV A;  1SK0 A;  3HCZ A;  2M66 A;  3HKR A;  3MNG A;  1B9Y C;  3HJM A;  3IDV A;  2GTU A;  3M9J A;  2VCW A;  3VUR A;  1PN9 A;  4IHU A;  3WGX A;  2H30 A;  2DIZ A;  2H70 A;  3BBY A;  3DGQ A;  1M2B A;  1O73 A;  4NHW A;  1YKC A;  4RQR A;  2PMT A;  1ERU A;  3KH7 A;  1M99 A;  2YZH A;  5HR3 A;  3GRX A;  5CAX A;  3GV1 A;  4XS4 B;  6GSU A;  4TW5 A;  3ZYW A;  2O89 A;  1AW9 A;  1WWJ A;  2G2Q A;  4MLY A;  4KE3 A;  3VI7 A;  1XXU A;  2VL2 C;  1CQG A;  1ILO A;  2F8A A;  3DWV A;  2YV7 A;  4WR4 A;  1OE7 A;  2BJX A;  4XS4 A;  4Z2T A;  3EYT A;  4JZQ A;  1OC8 A;  4KDU A;  4ZIL A;  3TKS A;  3JCM L;  1GUH A;  3CTF A;  2OE1 A;  4PNF A;  4MZC A;  1ZYN A;  4KA0 A;  2I3Y A;  2GLR A;  3UVT A;  2I4A A;  3W8J A;  1DE1 A;  5H5Q A;  19GS A;  2HZF A;  1SJ6 A;  1B4Q A;  2HFD A;  1SK2 A;  1S3C A;  3KTL A;  1R7H A;  1V58 A;  1BJX A;  4KUN A;  4TRX A;  1R26 A;  4IQA A;  4EIP A;  1PQN A;  3P2A A;  5GAP D;  4YQM A;  1AC1 A;  5C00 A;  4I8B A;  4K8M A;  1F3A A;  5CRH A;  1X5D A;  3GUR A;  5HFG A;  3O6T A;  1EEJ A;  1K3L A;  3L9V A;  3MWH A;  5ECH B;  2B6M A;  1ZYP A;  1GSY A;  1PGT A;  1SK1 A;  2HT9 A;  5CRW A;  1GUL A;  4ECI A;  3CSJ A;  5KOX A;  1BX9 A;  4MJA A;  3C8E A;  2GSQ A;  5KN0 A;  4OO4 A;  2C4J A;  2L5O A;  4KAE A;  3LQ7 A;  4L0W A;  3WT1 A;  1JHB A;  5HFI A;  3EMP A;  1EV4 A;  4PXO A;  5DAL B;  3KP8 A;  4MH2 A;  2CAI A;  3FW2 A;  1AQX A;  3AY8 A;  2VCV A;  4RQX A;  1BAY A;  2VL2 A;  5IO0 A;  3G9B A;  1F6M C;  1MD3 A;  1YY7 A;  2DKH A;  2C3N A;  5DAL A;  3DVW A;  1TK5 B;  4IBP A;  1AAZ A;  2B1L A;  2P0G A;  1A24 A;  4I2U A;  2HRN A;  1ZGN A;  4AGS A;  1GSD A;  5EPF A;  2YWM A;  1T4Z A;  1FOV A;  5D9W A;  3O3T A;  4KGI A;  5BMU A;  5IM9 A;  2H1G A;  2DML A;  3EPT A;  2X49 A;  4G19 A;  5DQS A;  5ENU A;  2HSY A;  4ZB6 A;  1Z5Y E;  2AB6 A;  4XRD A;  1V2A A;  2P31 A;  3SWL A;  4ZXG A;  1XWK A;  1G7E A;  1AUC A;  4N0Z A;  4FYU A;  2OA7 A;  2QA1 A;  1SKW B;  16GS A;  2CX3 A;  4MJE A;  1XVW A;  1YQ1 A;  4KSO A;  1X5E A;  2FLS A;  1T1V A;  1Y6E A;  3ED3 A;  3IK7 A;  4OCE A;  5DVB A;  3ZZX A;  1GNW A;  1RQM A;  5HR1 A;  5CNW A;  2F51 A;  2O87 A;  3DIE A;  1UN2 A;  1SD9 A;  5IO2 A;  1QMV A;  1UVZ A;  3FZ9 A;  4OMV A;  1Z7R A;  4HEA 2;  2H6Y A;  3QFB C;  3EIN A;  2VCQ A;  2GSR A;  4ZL9 A;  5IMF A;  1Z3E A;  3RHC A;  4LLR A;  4YKG A;  2OAC A;  4WEY A;  1YF1 A;  2AYT A;  3F3R A;  4WF5 A;  1SJZ A;  3PGT A;  5A5K A;  2VD0 A;  5IPG A;  3ERW A;  3OR5 A;  3C71 A;  5ID2 B;  4J57 E;  1JLV A;  2O85 A;  3IA1 A;  4PGT A;  4XRA A;  2OE0 A;  3KMO A;  5IMV A;  3F4R A;  2QGV A;  1NHY A;  1E6B A;  3GH9 A;  2K8S A;  1USB A;  1JZR A;  5J41 A;  3UJ1 A;  2ALB A;  3QDN A;  2VD1 A;  4MJC A;  3Q18 A;  3F9U A;  4N11 A;  2C0E A;  3TCO A;  2GT5 A;  3IHG A;  3HVS A;  2JAD A;  3G7J A;  4FYB A;  1F3B A;  1TDI A;  3HDC A;  3GH6 A;  4NPB A;  2LUS A;  2XBI A;  4GST A;  4TXO A;  3RPN A;  2K18 A;  4QL9 A;  4ML1 A;  3WGD A;  3I43 A;  3FHK A;  5KEJ A;  2C8U A;  1F37 A;  1SL2 B;  2LJK A;  4GSS A;  2EIO A;  1S3A A;  5HR2 A;  4K7N A;  1UC7 A;  4K9Z A;  1GTA A;  2B1K A;  3CRU A;  2DC5 A;  1OKD A;  2V32 A;  4K5R A;  4JU5 A;  3GX0 A;  2E2M A;  3IK9 A;  3IPZ A;  5B6N A;  1FB0 A;  1U3A A;  2EC4 A;  5CP1 A;  4V2N A;  2N5F A;  3M3M A;  3Q74 A;  1Y25 A;  4BL7 A;  2YOI A;  4TXV A;  3A3T A;  2YWO A;  3HZ4 A;  2CV4 A;  1I9D A;  3VFI A;  3LWA A;  4KND A;  4ZIJ A;  3NOF A;  5ECK B;  1O8W A;  3DVX A;  1FG4 A;  4ZBD A;  3HVX A;  4TR0 A;  1VF3 A;  1HNB A;  5L71 A;  1PMT A;  1O81 A;  3TB2 A;  1SKR B;  4D73 A;  1T7P B;  5ECP B;  4EO3 A;  3TRP A;  2H1A A;  4I2T A;  5B6M A;  4QQ7 A;  1RK4 A;  2TRC P;  3EUR A;  1HD2 A;  5LNK e;  3VPQ A;  4F0C A;  4G0K A;  3DRN A;  2NDO A;  4IEL A;  3GX8 A;  5ECQ B;  5D9T A;  4O32 A;  3TOT A;  4LMW A;  3DEX A;  4G0L A;  1GTI A;  4L5O A;  2QA2 A;  4RI7 A;  3KP9 A;  4MPF A;  1A2J A;  3HD5 A;  5IOX A;  5KOW A;  5G31 A;  2HZE A;  3QD9 A;  1QUW A;  3UBK A;  2GSS A;  3ZMK A;  1R4W A;  4TOP A;  4WR5 A;  4PUF C;  2V1M A;  4ZB8 A;  3D4M A;  4TKY A;  1FB6 A;  2DLX A;  1XOB A;  2VO4 A;  3LOR A;  2F9S A;  5D96 A;  3ERF A;  1J0F A;  3UOM A;  4LL1 B;  5ECL B;  4XTS A;  1HQO A;  5DCG A;  1XPV A;  2A4H A;  1AQW A;  5GAN D;  3IAS 2;  2LKU A;  20GS A;  4OD7 A;  2IWT A;  1YDK A;  4KF9 A;  4PX1 A;  5D9X A;  3KEB A;  2CZ3 A;  5CRE A;  2LV3 A;  3KM6 A;  5E59 A;  2DJK A;  4OFT A;  2H0G A;  3GSS A;  3KZQ A;  1EOH A;  4Q5Q A;  1BED A;  3D4T A;  4MPG A;  3W8S A;  3FR9 A;  2MMZ A;  1SEN A;  1QK8 A;  3PPU A;  1K0C A;  3IHQ A;  4KB3 A;  1GSE A;  4HU7 A;  2CA8 A;  1U87 A;  3LXT A;  2PUK C;  3LFL A;  4IVF A;  3W6G A;  4ACS A;  2L59 A;  4CY6 A;  2FWF A;  3IRA A;  2ZNM A;  1OE8 A;  2PGT A;  2RUE A;  3H79 A;  3H93 A;  3L78 A;  5GSS A;  2HNL A;  4MA9 A;  4K2D A;  1AXD A;  1ACV A;  5F07 A;  3Q6O A;  5G30 A;  4MAB A;  5DDL A;  3EU3 A;  2YN1 A;  4TR4 A;  2WGR A;  4ZL8 A;  2CVD A;  1PX7 A;  2R5G A;  4YAP A;  2LTK A;  3FY7 A;  3A5I A;  1IYI A;  3R2Q A;  1VF1 A;  3E0U A;  1A2L A;  2VCX A;  5EL8 A;  3UIW A;  1GNE A;  1Z6M A;  2LNS A;  3ZVJ D;  2CAQ A;  4GQC A;  1ZOF A;  4EF0 A;  3DKS A;  1R5A A;  2ON7 A;  1J08 A;  4BWQ A;  6GSX A;  2WRT A;  2H0H A;  2WDU A;  4AJ8 A;  3BCI A;  4YKF A;  3IAM 2;  3E9J B;  3RPP A;  2HYX A;  1WJK A;  2IME A;  2PU9 C;  2J23 A;  5B8A A;  2QSI A;  2CZ2 A;  3A2V A;  4POL A;  1R5P A;  1XW9 A;  1T8E B;  4JED A;  4V2M A;  3LYP A;  5ECI B;  3APQ A;  1GSF A;  1TJD A;  5ECO B;  4F82 A;  3RHB A;  2GS3 A;  3A2W A;  3ZIV A;  3EMX A;  2KUC A;  1GSU A;  2K8V A;  5J9B A;  1GSS A;  3MYD A;  2FWE A;  1PA3 A;  3VWW A;  5HR0 A;  3GTU B;  1KEB A;  1THO A;  4USS A;  4EE0 A;  3C1R A;  4RUV A;  3FRC A;  1SYR A;  5JWQ B;  2F8F A;  1EV9 A;  1A23 A;  4MP4 A;  3HA9 A;  2B7K A;  4IP1 A;  1O7U A;  3GTU A;  3TJG A;  3IXR A;  1WRY A;  3FR3 A;  1TI1 A;  3ZRE A;  2GZY A;  3IV4 A;  3V1W A;  1FW1 A;  4GQF A;  5CO3 A;  1ABA A;  4K1F A;  3Q19 A;  2R6K A;  2C0D A;  2EIR A;  3TOU A;  1TXX A;  3J7Y b;  3QAV A;  3IE3 A;  2NBS A;  2LEG A;  4DSQ A;  1XWA A;  1TP9 A;  2VM2 A;  3KJY A;  1MEK A;  3A5W A;  1M0U A;  1OVN A;  4V1A g;  1B48 A;  4Z7X A;  1X9W B;  4X4J A;  5J4U A;  1QQ2 A;  2YZU A;  1ZYQ B;  3GL3 A;  3N9J A;  3VWU A;  4IGJ A;  4EDZ A;  4OFN A;  5A4V A;  4FIW A;  1GH2 A;  5A4W A;  5AGY A;  3KCM A;  1XFL A;  2H71 A;  2V6O A;  2JZS A;  1TU8 A;  5IMZ A;  5IMA A;  1A8Y A;  3F63 A;  4K6X A;  3TDG A;  4PNG A;  2WS2 A;  3UEM A;  2G0F A;  4IP6 A;  2JZT A;  1F9M A;  3GYK A;  1GTB A;  2E2G A;  2YV9 A;  5JCG A;  5EY6 A;  5AN1 A;  2H72 A;  4NWY A;  3IBH A;  3P90 A;  3VK9 A;  4DSS B;  1NSW A;  2X64 A;  3GNJ A;  1J9B A;  22GS A;  2DJJ A;  2XHF A;  4JE1 A;  2H8L A;  2H19 A;  4X0X A;  6GSY A;  1MDJ A;  2FUG 2;  3CYN A;  4V1A p;  2L5L A;  1XZO A;  5CRG A;  1GSQ A;  2FA4 A;  4DSS A;  3TKQ A;  1EOG A;  5IMC A;  4XS6 A;  1EGO A;  2H75 A;  3EWL A;  5IPH A;  1A8L A;  2CVK A;  3F6D A;  3C1S A;  5IQY A;  2K6V A;  3APS A;  4HUA A;  1XWC A;  1PKW A;  2GZZ A;  2HXK A;  4GCI A;  4FO5 A;  4MDC A;  3P7X A;  4PQ1 A;  4IS0 A;  1PSQ A;  3BD2 A;  2I1U A;  2HSH A;  3GFK A;  1TRU A;  2C1Y A;  2C0G A;  4EVM A;  4NMU A;  5KN2 A;  2V41 A;  3ISO A;  2IMD A;  1WOU A;  1V9W A;  3LXZ A;  4I97 A;  1W89 A;  3C7M A;  3QAW A;  1B9X C;  3D5J A;  1EP7 A;  2R0P A;  1OYJ A;  5G2Z A;  4P3Y B;  3HY2 A;  2FNO A;  3U5R E;  2MBS A;  5LCZ A;  4MCU A;  3QCP A;  5ID2 A;  3WGE A;  4IQ1 A;  4HQS A;  1BYE A;  4AJ6 A;  4J56 E;  2RM5 A;  2GT6 A;  3EC3 A;  1RW1 A;  1YZX A;  2L57 A;  2H1D A;  3DXB A;  2YNX A;  4PUR A;  3GMF A;  3FZA A;  4IJI A;  1T00 A;  3WT2 A;  3L4N A;  3DYR A;  2P5Q A;  3TJB A;  3S9F A;  4TR1 B;  1GUK A;  4BVY B;  1K0B A;  3CSI A;  5ECN B;  5HFK A;  1M9B A;  1U6T A;  3RDW A;  1KBN A;  1XOA A;  2R2J A;  3D6I A;  2FGX A;  1HYU A;  5DJM A;  3LG6 A;  2J9H A;  2H0I A;  4ZBB A;  2F3M A;  5DAK B;  4JBB A;  5FHI A;  3TRQ A;  4TN8 A;  1GTU A;  2LNT A;  11GS A;  2H1B A;  1EGR A;  3PH9 A;  2IIY A;  4POK A;  4IW9 A;  3TRX A;  17GS A;  4X43 A;  5IIZ A;  4TVE A;  1JZD A;  4XS1 A;  3VPT A;  4L0U A;  4NAX A;  2LJR A;  5INY A;  1Z7P A;  4FQU A;  3FZ5 A;  1MTC A;  3IR4 A;  1HNA A;  3CSH A;  3MDK A;  1JZO A;  1XVQ A;  3QMX A;  5D9V A;  1DSB A;  3VI5 A;  4ZBA A;  3P8W A;  1TI3 A;  2K9F A;  2OKA A;  3FR6 A;  2GZP A;  3PR8 A;  1G7D A;  12GS A;  4G2E A;  2FCH A;  2LS5 A;  3GKX A;  2ZCT A;  3G7I A;  3F3Q A;  1FOH A;  1WMJ A;  2WCI A;  2ES7 A;  3O76 A;  4KW6 A;  1THX A;  1VF4 A;  5F8B A;  2ZUP A;  3ZIT A;  3UVH A;  4BA7 A;  1O6J A;  1FVJ A;  2OE3 A;  4EXJ A;  3BCK A;  2YWI A;  4GWR A;  4MZW A;  1S3D A;  1K0O A;  2HE3 A;  5H5S A;  1URM A;  2VUP A;  2X8G A;  1A0F A;  2RM6 A;  2VCT A;  4HJM A;  2YJ7 A;  4X1U A;  4WXT A;  1EP8 A;  9GSS A;  2N5A A;  2DKI A;  3L9S A;  3ZL5 A;  4POB A;  5F0G A;  3NZN A;  4MMM A;  2A2S A;  2L4C A;  2C80 A;  1FO5 A;  5KN3 A;  3HXS A;  3N5O A;  1X9S B;  4N10 A;  5B8B A;  2DJ0 A;  3EE2 A;  4K5S A;  2L4Q A;  2IJY A;  4JR6 A;  2VL9 A;  1PL1 A;  3UMA A;  1K0A A;  5D93 A;  1NW2 A;  1NM3 A;  2DMM A;  4PUA A;  3GKK A;  2PPT A;  2JAC A;  3CBU A;  1TW9 A;  1WIK A;  3LYK A;  2LST A;  1TKD B;  4GXZ A;  2GVP A;  3UAR A;  1XWB A;  3QAG A;  4WET A;  1T3B A;  3ZFL A;  1SJI A;  3H4K A;  2IMK A;  5LD0 A;  2JSZ A;  4LL4 B;  4F2I A;  2DIY A;  5JCW A;  3FZ4 A;  1K0N A;  4G9H A;  1U88 A;  2X4A A;  4N30 A;  1N2A A;  4ICY A;  3RAZ A;  5DCH A;  2VLT A;  1Q98 A;  1ZCP A;  3LJR A;  3QFA C;  2NVL A;  1KTE A;  1PX6 A;  1XW5 A;  2QKE A;  4YQV A;  4GRF A;  4Q5R A;  4V2L A;  2FD3 A;  2IMI A;  2MBT A;  2R3X A;  2IL3 A;  5JCU A;  1XBS A;  3LSZ A;  3FEU A;  1O85 A;  2HRK A;  2LQO A;  5GZZ B;  3CMI A;  5F05 A;  1WE0 A;  2DBC A;  5C04 A;  2X8C A;  3GST A;  2OAD A;  5JWO B;  1ERV A;  5J5N A;  4I5Q A;  3TUE A;  5J3R A;  3M1G A;  1PL2 A;  1M2A A;  4GTU A;  4MJB A;  3F6F A;  5D8I A;  1Z6N A;  3WD6 A;  1ZZY A;  3ZRD A;  4JR4 A;  3VWV A;  1B4P A;  3CTG A;  2PN8 A;  3HJO A;  1YF0 A;  4ECJ A;  2WB9 A;  5DBQ A;  4KCA A;  4HJ2 A;  1WP0 A;  4O92 A;  1X5C A;  2JSY A;  2V2G A;  1ZMA A;  1HNC A;  2NTO A;  1SD8 A;  1KNG A;  2H76 A;  4HZ4 A;  2XPE A;  1SL0 B;  4LA1 A;  1XWG A;  4POM A;  2RII A;  3L9U A;  4HDE A;  3ERG A;  2LRT A;  1ERT A;  5B7C A;  4F9Z A;  2PVO C;  1WPI A;  1Z9H A;  1DBY A;  2PVQ A;  2BMX A;  2H01 A;  2YP6 A;  4KH7 A;  1PKZ A;  2R0C A;  2WFC A;  1FVK A;  3MSZ A;  2V6K A;  2D2Z A;  5G1L A;  1FHE A;  2REM A;  1A0R P;  1GWC A;  2WZ9 A;  1VGL A;  3GKM A;  2M46 A;  5FT3 A;  3H1N A;  1TRW A;  2L6D A;  2IPA A;  2P5R A;  1VF2 A;  3RBT A;  4I6X A;  3A2X A;  2LRC A;  2VOC A;  8GSS A;  2YWN A;  3L0H A;  1C72 A;  4ULX A;  2HRA A;  2DJ1 A;  3HJP A;  3QPM A;  5G1K A;  3TJF A;  4KDY A;  4MF5 A;  1K3Y A;  3M0F A;  2X99 A;  1K0D A;  4ISD A;  2BTO T;  2MYG A;  4EUY A;  5BRT A;  1PD2 1;  4CDO A;  1ZL9 A;  4K0G A;  1EEM A;  2Z9S A;  2KP1 A;  4WKW A;  3PIN A;  4J2F A;  4KX4 A;  4OWY A;  3TJJ A;  3DD3 A;  3GKN A;  3UAP A;  2VAF A;  2GQL A;  3F4T A;  2YPM A;  7GSS A;  1SYX A;  3GUS A;  4OCF A;  4PQH A;  3D22 A;  5EVO A;  2B5X A;  2A4V A;  5CRD A;  2VLU A;  4NV5 A;  4HI7 A;  2HLS A;  2XC2 A;  4H86 A;  2KLX A;  3LW9 A;  4CW9 A;  5ECM B;  2DJ3 A;  1QGV A;  5ELG A;  4IKH A;  1YEP A;  2LQQ A;  4MNN A;  3GHA A;  3IC8 A;  4O5R A;  3FK8 A;  1G7O A;  3BOA A;  2XPD A;  1M9A A;  5G5F A;  2DJ2 A;  1LJR A;  4DEJ A;  5J9C A;  2FWG A;  1V40 A;  2OBK A;  3SBC A;  5ABR A;  1ST9 A;  2DSA A;  2HRF A;  1OKT A;  4YH2 A;  3MAK A;  3I9V 2;  2E0Q A;  4ZL7 A;  2YCD A;  2GST A;  2XBQ A;  3I69 A;  3TJK A;  4IJ3 A;  4NV2 A;  4G0I A;  1CQH A;  4JRR A;  1TK0 B;  3ME8 A;  1LU4 A;  2CX4 A;  1VRS D;  3KH9 A;  2B3S A;  2LJA A;  1BQ7 A;  2JZR A;  5JWR B;  2AAW A;  1GLQ A;  3TGZ A;  1G6Y A;  4IN0 A;  4O7H A;  5KN1 A;  4BWS A;  1JFU A;  2R37 A;  4O5U A;  4ECC A;  2RLI A;  5FWG A;  2ON5 A;  3ZVJ A;  2OJL A;  2C3Q A;  3E3E A;  1OC3 A;  1JZW A;  4ILF A;  2R0G A;  1YEX A;  4WBR D;  4FH8 A;  2JL4 A;  3GIX A;  2B7J A;  3LGC A;  3TKS E;  2UZ8 A;  3TKR A;  4WF4 A;  4MH3 A;  2MMN A;  2FA8 A;  4HQZ A;  5COH A;  1JLW A;  3KTB A;  2H6Z A;  5H5R A;  3KGK A;  3CXG A;  2A2P A;  1XCC A;  2O7K A;  3U6V A;  4ECB A;  1GLP A;  5AIX A;  2LRN A;  1OC9 B;  5G5E A;  5DJL A;  4L5L A;  3VWX A;  4L8E A;  10GS A;  3J7Y k;  4AJ7 A;  1H75 A;  1SKS B;  3F4S A;  2B5Y A;  3DML A;  3EU4 A;  2CT6 A;  3KD0 A;  2KP2 A;  4Q5N A;  1UA5 A;  4AF2 A;  1OC9 A;  3IOS A;  4K2X A;  2X8H A;  2L6C A;  2PBJ A;  4XHM A;  2MMA A;  2YAN A;  4MF6 A;  2VM1 A;  5IMD A;  3R3E A;  1GL8 A;  4TXO B;  5AIS A;  2CVB A;  4TR3 A;  2WUL A;  3KMN A;  3APO A;  2RUF A;  3LEF A;  3ZFB A;  2IFQ B;  1IYH A;  2H73 A;  4OO5 A;  4TR1 A;  1YJ6 A;  6GST A;  4BVY A;  2A2R A;  18GS A;  3US3 A;  2YJH A;  1ML6 A;  1U3I A;  3C73 A;  3FMW A;  2I81 A;  1G0T A;  2VLV A;  2TIR A;  2N5B A;  4KSM A;  2M80 A;  4F03 A;  2IFQ A;  2FY6 A;  5HQP A;  13GS A;  2O8V B;  3ZIJ A;  5GST A;  1PN0 A;  1YKA A;  2B5E A;  3KIJ A;  1QXH A;  5DAK A;  3F8U A;  1X0R A;  3ME7 A;  5CYY A;  2HI7 A;  5A4U A;  4HOJ A;  4E8E A;  2IMF A;  5ELA A;  2VL3 A;  4CY8 A;  4EKZ A;  2PWJ A;  2R4V A;  4BL7 B;  2AUV A;  3GN3 A;  2MMO A;  1MDI A;  1A2M A;  1G6W A;  2TRX A;  4ID0 A;  1ON4 A;  3ZTL A;  1B8X A;  2MZC A;  5AIV A;  4Z2R A;  3BJ5 A;  14GS A;  3ZLP A;  1OAZ A;  3D21 A;  1MD4 A;  3IC4 A;  4D73 B;  3GL5 A;  1K0M A;  1T4Y A;  2AHE A;  4HS1 A;  1E2Y A;  2FWH A;  2H66 A;  2GGT A;  1XIY A;  4MZB A;  1TTZ A;  3QR6 A;  1N8J A;  1EWX A;  5DQY A;  4GLT A;  1ZYE A;  2E7P A;  6GSV A;  3F0I A;  1EZK A;  4DSR A;  3EVI A;  4HU9 A;  1TK8 B;  4DVC A;  2CQ9 A;  1V98 A;  2VCZ A;  1AQV A;  2EIQ A;  1TOF A;  3I6A A;  2C3T A;  2NPB A;  3FYG A;  2GDR A;  2HZE B;  4Q5F A;  4Z2U A;  4NXI A;  3VLN A;  5ECS A;  1TRS A;  1SU9 A;  6GSS A;  3ZML A;  1GRX A;  5IOW A;  2PER A;  4XIH A;  5ECR B;  4BVX B;  1GP1 A;  1QFN A;  3UBL A;  3MIX A;  4G10 A;  1V57 A;  3HHV A;  3KXO A;  4K7O A;  4O5Q A;  2KHP A;  3CRT A;  4E8H A;  2OBI A;  1I5G A;  4KDX A;  4ZB9 A;  1X9M B;  4BVX A;  3TKP A;  3M9K A;  3HYP A;  4EL1 A;  4NHZ A;  2AV4 A;  1BG5 A;  4WBJ A;  1AIU A;  4EIQ A;  4ML6 A;  3D0Z A;  2H74 A;  4YQU A;  1MDK A;  4LMV A;  1PRX A;  3QOU A;  4FYC A;  4YAV A;  4MF7 A;  4PQI A;  2VIM A;  2IN3 A;  5D73 A;  1TRV A;  1O8X A;  2FHE A;  4EC0 A;  1DUG A;  5E4W A;  3G7Y A;  3GA4 A;  3M8N A;  4GF0 A;  6GSW A;  4K0N A;  4F0B A;  2M72 A;  3FKF A;  1Q4J A;  2H6X A;  1TU7 A;  4XCS A;  1DE2 A;  2QC7 A;  4A5P A;  1K3O A;  4N0V A;  4CHS A;  2JU5 A;  3TKS C;  2AJQ B;  5F06 A;  2I9H A;  1H4O A;  3H8Q A;  2C0F A;  1SL1 B;  4QL7 A;  2GQK A;  4K7I A;  3HVV A;  4GSN A;  1M2D A;  1M7T A;  4PTS A;  2HSM A;  4BPY A;  2KOK A;  2WJU A;  2GQM A;  1NHO A;  4OFM A;  1GUM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...