2C1YA

Structure of pdi-related chaperone, wind mutant-y55k
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
231
structure length
231
Chain Sequence
TCTGCVDLDELSFEKTVERFPYSVVKFDIAYPKGEKHEAFTAFSKSAHKATKDLLIATVGVKDYGELENKALGDRYKVDDKNFPSIFLFKGNADEYVQLPSHVDVTLDNLKAFVSANTPLYIGRDGCIKEFNEVLKNYANIPDAEQLKLIEKLQAKQEQLTDPEQQQNARAYLIYMRKIHEVGYDFLEEETKRLLRLKAGKVTEAKKEELLRKLNILEVFRVHKVTKTAPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords WINDBEUTEL PROTEIN
publication title Structural Elucidation of the Pdi-Related Chaperone Wind with the Help of Mutants.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 71
structure length 231
sequence length 231
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07749 ERp29 Endoplasmic reticulum protein ERp29, C-terminal domain
A PF07912 ERp29_N ERp29, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1150.12 Mainly Alpha Up-down Bundle Endoplasmic reticulum protein erp29 Endoplasmic reticulum resident protein 29, C-terminal domain 2c1yA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2c1yA01
1XZOA 2HZFA 2R6KA 2YWNA 2E2GA 2H1BA 5LCZA 2LJAA 1VF1A 4G19A 1GTUA 3TOTA 1QQ2A 5IQYA 3KGKA 1O8WA 1PL1A 3KD0A 1ZCPA 4IBPA 4JR4A 1ILOA 3M8NA 2PUKC 4WBRD 1GTBA 4HS1A 3IE3A 2JZSA 4JE1A 2LEGA 1M9AA 2IMIA 2YWOA 4BVYA 4DSRA 4TOPA 4POLA 1JZWA 1THOA 2B5YA 4HUAA 4IJ3A 1ZYEA 3VFIA 5F05A 4YH2A 2GQLA 2KP2A 4TW5A 4PQ1A 3HJPA 2YZUA 5GSSA 1JLVA 2LQQA 2X99A 5IMAA 3RAZA 20GSA 4F0BA 2FWGA 5IMCA 4ZBDA 3TJKA 4IS0A 2LNTA 1W89A 2N5FA 3GFKA 4I97A 4MA9A 1ERWA 22GSA 2MMNA 3EU3A 2OA7A 5DJMA 4BWSA 3CSIA 1EEMA 3G9BA 5ECMB 3OR5A 4AJ7A 2ZCTA 3C71A 5L71A 3SWLA 2JSZA 1QUWA 3W6GA 2LS5A 19GSA 1XWCA 4OD7A 2FA8A 2TRCP 3IBHA 1XFLA 4F82A 3MWHA 5ECLB 4K7IA 3ZIJA 1OAZA 2H73A 5G5EA 3NIVA 4TVEA 4GQFA 1GULA 1V9WA 2P31A 3DD3A 5ELGA 8GSSA 1LBKA 2PGTA 2K18A 1PMTA 2C80A 3APSA 1J0FA 3VLNA 2LSTA 4Q5QA 3VPQA 4MPGA 4OMVA 5A5KA 3ERFA 1QGVA 1GTIA 5IOWA 4XS4A 1TK0B 1ML6A 10GSA 4ZBAA 3QAGA 1GLPA 1MDKA 4NPBA 3GKMA 2LTKA 1TI1A 3TJBA 1J08A 5CREA 5G1KA 2KUCA 3TKQA 3ZFBA 2WGRA 4GSNA 4EXJA 2AB6A 2DSAA 2BMXA 2CZ3A 1AQWA 2B5EA 4E8EA 5IIZA 2O7KA 2DC5A 1AW9A 4Z7XA 4ZBBA 4NV5A 2L4CA 1X9MB 2WB9A 4GCIA 1T4ZA 2DJJA 5DQSA 2MMAA 2DJKA 3HVXA 1GLQA 1EEJA 2AV4A 4HEA2 5ECNB 1M0UA 3LYPA 4JBBA 4IJIA 1NW2A 1X5CA 4IW9A 1AQXA 3HJMA 2QC7A 2CVKA 5D96A 3IAM2 2X8HA 2LUSA 2D2ZA 4OFNA 4TR3A 5LNKe 5IMDA 1BQ7A 3EU4A 2LJKA 3F6FA 1OKTA 3APOA 3G7JA 1TRSA 1DE2A 3TGZA 1ZZYA 1BX9A 1TI3A 3UMAA 3H4KA 2G0FA 2FLSA 6GSTA 2O85A 2O8VB 2IPAA 4PNGA 3VI7A 2HLSA 4AJ6A 1K0AA 5CP1A 4RI6A 5G5FA 1Z6NA 1JZRA 3AY8A 5F06A 2VCWA 3L0HA 2HSYA 3LJRA 3K8NA 4D73A 2PWJA 3GMFA 5J4UA 5D8IA 2K6VA 1E2YA 2HZEA 1WIKA 3HVVA 2AYTA 2B7KA 4IGJA 1FW1A 2JL4A 4TN8A 4DSQA 3IK7A 1A24A 1M2BA 4X43A 2PN8A 3TRQA 5D9WA 1PL2A 4G2EA 2C0DA 1G0TA 4WF5A 3UARA 2VCQA 3GH6A 1EV9A 2YJ7A 2YN1A 4FO5A 1MTCA 4ZIJA 4N10A 4CW9A 3J7Yb 3RHBA 2A4VA 3PH9A 3FKFA 3FYGA 1IYHA 1S3CA 2VCTA 1BJXA 1X9SB 4XS4B 2A2RA 3FZ4A 1UN2A 3BCKA 4EKZA 2X8CA 6GSVA 1Z6MA 4OFMA 2QGVA 4WBJA 9GSSA 3CYNA 4WR5A 3HJOA 3F6DA 2QKEA 5CRGA 4N0VA 1DE1A 3G7YA 4XTSA 1JHBA 2KLXA 3N5OA 1TRWA 2V1MA 5KN1A 2RLIA 5J41A 3ZLPA 2XBIA 5ECHB 3ZMLA 1UA5A 3FR6A 4NHWA 3BOAA 3F8UA 18GSA 2B1LA 1BYEA 1SD9A 4KSOA 2PU9C 1O6JA 1SK2A 5DCHA 5HR2A 2XPEA 5ECKB 4YQVA 4J57E 2YNXA 3GYKA 1WOUA 2M66A 2K8VA 2VL2A 2CAIA 5HR3A 3I6AA 2HYXA 4NMUA 2V6KA 4O32A 4ZL7A 2C0GA 3QDNA 3TRXA 4MZWA 3H8QA 1TRUA 4ZB8A 1T4YA 2FWHA 4ZL8A 2HXKA 1YEXA 2IMEA 6GSWA 2GT5A 2F8FA 3UBLA 3TKPA 3QAWA 1X9WB 1SKWB 2GVPA 2WS2A 1XOAA 2GZPA 2L4QA 4LL4B 3EURA 4V1Ap 2BTOT 1ACVA 4ECBA 4OWYA 4EDYA 5ECOB 2LRCA 2MMZA 4RQXA 4YQUA 4K2DA 2NPBA 3D5JA 4EE0A 2HZEB 2AHEA 4EDZA 3GIXA 1WJKA 2DJ1A 4P3YB 3UVHA 1TW9A 4TXOB 2VD1A 5CRHA 3LWAA 3QMXA 4KDXA 4POMA 2YWMA 5G1LA 1M9BA 2KP1A 1NM3A 3DIEA 3DWVA 3GTUA 2VOCA 4MK3A 3GN3A 2EIQA 5IOXA 2E0QA 4JR6A 3M3MA 3FHKA 1VF3A 6GSXA 1K0DA 1M99A 2GSTA 3BBYA 4WEYA 3I9V2 1V40A 4PQHA 1FVKA 1MDJA 5JWQB 5CRDA 3UEMA 1ZGNA 2REMA 1GRXA 2PBJA 4KB3A 4ILFA 1GSDA 3DVWA 4GF0A 1XPVA 4V2LA 2VL2C 1EWXA 3V1WA 3F3QA 3DGQA 3L9SA 2FY6A 2L57A 3VWUA 3W8JA 5D73A 3F9UA 2KOKA 2DIZA 3UVTA 3PINA 1GNWA 4ID0A 2DJ3A 2GQKA 2MZCA 2VLTA 2G2QA 1PA3A 4TR1B 3WGXA 4MJAA 3VK9A 2H0GA 4HJ2A 2VO4A 2J9HA 2YANA 3WGDA 3M9KA 3UAPA 4HJMA 2VCXA 5HQPA 3EE2A 3C73A 3JCML 1F3AA 3QFBC 2H1AA 1SYXA 5IO2A 1SJIA 2WDUA 11GSA 2MBSA 5F8BA 4HU7A 2H6XA 2R5GA 5CRWA 1ZL9A 4Q5FA 3HZ8A 3WGEA 1DSBA 2HRFA 3GKNA 3VPTA 3MAKA 2C1YA 5CAXA 3APQA 1R26A 2ZNMA 3F4SA 4OO4A 3P8WA 4KX4A 2IWTA 1YKCA 1GWCA 3ME8A 5J5NA 3BCIA 2CVDA 5DCGA 1XIYA 2H76A 5DQYA 4JU5A 1U3AA 5JCGA 5ECSA 3ZIVA 2ES7A 3RBTA 2B1KA 1JZDA 4JEDA 1SK0A 3KTBA 1GL8A 5G30A 1USBA 2IJYA 1U6TA 1XBSA 7GSSA 2RIIA 1R4WA 5B6NA 1U3IA 1UVZA 4FIWA 2GZYA 3KMOA 4MH2A 3L9UA 3Q6OA 2E7PA 1Z7PA 4OO5A 2TIRA 5DALA 4MH3A 5HR0A 3HD5A 4XCSA 4L0WA 3ZRDA 1OE7A 3LORA 1FB6A 2C3NA 3ZITA 3GA4A 1GUKA 4L0UA 2M80A 5IO0A 3HDCA 1XWBA 3MSZA 3IRAA 4ULXA 2YV7A 2R3XA 2K9FA 3CSHA 4I8BA 1AC1A 1BG5A 4KNDA 2WJUA 4MCUA 2FCHA 1KEBA 2M46A 1B9XC 3KMNA 1B9YC 1O81A 5E4WA 1K0OA 3Q74A 3FR3A 5J3RA 1FVJA 3ERGA 2CVBA 4PURA 5A4UA 4HDEA 2C0FA 2F8AA 1PQNA 3FR9A 1N2AA 5HFGA 2VL9A 4KGIA 4J2FA 1FOVA 1SJ6A 2AJQB 2X8GA 1Z5YE 3UIWA 4NAXA 1N8JA 4RQRA 4K7NA 3IHQA 2YOIA 2EC4A 1XWGA 5IPHA 4HZ4A 3CBUA 1E6BA 3IV4A 3ZL5A 1YJ6A 2JU5A 2MYGA 1PKZA 5ENUA 2KHPA 1SD8A 2EIOA 4MF7A 1GSYA 5ECRB 2L6DA 3VWXA 5HFIA 5J9CA 4DSSA 1Q4JA 5FWGA 1B4PA 3FZ5A 2R37A 3C7MA 3I43A 2CQ9A 5AIXA 1DBYA 1OC3A 1SENA 1A2JA 2PERA 4L8EA 1V98A 4EF0A 3US3A 2YV9A 3TKSA 2YP6A 3O76A 4NHZA 4MF5A 1FHEA 1K0NA 2DJ0A 2HRNA 3RPPA 3I69A 2RM6A 4PUFC 5H5QA 1ZOFA 3VWVA 5DVBA 2PPTA 1AIUA 2N5BA 4N11A 4GXZA 5DJLA 1TRVA 1Z3EA 1Y6EA 3NOFA 3UOMA 1YF1A 3GURA 1YZXA 4HQSA 5ELAA 4Q5RA 3TKRA 4XS1A 3TKSE 2TRXA 2DIYA 1G7DA 2GSQA 1T8EB 3HA9A 1B4QA 3ZZXA 3KM6A 1A2LA 2DJ2A 2OE3A 4IN0A 2WZ9A 3L9VA 1MD3A 4MP4A 3QR6A 2OBIA 3HVSA 5EL8A 4F2IA 2GTUA 2GSRA 3C8EA 5GZZB 2IMDA 5ECQB 4IQAA 1WE0A 4GSTA 1JFUA 1ZYQB 3IA1A 1G6YA 4IELA 3LGCA 1X5DA 1VF4A 5H5SA 4CHSA 3RDWA 3WYWA 1V58A 1FAAA 1OYJA 5GAPD 1SKRB 2B6MA 2BJXA 1PGTA 2L5LA 1DUGA 3N9JA 4EUYA 5E59A 2I1UA 1H4OA 5AN1A 5DDLA 3F63A 1RW1A 4I2UA 4V2MA 3S9FA 4TR0A 1M2AA 2FNOA 2EIRA 5EPFA 2WRTA 3TKSC 2H74A 4EO3A 1SJZA 1RQMA 5B8BA 5B7CA 1I9DA 2HT9A 4HU9A 4TKYA 3PGTA 4TR4A 1B48A 4KAEA 4IP6A 3EINA 3W8SA 3A5WA 3J7Yk 3WT1A 4K6XA 4F0CA 1GSQA 1SL0B 4LMWA 1EGRA 4IP1A 4ZILA 1XWKA 2VLVA 4QL7A 2L6CA 3ZYWA 1URMA 2I81A 1K3OA 3U6VA 13GSA 1SKSB 3KJYA 1T00A 2VLUA 4NWYA 1ON4A 4O7HA 3ERWA 3TJFA 5FHIA 2OJLA 5IMFA 1YKAA 4L5OA 3ED3A 1YQ1A 3ZMKA 2V6OA 3DEXA 1ST9A 3DVXA 5GSTA 1OVNA 3DMLA 3FZ9A 2B3SA 1O7UA 1W4VA 4BWQA 1SL2B 2JACA 4DEJA 2MMOA 2DMMA 3O3TA 1PX6A 4D73B 1FO5A 1GP1A 4IVFA 1RK4A 2OACA 5DAKA 1FB0A 2GT6A 5CNWA 3UBKA 1ERUA 1PX7A 3D21A 3ME7A 2V2GA 2AAWA 2PVOC 2CV4A 2IMFA 2A2SA 1TDIA 3FY7A 2P5QA 1PRXA 2OBKA 4XS6A 5INYA 4WXTA 5JWRB 1GSUA 3MDKA 1YF0A 3GL5A 1TK8B 2Z9SA 5IM9A 1GSEA 3TRPA 5ID2A 2C3TA 3FK8A 3LEFA 1M7TA 3D22A 2H71A 2WULA 4AF2A 3GX0A 5D93A 2I9HA 2HSHA 3GL3A 1FG4A 2YCDA 5FT3A 4EVMA 2XHFA 3KH9A 4F03A 3EYTA 3KXOA 4OCEA 3KTLA 4PX1A 3R2QA 4K7OA 1X5EA 4I5QA 3WT2A 1O85A 3GSSA 3TJGA 1JLWA 1T1VA 4N30A 1O73A 4RUVA 1OC9A 2VUPA 3DRNA 2M72A 2C4JA 1TKDB 2FA4A 2C8UA 2O87A 5A4WA 2RUEA 1HQOA 5COHA 3CRTA 2FGXA 2LV3A 3BD2A 1OC8A 2FHEA 4Q5NA 4ECJA 1XWAA 1XW5A 4OFTA 1F9MA 1JZOA 2RM5A 2LQOA 4ML1A 1Z7RA 5KN2A 3GKKA 2H01A 3VURA 3IXRA 1K3LA 1F2EA 1C72A 5ABRA 3Q19A 2WFCA 4IKHA 4EC0A 1YEPA 1TU8A 1XVQA 2HI7A 1S3AA 2LRTA 2H1GA 4GLTA 2C3QA 3IAS2 3GX8A 3LXZA 5EVOA 2P0GA 3KH7A 3UL3A 1F3BA 3KEBA 4H86A 5G31A 2NDOA 2R2JA 4WF4A 4HOJA 4QQ7A 5DAKB 4YAPA 3F4TA 1PN9A 5F07A 3P7XA 6GSYA 3IR4A 1A0RP 1ERTA 3C1SA 2MBTA 1EOHA 2O89A 4K0GA 3GUSA 5D9VA 4WETA 1TJDA 3P90A 5EY6A 3EC3A 3FW2A 3RHCA 1XW9A 3LXTA 2X64A 2F9SA 3GTUB 4KCEA 1J9BA 2CX3A 4OCFA 4O92A 1EGOA 4KSMA 2DBCA 5ID2B 1BAYA 4E8HA 5JCUA 2H0HA 1XCCA 2ON7A 1WMJA 3KZQA 1OE8A 1XOBA 5KN0A 4PUAA 1CQHA 5JCWA 3A3TA 2XC2A 1GSFA 4ZB6A 3VWWA 2CZ2A 2I3YA 3IPZA 1AQVA 2DMLA 1A0FA 1ABAA 5G2ZA 5ECPB 1GTAA 2CAQA 3GV1A 2YZHA 4HI7A 3CTFA 5ECIB 1QXHA 3QFAC 1U87A 3E9JB 4PXOA 2H70A 3CSJA 3GH9A 1NHOA 4O5RA 3LYKA 1X0RA 5F0GA 3QD9A 1A2MA 3F3RA 3H79A 1IYIA 1R5PA 2I4AA 4POKA 1OC9B 1WRYA 2H8LA 12GSA 4GTUA 4I6XA 3HXSA 2JADA 3TOUA 4KE3A 1AUCA 1F6MC 2GGTA 2VL3A 1AAZA 2VD0A 4V1Ag 1PKWA 2HNLA 4MZCA 4GSSA 1G7EA 4WKWA 3A2VA 3ZREA 1SL1B 5C04A 3QAVA 3CRUA 3KP9A 1EZKA 2CT6A 2JZTA 2ZUPA 4HZ2A 5CO3A 4JRRA 1PSQA 2JZRA 1G7OA 1TXXA 1NSWA 2QSIA 4ZL9A 3VI5A 4NV2A 1G6WA 2IMKA 3EVIA 4ML6A 3HHVA 4ECIA 3RPNA 1UC7A 1ZMAA 1GSSA 4XRDA 4POBA 2VAFA 1V57A 4K0NA 1KNGA 2JSYA 4PGTA 1SK1A 4BA7A 1K0MA 5C00A 4GRFA 2NTOA 4KA0A 4TRXA 3H93A 2CX4A 4N0ZA 4LL1B 4KCAA 3GNJA 2RUFA 2H19A 5AISA 1WPIA 1KBNA 4QL9A 1Y25A 2OE0A 2E2MA 3DXBA 2H6ZA 3SBCA 4LLRA 2F51A 3ZVJD 1VF2A 1YY7A 3D4MA 5HR1A 2YJHA 3CXGA 3IK9A 3A2XA 1SU9A 5DALB 3TCOA 5H5RA 3D6IA 1XXUA 5B6MA 4PQIA 4EL1A 1MEKA 2R4VA 2FD3A 1TU7A 4CDOA 2H72A 1T3BA 4G10A 1GNEA 3EMXA 5IMVA 1EOGA 1EV4A 2P5RA 4K9ZA 2VCVA 5LD0A 2FWEA 3GSTA 3L78A 4J56E 1A8LA 2GZZA 1QK8A 17GSA 2PVQA 2IFQA 3QPMA 2VIMA 3IC4A 3CMIA 3IOSA 4HQZA 3KIJA 4KUNA 2FWFA 4ZXGA 2LKUA 4G9HA 4NXIA 2PMTA 1HYUA 1MDIA 1Z9HA 3BJ5A 2GDRA 2H75A 4K8MA 1HD2A 2H1DA 3E3EA 3FRCA 4TXVA 2WCIA 2IN3A 2J23A 4TXOA 3HYPA 1EP7A 2OE1A 1WWJA 3D0ZA 1H75A 4MF6A 2GSSA 1YDKA 1F37A 1HNCA 3HCZA 1TOFA 4FYUA 1V2AA 3PR8A 3D4TA 3LQ7A 1WP0A 1R5AA 2L59A 4MMMA 2LNSA 4XRAA 2AUVA 4DSSB 2NVLA 1GUHA 4AJ8A 4ZB9A 1NHYA 4I2TA 1EP8A 6GSUA 1LU4A 3UJ1A 4BPYA 3TB2A 3GKXA 3EMPA 4PNFA 4ISDA 4X0XA 1GUMA 3U5RE 1CQGA 1K3YA 2GS3A 2C0EA 2OKAA 2IIYA 1S3DA 1A23A 4TR1A 1THXA 1VRSD 1A8YA 1ERVA 5D9TA 3CTGA 3DYRA 2YPMA 4KH7A 3M0FA 4IHUA 2H0IA 2B7JA 2F3MA 4F9ZA 3M1GA 5KN3A 2IL3A 1U88A 3LSZA 4KDUA 14GSA 2K8SA 4JZQA 3ISOA 2VCZA 2ALBA 4L5LA 3A2WA 2H66A 1OKDA 3O6TA 3HKRA 4KW6A 3EWLA 1MD4A 4MLYA 3LG6A 3TUEA 4GWRA 1QMVA 1B8XA 2VM1A 4LMVA 1R7HA 4LA1A 1TP9A 4ECCA 1LJRA 2CA8A 2GLRA 2HFDA 1HNAA 3NZNA 5IPGA 4XHMA 2IFQB 5A4VA 1T7PB 3P2AA 3GRXA 3E0UA 4BVXA 3M9JA 2NBSA 4V2NA 3QCPA 1Q98A 4MDCA 3HZ4A 2V41A 3KCMA 4BL7A 4MZBA 1HNBA 3ZTLA 3TDGA 3MNGA 5D9XA 4YAVA 2LJRA 5AIVA 3Q18A 5AGYA 5IMZA 3F0IA 1KTEA 2VM2A 4FH8A 4MJBA 4X1UA 4MJCA 3G7IA 4AGSA 1VGLA 4YQMA 2YWIA 1AXDA 16GSA 5JWOB 4ACSA 2FUG2 5HFKA 3QOUA 4RI7A 2N5AA 5B8AA 4WR4A 3FEUA 4FYBA 1K0BA 1O8XA 1K0CA 4XIHA 1XW6A 3HY2A 1BEDA 4DVCA 3ZFLA 2XPDA 1M2DA 1SYRA 3H1NA 5DBQA 4MPFA 2DLXA 5CYYA 4MABA 3KP8A 2H30A 4MJEA 3F4RA 2H6YA 2V32A 3DKSA 6GSSA 2GQMA 5GAND 4GQCA 5KEJA 1TTZA 2HE3A 4KDYA 2L5OA 2OADA 3C1RA 3GHAA 3LFLA 2ON5A 3IDVA 2B5XA 4K1FA 3ZVJA 1PD21 3L4NA 1QFNA 5J9BA 2XBQA 1I5GA 3WD6A 1XVWA 1GH2A 3FZAA 1TK5B 2LRNA 3TJJA 4IQ1A 4FYCA
chains in the Genus database with same CATH superfamily
1XZOA 2HZFA 2R6KA 2YWNA 2E2GA 2H1BA 5LCZA 2LJAA 1VF1A 4G19A 1GTUA 3TOTA 1QQ2A 5IQYA 3KGKA 1O8WA 1PL1A 3KD0A 1ZCPA 4IBPA 4JR4A 1ILOA 3M8NA 2PUKC 4WBRD 1GTBA 3MIXA 4HS1A 3IE3A 2JZSA 4JE1A 2LEGA 1M9AA 2IMIA 2YWOA 4BVYA 4DSRA 4TOPA 4POLA 1JZWA 1THOA 2B5YA 4HUAA 4IJ3A 1ZYEA 3VFIA 5F05A 4YH2A 2GQLA 4CY6A 2KP2A 4TW5A 4PQ1A 3HJPA 2YZUA 4BL7B 5GSSA 4MNNA 1JLVA 2LQQA 2X99A 5IMAA 3RAZA 20GSA 4F0BA 2FWGA 5IMCA 4ZBDA 3TJKA 4IS0A 2LNTA 1W89A 2N5FA 3GFKA 4I97A 4MA9A 1ERWA 22GSA 2MMNA 3EU3A 2OA7A 5DJMA 4BWSA 3CSIA 1EEMA 3G9BA 5ECMB 3OR5A 4AJ7A 2ZCTA 3C71A 5L71A 2HSMA 4G0KA 3SWLA 2JSZA 1QUWA 3W6GA 2LS5A 19GSA 1XWCA 4OD7A 2FA8A 2TRCP 3IBHA 1XFLA 4F82A 3MWHA 5ECLB 4K7IA 3ZIJA 1OAZA 2H73A 5G5EA 3NIVA 4TVEA 4GQFA 1GULA 1V9WA 2P31A 3DD3A 5ELGA 8GSSA 1LBKA 2PGTA 2K18A 1PMTA 2C80A 3APSA 1J0FA 3VLNA 2LSTA 4Q5QA 3VPQA 4MPGA 4O5UA 4OMVA 5A5KA 3ERFA 1QGVA 1GTIA 5IOWA 4XS4A 1TK0B 1ML6A 10GSA 4ZBAA 3QAGA 1GLPA 1MDKA 4NPBA 3GKMA 2LTKA 1TI1A 3TJBA 1J08A 5CREA 5G1KA 2KUCA 3TKQA 3ZFBA 2WGRA 4GSNA 4EXJA 2AB6A 2DSAA 2BMXA 2CZ3A 1AQWA 2B5EA 4E8EA 5IIZA 2R0CA 2O7KA 2DC5A 1AW9A 4Z7XA 4ZBBA 5BRTA 4NV5A 2L4CA 1X9MB 2WB9A 4GCIA 1T4ZA 2R0PA 2DJJA 5DQSA 2MMAA 2DJKA 3HVXA 1GLQA 1EEJA 2AV4A 4HEA2 5ECNB 1M0UA 3LYPA 4JBBA 4IJIA 1NW2A 1X5CA 4IW9A 1AQXA 3HJMA 2QC7A 2CVKA 5D96A 3IAM2 2X8HA 2LUSA 2D2ZA 4OFNA 4TR3A 5LNKe 5IMDA 1BQ7A 3EU4A 2LJKA 3F6FA 1OKTA 3APOA 3G7JA 1TRSA 1DE2A 3TGZA 1ZZYA 1BX9A 1TI3A 3UMAA 3H4KA 2G0FA 2FLSA 6GSTA 2O85A 2O8VB 2IPAA 4PNGA 3VI7A 2HLSA 4AJ6A 1K0AA 5CP1A 4RI6A 5G5FA 1Z6NA 1JZRA 3AY8A 5F06A 2VCWA 3L0HA 2HSYA 3LJRA 3K8NA 4D73A 2PWJA 3GMFA 5J4UA 5D8IA 2K6VA 1E2YA 2HZEA 1WIKA 3HVVA 2AYTA 2B7KA 4IGJA 1FW1A 2JL4A 4TN8A 4DSQA 3IK7A 1A24A 1M2BA 4X43A 2PN8A 3TRQA 5D9WA 1PL2A 4G2EA 2C0DA 1G0TA 4WF5A 3UARA 2VCQA 3GH6A 1EV9A 2YJ7A 2YN1A 4FO5A 1MTCA 2A4HA 4ZIJA 4N10A 4CW9A 3J7Yb 3RHBA 2A4VA 3PH9A 3FKFA 3FYGA 1IYHA 1S3CA 2VCTA 1BJXA 1X9SB 4XS4B 2A2RA 3FZ4A 1UN2A 3BCKA 4EKZA 2X8CA 6GSVA 1Z6MA 4OFMA 2QGVA 4WBJA 9GSSA 3CYNA 4WR5A 3HJOA 3F6DA 2QKEA 5CRGA 4N0VA 1DE1A 3G7YA 4XTSA 1JHBA 2KLXA 3N5OA 1TRWA 2V1MA 5KN1A 2RLIA 5J41A 3ZLPA 2XBIA 5ECHB 3ZMLA 1UA5A 3FR6A 4NHWA 3BOAA 3F8UA 18GSA 2B1LA 1BYEA 1SD9A 4KSOA 2PU9C 1O6JA 1SK2A 5DCHA 5HR2A 2XPEA 5ECKB 4YQVA 4J57E 2YNXA 3GYKA 1WOUA 2M66A 2K8VA 2VL2A 2CAIA 5HR3A 3I6AA 2HYXA 4NMUA 4ICYA 2V6KA 4O32A 4ZL7A 2C0GA 3QDNA 3TRXA 4MZWA 3H8QA 4KF9A 1TRUA 4ZB8A 1T4YA 2FWHA 4ZL8A 2HXKA 1YEXA 2IMEA 6GSWA 1ZYPA 2GT5A 2F8FA 3UBLA 3TKPA 3QAWA 1X9WB 1SKWB 2GVPA 2WS2A 1XOAA 2GZPA 2L4QA 4LL4B 3EURA 4V1Ap 2BTOT 1ACVA 4ECBA 4OWYA 4EDYA 2LRCA 5ECOB 2MMZA 4RQXA 4YQUA 4K2DA 2NPBA 3D5JA 4EE0A 2HZEB 2AHEA 4EDZA 3GIXA 1WJKA 2DJ1A 4P3YB 3UVHA 1TW9A 4TXOB 2VD1A 5CRHA 3LWAA 3QMXA 4KDXA 4POMA 2YWMA 5G1LA 1M9BA 2KP1A 1NM3A 3DIEA 3DWVA 3GTUA 2VOCA 4MK3A 3GN3A 2EIQA 5IOXA 2E0QA 4JR6A 3M3MA 3FHKA 1VF3A 6GSXA 1K0DA 1M99A 2GSTA 3BBYA 4WEYA 3I9V2 1V40A 4PQHA 1FVKA 1MDJA 5JWQB 5CRDA 3UEMA 1ZGNA 2REMA 1GRXA 2PBJA 4KB3A 4ILFA 1GSDA 3DVWA 4GF0A 1XPVA 4V2LA 2VL2C 1EWXA 3V1WA 3A5IA 3F3QA 3DGQA 3L9SA 2FY6A 2L57A 3VWUA 3W8JA 3F9UA 2KOKA 5D73A 2DIZA 3UVTA 3PINA 1GNWA 4ID0A 2DJ3A 2GQKA 2MZCA 2VLTA 2G2QA 1PA3A 4TR1B 3WGXA 4MJAA 3VK9A 2H0GA 4HJ2A 2VO4A 2J9HA 2YANA 3WGDA 3M9KA 3UAPA 4HJMA 2VCXA 5HQPA 3EE2A 3C73A 3JCML 1F3AA 3QFBC 2H1AA 1SYXA 5IO2A 1SJIA 2WDUA 11GSA 2MBSA 5F8BA 4HU7A 2H6XA 2R5GA 5CRWA 1ZL9A 4Q5FA 3HZ8A 3WGEA 1DSBA 2HRFA 3GKNA 3VPTA 3MAKA 2C1YA 5CAXA 3APQA 1R26A 2ZNMA 3F4SA 4OO4A 3P8WA 4KX4A 2IWTA 1YKCA 1GWCA 3ME8A 5J5NA 4BVXB 3BCIA 2CVDA 5DCGA 1XIYA 2H76A 5DQYA 4JU5A 1U3AA 5JCGA 5ECSA 3ZIVA 2ES7A 3RBTA 2B1KA 1JZDA 4JEDA 1SK0A 3KTBA 1GL8A 5G30A 1USBA 2IJYA 1U6TA 1XBSA 7GSSA 2RIIA 1R4WA 5B6NA 1U3IA 1UVZA 4FIWA 2GZYA 3KMOA 4MH2A 3L9UA 3Q6OA 2E7PA 1Z7PA 4OO5A 2TIRA 5DALA 4FQUA 4MH3A 5HR0A 3HD5A 4XCSA 4L0WA 3ZRDA 1OE7A 3LORA 1FB6A 2C3NA 3ZITA 3GA4A 4YKGA 1GUKA 4L0UA 2M80A 5IO0A 3HDCA 1XWBA 3MSZA 3IRAA 4ULXA 2YV7A 2R3XA 2K9FA 3CSHA 4I8BA 1AC1A 1BG5A 4KNDA 2WJUA 4MCUA 4Z2RA 2FCHA 1KEBA 2M46A 1B9XC 3KMNA 1B9YC 1O81A 5E4WA 1K0OA 3Q74A 3FR3A 2DKIA 5J3RA 1FVJA 3ERGA 2CVBA 4PURA 5A4UA 4HDEA 2C0FA 2F8AA 1PQNA 3FR9A 1N2AA 5HFGA 2VL9A 4KGIA 4J2FA 1M3JA 1FOVA 1SJ6A 2AJQB 2X8GA 1Z5YE 3UIWA 4NAXA 1N8JA 4RQRA 4K7NA 3IHQA 2YOIA 2EC4A 1XWGA 5IPHA 2R0GA 4HZ4A 1XG8A 3CBUA 1E6BA 3IV4A 3ZL5A 1YJ6A 2JU5A 2MYGA 1PKZA 5ENUA 2KHPA 1SD8A 2EIOA 4MF7A 1GSYA 5ECRB 2L6DA 3VWXA 5HFIA 5J9CA 4DSSA 1Q4JA 5FWGA 1B4PA 3FZ5A 2R37A 3C7MA 3I43A 2CQ9A 5AIXA 1S3RA 1DBYA 1OC3A 1SENA 1A2JA 2PERA 4L8EA 1V98A 4EF0A 3US3A 2YV9A 3TKSA 4BVYB 2YP6A 3O76A 4NHZA 4MF5A 1FHEA 1K0NA 2DJ0A 2HRNA 3RPPA 3I69A 2RM6A 4PUFC 5H5QA 1ZOFA 3VWVA 5DVBA 2PPTA 1AIUA 2N5BA 2X49A 4N11A 4GXZA 5DJLA 4YKFA 1TRVA 1Z3EA 1Y6EA 3NOFA 3UOMA 1YF1A 3GURA 1YZXA 4HQSA 5ELAA 4Q5RA 3TKRA 4XS1A 3TKSE 2TRXA 1PFOA 2DIYA 1G7DA 2GSQA 1T8EB 3HA9A 1B4QA 3ZZXA 3KM6A 4G0IA 1A2LA 2DJ2A 2OE3A 4IN0A 2WZ9A 3L9VA 1MD3A 4MP4A 3QR6A 2OBIA 3HVSA 5EL8A 4F2IA 2GTUA 2GSRA 3C8EA 5GZZB 2IMDA 5ECQB 4IQAA 1WE0A 4GSTA 1JFUA 1ZYQB 3IA1A 1G6YA 4IELA 3LGCA 1X5DA 1VF4A 5H5SA 4CHSA 3RDWA 3WYWA 1V58A 1FAAA 1OYJA 5GAPD 1SKRB 2B6MA 2BJXA 2UZ8A 1PGTA 2L5LA 1DUGA 3N9JA 4EUYA 5E59A 2I1UA 1H4OA 5AN1A 5DDLA 3F63A 1RW1A 4I2UA 4V2MA 3S9FA 4TR0A 1M2AA 2FNOA 2EIRA 5EPFA 4Z2TA 2WRTA 3TKSC 2H74A 4EO3A 1SJZA 1RQMA 5B8BA 5B7CA 1I9DA 2HT9A 4HU9A 4TKYA 3PGTA 4TR4A 1B48A 3IC8A 4KAEA 4IP6A 3R3EA 3EINA 3W8SA 3A5WA 3J7Yk 3WT1A 4K6XA 4F0CA 1GSQA 1SL0B 4LMWA 1EGRA 4IP1A 3PPUA 4ZILA 1XWKA 2VLVA 4QL7A 2L6CA 3ZYWA 1URMA 2I81A 1K3OA 3U6VA 13GSA 1SKSB 3KJYA 1T00A 2VLUA 4NWYA 1ON4A 4O7HA 3ERWA 3TJFA 5FHIA 2OJLA 5IMFA 1YKAA 4L5OA 3ED3A 1YQ1A 3ZMKA 2V6OA 3DEXA 1ST9A 3DVXA 5GSTA 1OVNA 3MYDA 3DMLA 3FZ9A 2B3SA 1O7UA 1W4VA 4BWQA 1SL2B 2JACA 2X4AA 4DEJA 2MMOA 2DMMA 3O3TA 1PX6A 4D73B 1FO5A 1GP1A 4IVFA 4CY8A 1RK4A 2OACA 5DAKA 1FB0A 2GT6A 5CNWA 3UBKA 1ERUA 1PX7A 3D21A 3ME7A 2V2GA 2AAWA 2PVOC 2CV4A 2IMFA 2A2SA 1TDIA 3FY7A 2P5QA 1PRXA 2OBKA 4XS6A 5INYA 4WXTA 5JWRB 1GSUA 3MDKA 1YF0A 3GL5A 1TK8B 2Z9SA 5BMUA 5IM9A 1GSEA 3TRPA 5ID2A 2C3TA 3FK8A 3LEFA 1M7TA 3D22A 2H71A 2WULA 4AF2A 3GX0A 5D93A 2I9HA 2HSHA 3GL3A 1FG4A 2YCDA 5FT3A 4EVMA 2XHFA 3KH9A 4F03A 3EYTA 3KXOA 4OCEA 3KTLA 4PX1A 3R2QA 4K7OA 1X5EA 2HRAA 4I5QA 3WT2A 2A2PA 1O85A 3GSSA 3TJGA 1JLWA 1T1VA 4N30A 1O73A 4RUVA 1OC9A 2VUPA 3DRNA 2M72A 2C4JA 1TKDB 2FA4A 2C8UA 2O87A 5A4WA 2RUEA 1HQOA 5COHA 3CRTA 2FGXA 2LV3A 3BD2A 1OC8A 2FHEA 4Q5NA 4ECJA 1XWAA 1XW5A 4OFTA 1F9MA 1JZOA 2RM5A 2LQOA 4ML1A 1Z7RA 5KN2A 3GKKA 2H01A 3VURA 3IXRA 1K3LA 1F2EA 1C72A 5ABRA 3Q19A 2WFCA 4IKHA 4EC0A 2QA2A 1YEPA 1TU8A 1XVQA 2HI7A 1S3AA 2LRTA 2H1GA 4GLTA 2C3QA 3IAS2 3GX8A 3LXZA 4K5SA 5EVOA 2P0GA 3KH7A 3UL3A 1F3BA 3KEBA 4H86A 5G31A 2NDOA 2R2JA 4WF4A 4HOJA 4QQ7A 5DAKB 4YAPA 3F4TA 1PN9A 5F07A 3P7XA 6GSYA 3IR4A 1A0RP 1ERTA 3C1SA 2MBTA 1EOHA 2O89A 4K0GA 3GUSA 5D9VA 4WETA 1TJDA 3P90A 5EY6A 3EC3A 3FW2A 3RHCA 1XW9A 3LXTA 2X64A 2F9SA 3GTUB 4KCEA 1J9BA 2CX3A 4OCFA 4O92A 1EGOA 4KSMA 2DBCA 5ID2B 1BAYA 4E8HA 5JCUA 2H0HA 1XCCA 2ON7A 1WMJA 3KZQA 1OE8A 1XOBA 5KN0A 4PUAA 1CQHA 5JCWA 3A3TA 2XC2A 1GSFA 4ZB6A 3VWWA 2CZ2A 2I3YA 3IPZA 1AQVA 2DMLA 1A0FA 1ABAA 5G2ZA 5ECPB 1GTAA 1PN0A 2CAQA 3GV1A 2YZHA 4HI7A 3CTFA 5ECIB 1QXHA 3QFAC 1U87A 3E9JB 4PXOA 2H70A 3CSJA 3GH9A 1NHOA 4O5RA 3LYKA 1X0RA 5F0GA 3QD9A 1A2MA 3F3RA 3H79A 1IYIA 1R5PA 2QA1A 2I4AA 4POKA 1OC9B 1WRYA 2H8LA 12GSA 4GTUA 1ZYNA 4I6XA 3HXSA 2JADA 3FMWA 3TOUA 4KE3A 1AUCA 1F6MC 2GGTA 2VL3A 1AAZA 3IHGA 2VD0A 4V1Ag 1PKWA 2HNLA 4MZCA 4GSSA 1G7EA 4HSCX 4WKWA 3A2VA 3ZREA 1SL1B 5C04A 3QAVA 3CRUA 3KP9A 1EZKA 2CT6A 2JZTA 2ZUPA 4HZ2A 5CO3A 4JRRA 1PSQA 2JZRA 1G7OA 1TXXA 1NSWA 2QSIA 4ZL9A 3VI5A 4NV2A 1G6WA 2IMKA 3EVIA 4ML6A 3HHVA 4ECIA 3RPNA 1UC7A 1ZMAA 1GSSA 4XRDA 4POBA 2VAFA 1V57A 4K5RA 4K0NA 1KNGA 2JSYA 4PGTA 1SK1A 4BA7A 1K0MA 5C00A 4GRFA 2NTOA 4KA0A 4TRXA 3H93A 2CX4A 4N0ZA 4LL1B 4KCAA 3GNJA 2RUFA 2H19A 5AISA 1WPIA 4EIQA 1KBNA 4QL9A 5KOXA 1Y25A 2OE0A 2E2MA 3DXBA 2H6ZA 3SBCA 4LLRA 2F51A 3ZVJD 1VF2A 1YY7A 3D4MA 5HR1A 2YJHA 3CXGA 3IK9A 3A2XA 1SU9A 5DALB 3TCOA 5H5RA 3D6IA 1XXUA 5B6MA 4PQIA 4EL1A 1MEKA 2R4VA 2FD3A 1TU7A 4CDOA 2H72A 1T3BA 4G10A 1GNEA 3EMXA 4K2XA 5IMVA 1EOGA 1EV4A 2P5RA 4K9ZA 2VCVA 5LD0A 2FWEA 3GSTA 3L78A 4J56E 1A8LA 2GZZA 1QK8A 17GSA 2PVQA 2IFQA 3QPMA 2VIMA 3IC4A 3CMIA 3IOSA 4HQZA 3KIJA 4KUNA 2FWFA 4ZXGA 2LKUA 4X4JA 4G9HA 4NXIA 2PMTA 1HYUA 1MDIA 1Z9HA 3BJ5A 2GDRA 2H75A 4K8MA 1HD2A 2H1DA 3E3EA 3FRCA 4TXVA 2WCIA 2IN3A 3LW9A 2J23A 4TXOA 3HYPA 1EP7A 2HRKA 4BIKA 2OE1A 1WWJA 3D0ZA 1H75A 4MF6A 2GSSA 1YDKA 1F37A 1HNCA 3HCZA 1TOFA 4FYUA 1V2AA 3PR8A 3D4TA 3LQ7A 1WP0A 1R5AA 2L59A 4MMMA 2LNSA 4XRAA 2AUVA 4DSSB 2NVLA 1GUHA 4AJ8A 4ZB9A 1NHYA 4I2TA 1EP8A 6GSUA 3CQFA 1LU4A 3UJ1A 4BPYA 3TB2A 3GKXA 3EMPA 4PNFA 4ISDA 4X0XA 1GUMA 3U5RE 1CQGA 1K3YA 2GS3A 2C0EA 2OKAA 2IIYA 1M3IA 1S3DA 1A23A 4G0LA 4TR1A 1THXA 1VRSD 1A8YA 1ERVA 5D9TA 3CTGA 3DYRA 2YPMA 4KH7A 3M0FA 4IHUA 2H0IA 2B7JA 2F3MA 4F9ZA 4USSA 4Z2UA 3M1GA 5KN3A 3EPTA 2IL3A 1U88A 3LSZA 4KDUA 14GSA 2K8SA 4JZQA 3ISOA 2VCZA 2ALBA 4L5LA 3A2WA 2H66A 1OKDA 2DKHA 3O6TA 3HKRA 4KW6A 3EWLA 1MD4A 4MLYA 3LG6A 3TUEA 4GWRA 1QMVA 1B8XA 2VM1A 4LMVA 1R7HA 4LA1A 1TP9A 4ECCA 1LJRA 2CA8A 2GLRA 2HFDA 1HNAA 4O5QA 3NZNA 5IPGA 4XHMA 2IFQB 5A4VA 1T7PB 3P2AA 3GRXA 3E0UA 4BVXA 3M9JA 2NBSA 4V2NA 3QCPA 1Q98A 4MDCA 1FOHA 3HZ4A 2V41A 4A5PA 3KCMA 4BL7A 4MZBA 1HNBA 3ZTLA 3TDGA 3MNGA 5D9XA 4YAVA 2LJRA 5AIVA 3Q18A 5AGYA 5IMZA 3F0IA 1KTEA 2VM2A 4FH8A 3HVNA 4MJBA 4PTSA 4X1UA 4MJCA 3G7IA 4AGSA 1VGLA 4YQMA 2YWIA 1AXDA 16GSA 5JWOB 4ACSA 2FUG2 5HFKA 3QOUA 4RI7A 2N5AA 5B8AA 4WR4A 3FEUA 4FYBA 1K0BA 1O8XA 1K0CA 4XIHA 1XW6A 3HY2A 1BEDA 4DVCA 3ZFLA 2XPDA 1M2DA 1SYRA 3H1NA 5DBQA 4MPFA 2DLXA 5CYYA 4MABA 3KP8A 2H30A 4MJEA 3F4RA 2H6YA 2V32A 3DKSA 6GSSA 2GQMA 5GAND 4GQCA 5KEJA 1TTZA 2HE3A 4KDYA 2L5OA 2OADA 3C1RA 3GHAA 3LFLA 2ON5A 3IDVA 5KOWA 2B5XA 4K1FA 3ZVJA 1PD21 3L4NA 1QFNA 5J9BA 2XBQA 1I5GA 3WD6A 1XVWA 1GH2A 3FZAA 4EIPA 1TK5B 2LRNA 3TJJA 4IQ1A 4FYCA
chains in the Genus database with same CATH topology
1XZOA 2HZFA 2R6KA 2YWNA 2E2GA 2H1BA 5LCZA 2LJAA 1VF1A 4G19A 1GTUA 3TOTA 1QQ2A 5IQYA 3KGKA 1O8WA 1PL1A 3KD0A 1ZCPA 4IBPA 4JR4A 1ILOA 3M8NA 2PUKC 4WBRD 1GTBA 3MIXA 4HS1A 3IE3A 2JZSA 4JE1A 2LEGA 1M9AA 2IMIA 2YWOA 4BVYA 4DSRA 4TOPA 4POLA 1JZWA 1THOA 2B5YA 4HUAA 4IJ3A 1ZYEA 3VFIA 5F05A 4YH2A 2GQLA 4CY6A 2KP2A 4TW5A 4PQ1A 3HJPA 2YZUA 4BL7B 5GSSA 4MNNA 1JLVA 2LQQA 2X99A 5IMAA 3RAZA 20GSA 4F0BA 2FWGA 5IMCA 4ZBDA 3TJKA 4IS0A 2LNTA 1W89A 2N5FA 3GFKA 4I97A 4MA9A 1ERWA 22GSA 2MMNA 3EU3A 2OA7A 5DJMA 4BWSA 3CSIA 1EEMA 3G9BA 5ECMB 3OR5A 4AJ7A 2ZCTA 3C71A 5L71A 2HSMA 4G0KA 3SWLA 2JSZA 1QUWA 3W6GA 2LS5A 19GSA 1XWCA 4OD7A 2FA8A 2TRCP 3IBHA 1XFLA 4F82A 3MWHA 5ECLB 4K7IA 3ZIJA 1OAZA 2H73A 5G5EA 3NIVA 4TVEA 4GQFA 1GULA 1V9WA 2P31A 3DD3A 5ELGA 8GSSA 1LBKA 2PGTA 2K18A 1PMTA 2C80A 3APSA 1J0FA 3VLNA 2LSTA 4Q5QA 3VPQA 4MPGA 4O5UA 4OMVA 5A5KA 3ERFA 1QGVA 1GTIA 5IOWA 4XS4A 1TK0B 1ML6A 10GSA 4ZBAA 3QAGA 1GLPA 1MDKA 4NPBA 3GKMA 2LTKA 1TI1A 3TJBA 1J08A 5CREA 5G1KA 2KUCA 3TKQA 3ZFBA 2WGRA 4GSNA 4EXJA 2AB6A 2DSAA 2BMXA 2CZ3A 1AQWA 2B5EA 4E8EA 5IIZA 2R0CA 2O7KA 2DC5A 1AW9A 4Z7XA 4ZBBA 5BRTA 4NV5A 2L4CA 1X9MB 2WB9A 4GCIA 1T4ZA 2R0PA 2DJJA 5DQSA 2MMAA 2DJKA 3HVXA 1GLQA 1EEJA 2AV4A 4HEA2 5ECNB 1M0UA 3LYPA 4JBBA 4IJIA 1NW2A 1X5CA 4IW9A 1AQXA 3HJMA 2QC7A 2CVKA 5D96A 3IAM2 2X8HA 2LUSA 2D2ZA 4OFNA 4TR3A 5LNKe 5IMDA 1BQ7A 3EU4A 2LJKA 3F6FA 1OKTA 3APOA 3G7JA 1TRSA 1DE2A 3TGZA 1ZZYA 1BX9A 1TI3A 3UMAA 3H4KA 2G0FA 2FLSA 6GSTA 2O85A 2O8VB 2IPAA 4PNGA 3VI7A 2HLSA 4AJ6A 1K0AA 5CP1A 4RI6A 5G5FA 1Z6NA 1JZRA 3AY8A 5F06A 2VCWA 3L0HA 2HSYA 3LJRA 3K8NA 4D73A 2PWJA 3GMFA 5J4UA 5D8IA 2K6VA 1E2YA 2HZEA 1WIKA 3HVVA 2AYTA 2B7KA 4IGJA 1FW1A 2JL4A 4TN8A 4DSQA 3IK7A 1A24A 1M2BA 4X43A 2PN8A 3TRQA 5D9WA 1PL2A 4G2EA 2C0DA 1G0TA 4WF5A 3UARA 2VCQA 3GH6A 1EV9A 2YJ7A 2YN1A 4FO5A 1MTCA 2A4HA 4ZIJA 4N10A 4CW9A 3J7Yb 3RHBA 2A4VA 3PH9A 3FKFA 3FYGA 1IYHA 1S3CA 2VCTA 1BJXA 1X9SB 4XS4B 2A2RA 3FZ4A 1UN2A 3BCKA 4EKZA 2X8CA 6GSVA 1Z6MA 4OFMA 2QGVA 4WBJA 9GSSA 3CYNA 4WR5A 3HJOA 3F6DA 2QKEA 5CRGA 4N0VA 1DE1A 3G7YA 4XTSA 1JHBA 2KLXA 3N5OA 1TRWA 2V1MA 5KN1A 2RLIA 5J41A 3ZLPA 2XBIA 5ECHB 3ZMLA 1UA5A 3FR6A 4NHWA 3BOAA 3F8UA 18GSA 2B1LA 1BYEA 1SD9A 4KSOA 2PU9C 1O6JA 1SK2A 5DCHA 5HR2A 2XPEA 5ECKB 4YQVA 4J57E 2YNXA 3GYKA 1WOUA 2M66A 2K8VA 2VL2A 2CAIA 5HR3A 3I6AA 2HYXA 4NMUA 4ICYA 2V6KA 4O32A 4ZL7A 2C0GA 3QDNA 3TRXA 4MZWA 3H8QA 4KF9A 1TRUA 4ZB8A 1T4YA 2FWHA 4ZL8A 2HXKA 1YEXA 2IMEA 6GSWA 1ZYPA 2GT5A 2F8FA 3UBLA 3TKPA 3QAWA 1X9WB 1SKWB 2GVPA 2WS2A 1XOAA 2GZPA 2L4QA 4LL4B 3EURA 4V1Ap 2BTOT 1ACVA 4ECBA 4OWYA 4EDYA 2LRCA 5ECOB 2MMZA 4RQXA 4YQUA 4K2DA 2NPBA 3D5JA 4EE0A 2HZEB 2AHEA 4EDZA 3GIXA 1WJKA 2DJ1A 4P3YB 3UVHA 1TW9A 4TXOB 2VD1A 5CRHA 3LWAA 3QMXA 4KDXA 4POMA 2YWMA 5G1LA 1M9BA 2KP1A 1NM3A 3DIEA 3DWVA 3GTUA 2VOCA 4MK3A 3GN3A 2EIQA 5IOXA 2E0QA 4JR6A 3M3MA 3FHKA 1VF3A 6GSXA 1K0DA 1M99A 2GSTA 3BBYA 4WEYA 3I9V2 1V40A 4PQHA 1FVKA 1MDJA 5JWQB 5CRDA 3UEMA 1ZGNA 2REMA 1GRXA 2PBJA 4KB3A 4ILFA 1GSDA 3DVWA 4GF0A 1XPVA 4V2LA 2VL2C 1EWXA 3V1WA 3A5IA 3F3QA 3DGQA 3L9SA 2FY6A 2L57A 3VWUA 3W8JA 3F9UA 2KOKA 5D73A 2DIZA 3UVTA 3PINA 1GNWA 4ID0A 2DJ3A 2GQKA 2MZCA 2VLTA 2G2QA 1PA3A 4TR1B 3WGXA 4MJAA 3VK9A 2H0GA 4HJ2A 2VO4A 2J9HA 2YANA 3WGDA 3M9KA 3UAPA 4HJMA 2VCXA 5HQPA 3EE2A 3C73A 3JCML 1F3AA 3QFBC 2H1AA 1SYXA 5IO2A 1SJIA 2WDUA 11GSA 2MBSA 5F8BA 4HU7A 2H6XA 2R5GA 5CRWA 1ZL9A 4Q5FA 3HZ8A 3WGEA 1DSBA 2HRFA 3GKNA 3VPTA 3MAKA 2C1YA 5CAXA 3APQA 1R26A 2ZNMA 3F4SA 4OO4A 3P8WA 4KX4A 2IWTA 1YKCA 1GWCA 3ME8A 5J5NA 4BVXB 3BCIA 2CVDA 5DCGA 1XIYA 2H76A 5DQYA 4JU5A 1U3AA 5JCGA 5ECSA 3ZIVA 2ES7A 3RBTA 2B1KA 1JZDA 4JEDA 1SK0A 3KTBA 1GL8A 5G30A 1USBA 2IJYA 1U6TA 1XBSA 7GSSA 2RIIA 1R4WA 5B6NA 1U3IA 1UVZA 4FIWA 2GZYA 3KMOA 4MH2A 3L9UA 3Q6OA 2E7PA 1Z7PA 4OO5A 2TIRA 5DALA 4FQUA 4MH3A 5HR0A 3HD5A 4XCSA 4L0WA 3ZRDA 1OE7A 3LORA 1FB6A 2C3NA 3ZITA 3GA4A 4YKGA 1GUKA 4L0UA 2M80A 5IO0A 3HDCA 1XWBA 3MSZA 3IRAA 4ULXA 2YV7A 2R3XA 2K9FA 3CSHA 4I8BA 1AC1A 1BG5A 4KNDA 2WJUA 4MCUA 4Z2RA 2FCHA 1KEBA 2M46A 1B9XC 3KMNA 1B9YC 1O81A 5E4WA 1K0OA 3Q74A 3FR3A 2DKIA 5J3RA 1FVJA 3ERGA 2CVBA 4PURA 5A4UA 4HDEA 2C0FA 2F8AA 1PQNA 3FR9A 1N2AA 5HFGA 2VL9A 4KGIA 4J2FA 1FOVA 1SJ6A 2AJQB 2X8GA 1Z5YE 3UIWA 4NAXA 1N8JA 4RQRA 4K7NA 3IHQA 2YOIA 2EC4A 1XWGA 5IPHA 2R0GA 4HZ4A 3CBUA 1E6BA 3IV4A 3ZL5A 1YJ6A 2JU5A 2MYGA 1PKZA 5ENUA 2KHPA 1SD8A 2EIOA 4MF7A 1GSYA 5ECRB 2L6DA 3VWXA 5HFIA 5J9CA 4DSSA 1Q4JA 5FWGA 1B4PA 3FZ5A 2R37A 3C7MA 3I43A 2CQ9A 5AIXA 1DBYA 1OC3A 1SENA 1A2JA 2PERA 4L8EA 1V98A 4EF0A 3US3A 2YV9A 3TKSA 4BVYB 2YP6A 3O76A 4NHZA 4MF5A 1FHEA 1K0NA 2DJ0A 2HRNA 3RPPA 3I69A 2RM6A 4PUFC 5H5QA 1ZOFA 3VWVA 5DVBA 2PPTA 1AIUA 2N5BA 2X49A 4N11A 4GXZA 5DJLA 4YKFA 1TRVA 1Z3EA 1Y6EA 3NOFA 3UOMA 1YF1A 3GURA 1YZXA 4HQSA 5ELAA 4Q5RA 3TKRA 4XS1A 3TKSE 2TRXA 2DIYA 1G7DA 2GSQA 1T8EB 3HA9A 1B4QA 3ZZXA 3KM6A 4G0IA 1A2LA 2DJ2A 2OE3A 4IN0A 2WZ9A 3L9VA 1MD3A 4MP4A 3QR6A 2OBIA 3HVSA 5EL8A 4F2IA 2GTUA 2GSRA 3C8EA 5GZZB 2IMDA 5ECQB 4IQAA 1WE0A 4GSTA 1JFUA 1ZYQB 3IA1A 1G6YA 4IELA 3LGCA 1X5DA 1VF4A 5H5SA 4CHSA 3RDWA 3WYWA 1V58A 1FAAA 1OYJA 5GAPD 1SKRB 2B6MA 2BJXA 2UZ8A 1PGTA 2L5LA 1DUGA 3N9JA 4EUYA 5E59A 2I1UA 1H4OA 5AN1A 5DDLA 3F63A 1RW1A 4I2UA 4V2MA 3S9FA 4TR0A 1M2AA 2FNOA 2EIRA 5EPFA 4Z2TA 2WRTA 3TKSC 2H74A 4EO3A 1SJZA 1RQMA 5B8BA 5B7CA 1I9DA 2HT9A 4HU9A 4TKYA 3PGTA 4TR4A 1B48A 3IC8A 4KAEA 4IP6A 3R3EA 3EINA 3W8SA 3A5WA 3J7Yk 3WT1A 4K6XA 4F0CA 1GSQA 1SL0B 4LMWA 1EGRA 4IP1A 3PPUA 4ZILA 1XWKA 2VLVA 4QL7A 2L6CA 3ZYWA 1URMA 2I81A 1K3OA 3U6VA 13GSA 1SKSB 3KJYA 1T00A 2VLUA 4NWYA 1ON4A 4O7HA 3ERWA 3TJFA 5FHIA 2OJLA 5IMFA 1YKAA 4L5OA 3ED3A 1YQ1A 3ZMKA 2V6OA 3DEXA 1ST9A 3DVXA 5GSTA 1OVNA 3MYDA 3DMLA 3FZ9A 2B3SA 1O7UA 1W4VA 4BWQA 1SL2B 2JACA 2X4AA 4DEJA 2MMOA 2DMMA 3O3TA 1PX6A 4D73B 1FO5A 1GP1A 4IVFA 4CY8A 1RK4A 2OACA 5DAKA 1FB0A 2GT6A 5CNWA 3UBKA 1ERUA 1PX7A 3D21A 3ME7A 2V2GA 2AAWA 2PVOC 2CV4A 2IMFA 2A2SA 1TDIA 3FY7A 2P5QA 1PRXA 2OBKA 4XS6A 5INYA 4WXTA 5JWRB 1GSUA 3MDKA 1YF0A 3GL5A 1TK8B 2Z9SA 5BMUA 5IM9A 1GSEA 3TRPA 5ID2A 2C3TA 3FK8A 3LEFA 1M7TA 3D22A 2H71A 2WULA 4AF2A 3GX0A 5D93A 2I9HA 2HSHA 3GL3A 1FG4A 2YCDA 5FT3A 4EVMA 2XHFA 3KH9A 4F03A 3EYTA 3KXOA 4OCEA 3KTLA 4PX1A 3R2QA 4K7OA 1X5EA 2HRAA 4I5QA 3WT2A 2A2PA 1O85A 3GSSA 3TJGA 1JLWA 1T1VA 4N30A 1O73A 4RUVA 1OC9A 2VUPA 3DRNA 2M72A 2C4JA 1TKDB 2FA4A 2C8UA 2O87A 5A4WA 2RUEA 1HQOA 5COHA 3CRTA 2FGXA 2LV3A 3BD2A 1OC8A 2FHEA 4Q5NA 4ECJA 1XWAA 1XW5A 4OFTA 1F9MA 1JZOA 2RM5A 2LQOA 4ML1A 1Z7RA 5KN2A 3GKKA 2H01A 3VURA 3IXRA 1K3LA 1F2EA 1C72A 5ABRA 3Q19A 2WFCA 4IKHA 4EC0A 2QA2A 1YEPA 1TU8A 1XVQA 2HI7A 1S3AA 2LRTA 2H1GA 4GLTA 2C3QA 3IAS2 3GX8A 3LXZA 4K5SA 5EVOA 2P0GA 3KH7A 3UL3A 1F3BA 3KEBA 4H86A 5G31A 2NDOA 2R2JA 4WF4A 4HOJA 4QQ7A 5DAKB 4YAPA 3F4TA 1PN9A 5F07A 3P7XA 6GSYA 3IR4A 1A0RP 1ERTA 3C1SA 2MBTA 1EOHA 2O89A 4K0GA 3GUSA 5D9VA 4WETA 1TJDA 3P90A 5EY6A 3EC3A 3FW2A 3RHCA 1XW9A 3LXTA 2X64A 2F9SA 3GTUB 4KCEA 1J9BA 2CX3A 4OCFA 4O92A 1EGOA 4KSMA 2DBCA 5ID2B 1BAYA 4E8HA 5JCUA 2H0HA 1XCCA 2ON7A 1WMJA 3KZQA 1OE8A 1XOBA 5KN0A 4PUAA 1CQHA 5JCWA 3A3TA 2XC2A 1GSFA 4ZB6A 3VWWA 2CZ2A 2I3YA 3IPZA 1AQVA 2DMLA 1A0FA 1ABAA 5G2ZA 5ECPB 1GTAA 1PN0A 2CAQA 3GV1A 2YZHA 4HI7A 3CTFA 5ECIB 1QXHA 3QFAC 1U87A 3E9JB 4PXOA 2H70A 3CSJA 3GH9A 1NHOA 4O5RA 3LYKA 1X0RA 5F0GA 3QD9A 1A2MA 3F3RA 3H79A 1IYIA 1R5PA 2QA1A 2I4AA 4POKA 1OC9B 1WRYA 2H8LA 12GSA 4GTUA 1ZYNA 4I6XA 3HXSA 2JADA 3FMWA 3TOUA 4KE3A 1AUCA 1F6MC 2GGTA 2VL3A 1AAZA 3IHGA 2VD0A 4V1Ag 1PKWA 2HNLA 4MZCA 4GSSA 1G7EA 4WKWA 3A2VA 3ZREA 1SL1B 5C04A 3QAVA 3CRUA 3KP9A 1EZKA 2CT6A 2JZTA 2ZUPA 4HZ2A 5CO3A 4JRRA 1PSQA 2JZRA 1G7OA 1TXXA 1NSWA 2QSIA 4ZL9A 3VI5A 4NV2A 1G6WA 2IMKA 3EVIA 4ML6A 3HHVA 4ECIA 3RPNA 1UC7A 1ZMAA 1GSSA 4XRDA 4POBA 2VAFA 1V57A 4K5RA 4K0NA 1KNGA 2JSYA 4PGTA 1SK1A 4BA7A 1K0MA 5C00A 4GRFA 2NTOA 4KA0A 4TRXA 3H93A 2CX4A 4N0ZA 4LL1B 4KCAA 3GNJA 2RUFA 2H19A 5AISA 1WPIA 4EIQA 1KBNA 4QL9A 5KOXA 1Y25A 2OE0A 2E2MA 3DXBA 2H6ZA 3SBCA 4LLRA 2F51A 3ZVJD 1VF2A 1YY7A 3D4MA 5HR1A 2YJHA 3CXGA 3IK9A 3A2XA 1SU9A 5DALB 3TCOA 5H5RA 3D6IA 1XXUA 5B6MA 4PQIA 4EL1A 1MEKA 2R4VA 2FD3A 1TU7A 4CDOA 2H72A 1T3BA 4G10A 1GNEA 3EMXA 4K2XA 5IMVA 1EOGA 1EV4A 2P5RA 4K9ZA 2VCVA 5LD0A 2FWEA 3GSTA 3L78A 4J56E 1A8LA 2GZZA 1QK8A 17GSA 2PVQA 2IFQA 3QPMA 2VIMA 3IC4A 3CMIA 3IOSA 4HQZA 3KIJA 4KUNA 2FWFA 4ZXGA 2LKUA 4X4JA 4G9HA 4NXIA 2PMTA 1HYUA 1MDIA 1Z9HA 3BJ5A 2GDRA 2H75A 4K8MA 1HD2A 2H1DA 3E3EA 3FRCA 4TXVA 2WCIA 2IN3A 3LW9A 2J23A 4TXOA 3HYPA 1EP7A 2HRKA 2OE1A 1WWJA 3D0ZA 1H75A 4MF6A 2GSSA 1YDKA 1F37A 1HNCA 3HCZA 1TOFA 4FYUA 1V2AA 3PR8A 3D4TA 3LQ7A 1WP0A 1R5AA 2L59A 4MMMA 2LNSA 4XRAA 2AUVA 4DSSB 2NVLA 1GUHA 4AJ8A 4ZB9A 1NHYA 4I2TA 1EP8A 6GSUA 1LU4A 3UJ1A 4BPYA 3TB2A 3GKXA 3EMPA 4PNFA 4ISDA 4X0XA 1GUMA 3U5RE 1CQGA 1K3YA 2GS3A 2C0EA 2OKAA 2IIYA 1S3DA 1A23A 4G0LA 4TR1A 1THXA 1VRSD 1A8YA 1ERVA 5D9TA 3CTGA 3DYRA 2YPMA 4KH7A 3M0FA 4IHUA 2H0IA 2B7JA 2F3MA 4F9ZA 4USSA 4Z2UA 3M1GA 5KN3A 3EPTA 2IL3A 1U88A 3LSZA 4KDUA 14GSA 2K8SA 4JZQA 3ISOA 2VCZA 2ALBA 4L5LA 3A2WA 2H66A 1OKDA 2DKHA 3O6TA 3HKRA 4KW6A 3EWLA 1MD4A 4MLYA 3LG6A 3TUEA 4GWRA 1QMVA 1B8XA 2VM1A 4LMVA 1R7HA 4LA1A 1TP9A 4ECCA 1LJRA 2CA8A 2GLRA 2HFDA 1HNAA 4O5QA 3NZNA 5IPGA 4XHMA 2IFQB 5A4VA 1T7PB 3P2AA 3GRXA 3E0UA 4BVXA 3M9JA 2NBSA 4V2NA 3QCPA 1Q98A 4MDCA 1FOHA 3HZ4A 2V41A 4A5PA 3KCMA 4BL7A 4MZBA 1HNBA 3ZTLA 3TDGA 3MNGA 5D9XA 4YAVA 2LJRA 5AIVA 3Q18A 5AGYA 5IMZA 3F0IA 1KTEA 2VM2A 4FH8A 4MJBA 4PTSA 4X1UA 4MJCA 3G7IA 4AGSA 1VGLA 4YQMA 2YWIA 1AXDA 16GSA 5JWOB 4ACSA 2FUG2 5HFKA 3QOUA 4RI7A 2N5AA 5B8AA 4WR4A 3FEUA 4FYBA 1K0BA 1O8XA 1K0CA 4XIHA 1XW6A 3HY2A 1BEDA 4DVCA 3ZFLA 2XPDA 1M2DA 1SYRA 3H1NA 5DBQA 4MPFA 2DLXA 5CYYA 4MABA 3KP8A 2H30A 4MJEA 3F4RA 2H6YA 2V32A 3DKSA 6GSSA 2GQMA 5GAND 4GQCA 5KEJA 1TTZA 2HE3A 4KDYA 2L5OA 2OADA 3C1RA 3GHAA 3LFLA 2ON5A 3IDVA 5KOWA 2B5XA 4K1FA 3ZVJA 1PD21 3L4NA 1QFNA 5J9BA 2XBQA 1I5GA 3WD6A 1XVWA 1GH2A 3FZAA 4EIPA 1TK5B 2LRNA 3TJJA 4IQ1A 4FYCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XZO A;  2HZF A;  2R6K A;  2YWN A;  2E2G A;  2H1B A;  5LCZ A;  2LJA A;  1VF1 A;  4G19 A;  1GTU A;  3TOT A;  1QQ2 A;  5IQY A;  3KGK A;  1O8W A;  1PL1 A;  3KD0 A;  1ZCP A;  4IBP A;  4JR4 A;  1ILO A;  3M8N A;  2PUK C;  4WBR D;  1GTB A;  4HS1 A;  3IE3 A;  2JZS A;  4JE1 A;  2LEG A;  1M9A A;  2IMI A;  2YWO A;  4BVY A;  4DSR A;  4TOP A;  4POL A;  1JZW A;  1THO A;  2B5Y A;  4HUA A;  4IJ3 A;  1ZYE A;  3VFI A;  5F05 A;  4YH2 A;  2GQL A;  2KP2 A;  4TW5 A;  4PQ1 A;  3HJP A;  2YZU A;  5GSS A;  1JLV A;  2LQQ A;  2X99 A;  5IMA A;  3RAZ A;  20GS A;  4F0B A;  2FWG A;  5IMC A;  4ZBD A;  3TJK A;  4IS0 A;  2LNT A;  1W89 A;  2N5F A;  3GFK A;  4I97 A;  4MA9 A;  1ERW A;  22GS A;  2MMN A;  3EU3 A;  2OA7 A;  5DJM A;  4BWS A;  3CSI A;  1EEM A;  3G9B A;  5ECM B;  3OR5 A;  4AJ7 A;  2ZCT A;  3C71 A;  5L71 A;  3SWL A;  2JSZ A;  1QUW A;  3W6G A;  2LS5 A;  19GS A;  1XWC A;  4OD7 A;  2FA8 A;  2TRC P;  3IBH A;  1XFL A;  4F82 A;  3MWH A;  5ECL B;  4K7I A;  3ZIJ A;  1OAZ A;  2H73 A;  5G5E A;  3NIV A;  4TVE A;  4GQF A;  1GUL A;  1V9W A;  2P31 A;  3DD3 A;  5ELG A;  8GSS A;  1LBK A;  2PGT A;  2K18 A;  1PMT A;  2C80 A;  3APS A;  1J0F A;  3VLN A;  2LST A;  4Q5Q A;  3VPQ A;  4MPG A;  4OMV A;  5A5K A;  3ERF A;  1QGV A;  1GTI A;  5IOW A;  4XS4 A;  1TK0 B;  1ML6 A;  10GS A;  4ZBA A;  3QAG A;  1GLP A;  1MDK A;  4NPB A;  3GKM A;  2LTK A;  1TI1 A;  3TJB A;  1J08 A;  5CRE A;  5G1K A;  2KUC A;  3TKQ A;  3ZFB A;  2WGR A;  4GSN A;  4EXJ A;  2AB6 A;  2DSA A;  2BMX A;  2CZ3 A;  1AQW A;  2B5E A;  4E8E A;  5IIZ A;  2O7K A;  2DC5 A;  1AW9 A;  4Z7X A;  4ZBB A;  4NV5 A;  2L4C A;  1X9M B;  2WB9 A;  4GCI A;  1T4Z A;  2DJJ A;  5DQS A;  2MMA A;  2DJK A;  3HVX A;  1GLQ A;  1EEJ A;  2AV4 A;  4HEA 2;  5ECN B;  1M0U A;  3LYP A;  4JBB A;  4IJI A;  1NW2 A;  1X5C A;  4IW9 A;  1AQX A;  3HJM A;  2QC7 A;  2CVK A;  5D96 A;  3IAM 2;  2X8H A;  2LUS A;  2D2Z A;  4OFN A;  4TR3 A;  5LNK e;  5IMD A;  1BQ7 A;  3EU4 A;  2LJK A;  3F6F A;  1OKT A;  3APO A;  3G7J A;  1TRS A;  1DE2 A;  3TGZ A;  1ZZY A;  1BX9 A;  1TI3 A;  3UMA A;  3H4K A;  2G0F A;  2FLS A;  6GST A;  2O85 A;  2O8V B;  2IPA A;  4PNG A;  3VI7 A;  2HLS A;  4AJ6 A;  1K0A A;  5CP1 A;  4RI6 A;  5G5F A;  1Z6N A;  1JZR A;  3AY8 A;  5F06 A;  2VCW A;  3L0H A;  2HSY A;  3LJR A;  3K8N A;  4D73 A;  2PWJ A;  3GMF A;  5J4U A;  5D8I A;  2K6V A;  1E2Y A;  2HZE A;  1WIK A;  3HVV A;  2AYT A;  2B7K A;  4IGJ A;  1FW1 A;  2JL4 A;  4TN8 A;  4DSQ A;  3IK7 A;  1A24 A;  1M2B A;  4X43 A;  2PN8 A;  3TRQ A;  5D9W A;  1PL2 A;  4G2E A;  2C0D A;  1G0T A;  4WF5 A;  3UAR A;  2VCQ A;  3GH6 A;  1EV9 A;  2YJ7 A;  2YN1 A;  4FO5 A;  1MTC A;  4ZIJ A;  4N10 A;  4CW9 A;  3J7Y b;  3RHB A;  2A4V A;  3PH9 A;  3FKF A;  3FYG A;  1IYH A;  1S3C A;  2VCT A;  1BJX A;  1X9S B;  4XS4 B;  2A2R A;  3FZ4 A;  1UN2 A;  3BCK A;  4EKZ A;  2X8C A;  6GSV A;  1Z6M A;  4OFM A;  2QGV A;  4WBJ A;  9GSS A;  3CYN A;  4WR5 A;  3HJO A;  3F6D A;  2QKE A;  5CRG A;  4N0V A;  1DE1 A;  3G7Y A;  4XTS A;  1JHB A;  2KLX A;  3N5O A;  1TRW A;  2V1M A;  5KN1 A;  2RLI A;  5J41 A;  3ZLP A;  2XBI A;  5ECH B;  3ZML A;  1UA5 A;  3FR6 A;  4NHW A;  3BOA A;  3F8U A;  18GS A;  2B1L A;  1BYE A;  1SD9 A;  4KSO A;  2PU9 C;  1O6J A;  1SK2 A;  5DCH A;  5HR2 A;  2XPE A;  5ECK B;  4YQV A;  4J57 E;  2YNX A;  3GYK A;  1WOU A;  2M66 A;  2K8V A;  2VL2 A;  2CAI A;  5HR3 A;  3I6A A;  2HYX A;  4NMU A;  2V6K A;  4O32 A;  4ZL7 A;  2C0G A;  3QDN A;  3TRX A;  4MZW A;  3H8Q A;  1TRU A;  4ZB8 A;  1T4Y A;  2FWH A;  4ZL8 A;  2HXK A;  1YEX A;  2IME A;  6GSW A;  2GT5 A;  2F8F A;  3UBL A;  3TKP A;  3QAW A;  1X9W B;  1SKW B;  2GVP A;  2WS2 A;  1XOA A;  2GZP A;  2L4Q A;  4LL4 B;  3EUR A;  4V1A p;  2BTO T;  1ACV A;  4ECB A;  4OWY A;  4EDY A;  5ECO B;  2LRC A;  2MMZ A;  4RQX A;  4YQU A;  4K2D A;  2NPB A;  3D5J A;  4EE0 A;  2HZE B;  2AHE A;  4EDZ A;  3GIX A;  1WJK A;  2DJ1 A;  4P3Y B;  3UVH A;  1TW9 A;  4TXO B;  2VD1 A;  5CRH A;  3LWA A;  3QMX A;  4KDX A;  4POM A;  2YWM A;  5G1L A;  1M9B A;  2KP1 A;  1NM3 A;  3DIE A;  3DWV A;  3GTU A;  2VOC A;  4MK3 A;  3GN3 A;  2EIQ A;  5IOX A;  2E0Q A;  4JR6 A;  3M3M A;  3FHK A;  1VF3 A;  6GSX A;  1K0D A;  1M99 A;  2GST A;  3BBY A;  4WEY A;  3I9V 2;  1V40 A;  4PQH A;  1FVK A;  1MDJ A;  5JWQ B;  5CRD A;  3UEM A;  1ZGN A;  2REM A;  1GRX A;  2PBJ A;  4KB3 A;  4ILF A;  1GSD A;  3DVW A;  4GF0 A;  1XPV A;  4V2L A;  2VL2 C;  1EWX A;  3V1W A;  3F3Q A;  3DGQ A;  3L9S A;  2FY6 A;  2L57 A;  3VWU A;  3W8J A;  5D73 A;  3F9U A;  2KOK A;  2DIZ A;  3UVT A;  3PIN A;  1GNW A;  4ID0 A;  2DJ3 A;  2GQK A;  2MZC A;  2VLT A;  2G2Q A;  1PA3 A;  4TR1 B;  3WGX A;  4MJA A;  3VK9 A;  2H0G A;  4HJ2 A;  2VO4 A;  2J9H A;  2YAN A;  3WGD A;  3M9K A;  3UAP A;  4HJM A;  2VCX A;  5HQP A;  3EE2 A;  3C73 A;  3JCM L;  1F3A A;  3QFB C;  2H1A A;  1SYX A;  5IO2 A;  1SJI A;  2WDU A;  11GS A;  2MBS A;  5F8B A;  4HU7 A;  2H6X A;  2R5G A;  5CRW A;  1ZL9 A;  4Q5F A;  3HZ8 A;  3WGE A;  1DSB A;  2HRF A;  3GKN A;  3VPT A;  3MAK A;  2C1Y A;  5CAX A;  3APQ A;  1R26 A;  2ZNM A;  3F4S A;  4OO4 A;  3P8W A;  4KX4 A;  2IWT A;  1YKC A;  1GWC A;  3ME8 A;  5J5N A;  3BCI A;  2CVD A;  5DCG A;  1XIY A;  2H76 A;  5DQY A;  4JU5 A;  1U3A A;  5JCG A;  5ECS A;  3ZIV A;  2ES7 A;  3RBT A;  2B1K A;  1JZD A;  4JED A;  1SK0 A;  3KTB A;  1GL8 A;  5G30 A;  1USB A;  2IJY A;  1U6T A;  1XBS A;  7GSS A;  2RII A;  1R4W A;  5B6N A;  1U3I A;  1UVZ A;  4FIW A;  2GZY A;  3KMO A;  4MH2 A;  3L9U A;  3Q6O A;  2E7P A;  1Z7P A;  4OO5 A;  2TIR A;  5DAL A;  4MH3 A;  5HR0 A;  3HD5 A;  4XCS A;  4L0W A;  3ZRD A;  1OE7 A;  3LOR A;  1FB6 A;  2C3N A;  3ZIT A;  3GA4 A;  1GUK A;  4L0U A;  2M80 A;  5IO0 A;  3HDC A;  1XWB A;  3MSZ A;  3IRA A;  4ULX A;  2YV7 A;  2R3X A;  2K9F A;  3CSH A;  4I8B A;  1AC1 A;  1BG5 A;  4KND A;  2WJU A;  4MCU A;  2FCH A;  1KEB A;  2M46 A;  1B9X C;  3KMN A;  1B9Y C;  1O81 A;  5E4W A;  1K0O A;  3Q74 A;  3FR3 A;  5J3R A;  1FVJ A;  3ERG A;  2CVB A;  4PUR A;  5A4U A;  4HDE A;  2C0F A;  2F8A A;  1PQN A;  3FR9 A;  1N2A A;  5HFG A;  2VL9 A;  4KGI A;  4J2F A;  1FOV A;  1SJ6 A;  2AJQ B;  2X8G A;  1Z5Y E;  3UIW A;  4NAX A;  1N8J A;  4RQR A;  4K7N A;  3IHQ A;  2YOI A;  2EC4 A;  1XWG A;  5IPH A;  4HZ4 A;  3CBU A;  1E6B A;  3IV4 A;  3ZL5 A;  1YJ6 A;  2JU5 A;  2MYG A;  1PKZ A;  5ENU A;  2KHP A;  1SD8 A;  2EIO A;  4MF7 A;  1GSY A;  5ECR B;  2L6D A;  3VWX A;  5HFI A;  5J9C A;  4DSS A;  1Q4J A;  5FWG A;  1B4P A;  3FZ5 A;  2R37 A;  3C7M A;  3I43 A;  2CQ9 A;  5AIX A;  1DBY A;  1OC3 A;  1SEN A;  1A2J A;  2PER A;  4L8E A;  1V98 A;  4EF0 A;  3US3 A;  2YV9 A;  3TKS A;  2YP6 A;  3O76 A;  4NHZ A;  4MF5 A;  1FHE A;  1K0N A;  2DJ0 A;  2HRN A;  3RPP A;  3I69 A;  2RM6 A;  4PUF C;  5H5Q A;  1ZOF A;  3VWV A;  5DVB A;  2PPT A;  1AIU A;  2N5B A;  4N11 A;  4GXZ A;  5DJL A;  1TRV A;  1Z3E A;  1Y6E A;  3NOF A;  3UOM A;  1YF1 A;  3GUR A;  1YZX A;  4HQS A;  5ELA A;  4Q5R A;  3TKR A;  4XS1 A;  3TKS E;  2TRX A;  2DIY A;  1G7D A;  2GSQ A;  1T8E B;  3HA9 A;  1B4Q A;  3ZZX A;  3KM6 A;  1A2L A;  2DJ2 A;  2OE3 A;  4IN0 A;  2WZ9 A;  3L9V A;  1MD3 A;  4MP4 A;  3QR6 A;  2OBI A;  3HVS A;  5EL8 A;  4F2I A;  2GTU A;  2GSR A;  3C8E A;  5GZZ B;  2IMD A;  5ECQ B;  4IQA A;  1WE0 A;  4GST A;  1JFU A;  1ZYQ B;  3IA1 A;  1G6Y A;  4IEL A;  3LGC A;  1X5D A;  1VF4 A;  5H5S A;  4CHS A;  3RDW A;  3WYW A;  1V58 A;  1FAA A;  1OYJ A;  5GAP D;  1SKR B;  2B6M A;  2BJX A;  1PGT A;  2L5L A;  1DUG A;  3N9J A;  4EUY A;  5E59 A;  2I1U A;  1H4O A;  5AN1 A;  5DDL A;  3F63 A;  1RW1 A;  4I2U A;  4V2M A;  3S9F A;  4TR0 A;  1M2A A;  2FNO A;  2EIR A;  5EPF A;  2WRT A;  3TKS C;  2H74 A;  4EO3 A;  1SJZ A;  1RQM A;  5B8B A;  5B7C A;  1I9D A;  2HT9 A;  4HU9 A;  4TKY A;  3PGT A;  4TR4 A;  1B48 A;  4KAE A;  4IP6 A;  3EIN A;  3W8S A;  3A5W A;  3J7Y k;  3WT1 A;  4K6X A;  4F0C A;  1GSQ A;  1SL0 B;  4LMW A;  1EGR A;  4IP1 A;  4ZIL A;  1XWK A;  2VLV A;  4QL7 A;  2L6C A;  3ZYW A;  1URM A;  2I81 A;  1K3O A;  3U6V A;  13GS A;  1SKS B;  3KJY A;  1T00 A;  2VLU A;  4NWY A;  1ON4 A;  4O7H A;  3ERW A;  3TJF A;  5FHI A;  2OJL A;  5IMF A;  1YKA A;  4L5O A;  3ED3 A;  1YQ1 A;  3ZMK A;  2V6O A;  3DEX A;  1ST9 A;  3DVX A;  5GST A;  1OVN A;  3DML A;  3FZ9 A;  2B3S A;  1O7U A;  1W4V A;  4BWQ A;  1SL2 B;  2JAC A;  4DEJ A;  2MMO A;  2DMM A;  3O3T A;  1PX6 A;  4D73 B;  1FO5 A;  1GP1 A;  4IVF A;  1RK4 A;  2OAC A;  5DAK A;  1FB0 A;  2GT6 A;  5CNW A;  3UBK A;  1ERU A;  1PX7 A;  3D21 A;  3ME7 A;  2V2G A;  2AAW A;  2PVO C;  2CV4 A;  2IMF A;  2A2S A;  1TDI A;  3FY7 A;  2P5Q A;  1PRX A;  2OBK A;  4XS6 A;  5INY A;  4WXT A;  5JWR B;  1GSU A;  3MDK A;  1YF0 A;  3GL5 A;  1TK8 B;  2Z9S A;  5IM9 A;  1GSE A;  3TRP A;  5ID2 A;  2C3T A;  3FK8 A;  3LEF A;  1M7T A;  3D22 A;  2H71 A;  2WUL A;  4AF2 A;  3GX0 A;  5D93 A;  2I9H A;  2HSH A;  3GL3 A;  1FG4 A;  2YCD A;  5FT3 A;  4EVM A;  2XHF A;  3KH9 A;  4F03 A;  3EYT A;  3KXO A;  4OCE A;  3KTL A;  4PX1 A;  3R2Q A;  4K7O A;  1X5E A;  4I5Q A;  3WT2 A;  1O85 A;  3GSS A;  3TJG A;  1JLW A;  1T1V A;  4N30 A;  1O73 A;  4RUV A;  1OC9 A;  2VUP A;  3DRN A;  2M72 A;  2C4J A;  1TKD B;  2FA4 A;  2C8U A;  2O87 A;  5A4W A;  2RUE A;  1HQO A;  5COH A;  3CRT A;  2FGX A;  2LV3 A;  3BD2 A;  1OC8 A;  2FHE A;  4Q5N A;  4ECJ A;  1XWA A;  1XW5 A;  4OFT A;  1F9M A;  1JZO A;  2RM5 A;  2LQO A;  4ML1 A;  1Z7R A;  5KN2 A;  3GKK A;  2H01 A;  3VUR A;  3IXR A;  1K3L A;  1F2E A;  1C72 A;  5ABR A;  3Q19 A;  2WFC A;  4IKH A;  4EC0 A;  1YEP A;  1TU8 A;  1XVQ A;  2HI7 A;  1S3A A;  2LRT A;  2H1G A;  4GLT A;  2C3Q A;  3IAS 2;  3GX8 A;  3LXZ A;  5EVO A;  2P0G A;  3KH7 A;  3UL3 A;  1F3B A;  3KEB A;  4H86 A;  5G31 A;  2NDO A;  2R2J A;  4WF4 A;  4HOJ A;  4QQ7 A;  5DAK B;  4YAP A;  3F4T A;  1PN9 A;  5F07 A;  3P7X A;  6GSY A;  3IR4 A;  1A0R P;  1ERT A;  3C1S A;  2MBT A;  1EOH A;  2O89 A;  4K0G A;  3GUS A;  5D9V A;  4WET A;  1TJD A;  3P90 A;  5EY6 A;  3EC3 A;  3FW2 A;  3RHC A;  1XW9 A;  3LXT A;  2X64 A;  2F9S A;  3GTU B;  4KCE A;  1J9B A;  2CX3 A;  4OCF A;  4O92 A;  1EGO A;  4KSM A;  2DBC A;  5ID2 B;  1BAY A;  4E8H A;  5JCU A;  2H0H A;  1XCC A;  2ON7 A;  1WMJ A;  3KZQ A;  1OE8 A;  1XOB A;  5KN0 A;  4PUA A;  1CQH A;  5JCW A;  3A3T A;  2XC2 A;  1GSF A;  4ZB6 A;  3VWW A;  2CZ2 A;  2I3Y A;  3IPZ A;  1AQV A;  2DML A;  1A0F A;  1ABA A;  5G2Z A;  5ECP B;  1GTA A;  2CAQ A;  3GV1 A;  2YZH A;  4HI7 A;  3CTF A;  5ECI B;  1QXH A;  3QFA C;  1U87 A;  3E9J B;  4PXO A;  2H70 A;  3CSJ A;  3GH9 A;  1NHO A;  4O5R A;  3LYK A;  1X0R A;  5F0G A;  3QD9 A;  1A2M A;  3F3R A;  3H79 A;  1IYI A;  1R5P A;  2I4A A;  4POK A;  1OC9 B;  1WRY A;  2H8L A;  12GS A;  4GTU A;  4I6X A;  3HXS A;  2JAD A;  3TOU A;  4KE3 A;  1AUC A;  1F6M C;  2GGT A;  2VL3 A;  1AAZ A;  2VD0 A;  4V1A g;  1PKW A;  2HNL A;  4MZC A;  4GSS A;  1G7E A;  4WKW A;  3A2V A;  3ZRE A;  1SL1 B;  5C04 A;  3QAV A;  3CRU A;  3KP9 A;  1EZK A;  2CT6 A;  2JZT A;  2ZUP A;  4HZ2 A;  5CO3 A;  4JRR A;  1PSQ A;  2JZR A;  1G7O A;  1TXX A;  1NSW A;  2QSI A;  4ZL9 A;  3VI5 A;  4NV2 A;  1G6W A;  2IMK A;  3EVI A;  4ML6 A;  3HHV A;  4ECI A;  3RPN A;  1UC7 A;  1ZMA A;  1GSS A;  4XRD A;  4POB A;  2VAF A;  1V57 A;  4K0N A;  1KNG A;  2JSY A;  4PGT A;  1SK1 A;  4BA7 A;  1K0M A;  5C00 A;  4GRF A;  2NTO A;  4KA0 A;  4TRX A;  3H93 A;  2CX4 A;  4N0Z A;  4LL1 B;  4KCA A;  3GNJ A;  2RUF A;  2H19 A;  5AIS A;  1WPI A;  1KBN A;  4QL9 A;  1Y25 A;  2OE0 A;  2E2M A;  3DXB A;  2H6Z A;  3SBC A;  4LLR A;  2F51 A;  3ZVJ D;  1VF2 A;  1YY7 A;  3D4M A;  5HR1 A;  2YJH A;  3CXG A;  3IK9 A;  3A2X A;  1SU9 A;  5DAL B;  3TCO A;  5H5R A;  3D6I A;  1XXU A;  5B6M A;  4PQI A;  4EL1 A;  1MEK A;  2R4V A;  2FD3 A;  1TU7 A;  4CDO A;  2H72 A;  1T3B A;  4G10 A;  1GNE A;  3EMX A;  5IMV A;  1EOG A;  1EV4 A;  2P5R A;  4K9Z A;  2VCV A;  5LD0 A;  2FWE A;  3GST A;  3L78 A;  4J56 E;  1A8L A;  2GZZ A;  1QK8 A;  17GS A;  2PVQ A;  2IFQ A;  3QPM A;  2VIM A;  3IC4 A;  3CMI A;  3IOS A;  4HQZ A;  3KIJ A;  4KUN A;  2FWF A;  4ZXG A;  2LKU A;  4G9H A;  4NXI A;  2PMT A;  1HYU A;  1MDI A;  1Z9H A;  3BJ5 A;  2GDR A;  2H75 A;  4K8M A;  1HD2 A;  2H1D A;  3E3E A;  3FRC A;  4TXV A;  2WCI A;  2IN3 A;  2J23 A;  4TXO A;  3HYP A;  1EP7 A;  2OE1 A;  1WWJ A;  3D0Z A;  1H75 A;  4MF6 A;  2GSS A;  1YDK A;  1F37 A;  1HNC A;  3HCZ A;  1TOF A;  4FYU A;  1V2A A;  3PR8 A;  3D4T A;  3LQ7 A;  1WP0 A;  1R5A A;  2L59 A;  4MMM A;  2LNS A;  4XRA A;  2AUV A;  4DSS B;  2NVL A;  1GUH A;  4AJ8 A;  4ZB9 A;  1NHY A;  4I2T A;  1EP8 A;  6GSU A;  1LU4 A;  3UJ1 A;  4BPY A;  3TB2 A;  3GKX A;  3EMP A;  4PNF A;  4ISD A;  4X0X A;  1GUM A;  3U5R E;  1CQG A;  1K3Y A;  2GS3 A;  2C0E A;  2OKA A;  2IIY A;  1S3D A;  1A23 A;  4TR1 A;  1THX A;  1VRS D;  1A8Y A;  1ERV A;  5D9T A;  3CTG A;  3DYR A;  2YPM A;  4KH7 A;  3M0F A;  4IHU A;  2H0I A;  2B7J A;  2F3M A;  4F9Z A;  3M1G A;  5KN3 A;  2IL3 A;  1U88 A;  3LSZ A;  4KDU A;  14GS A;  2K8S A;  4JZQ A;  3ISO A;  2VCZ A;  2ALB A;  4L5L A;  3A2W A;  2H66 A;  1OKD A;  3O6T A;  3HKR A;  4KW6 A;  3EWL A;  1MD4 A;  4MLY A;  3LG6 A;  3TUE A;  4GWR A;  1QMV A;  1B8X A;  2VM1 A;  4LMV A;  1R7H A;  4LA1 A;  1TP9 A;  4ECC A;  1LJR A;  2CA8 A;  2GLR A;  2HFD A;  1HNA A;  3NZN A;  5IPG A;  4XHM A;  2IFQ B;  5A4V A;  1T7P B;  3P2A A;  3GRX A;  3E0U A;  4BVX A;  3M9J A;  2NBS A;  4V2N A;  3QCP A;  1Q98 A;  4MDC A;  3HZ4 A;  2V41 A;  3KCM A;  4BL7 A;  4MZB A;  1HNB A;  3ZTL A;  3TDG A;  3MNG A;  5D9X A;  4YAV A;  2LJR A;  5AIV A;  3Q18 A;  5AGY A;  5IMZ A;  3F0I A;  1KTE A;  2VM2 A;  4FH8 A;  4MJB A;  4X1U A;  4MJC A;  3G7I A;  4AGS A;  1VGL A;  4YQM A;  2YWI A;  1AXD A;  16GS A;  5JWO B;  4ACS A;  2FUG 2;  5HFK A;  3QOU A;  4RI7 A;  2N5A A;  5B8A A;  4WR4 A;  3FEU A;  4FYB A;  1K0B A;  1O8X A;  1K0C A;  4XIH A;  1XW6 A;  3HY2 A;  1BED A;  4DVC A;  3ZFL A;  2XPD A;  1M2D A;  1SYR A;  3H1N A;  5DBQ A;  4MPF A;  2DLX A;  5CYY A;  4MAB A;  3KP8 A;  2H30 A;  4MJE A;  3F4R A;  2H6Y A;  2V32 A;  3DKS A;  6GSS A;  2GQM A;  5GAN D;  4GQC A;  5KEJ A;  1TTZ A;  2HE3 A;  4KDY A;  2L5O A;  2OAD A;  3C1R A;  3GHA A;  3LFL A;  2ON5 A;  3IDV A;  2B5X A;  4K1F A;  3ZVJ A;  1PD2 1;  3L4N A;  1QFN A;  5J9B A;  2XBQ A;  1I5G A;  3WD6 A;  1XVW A;  1GH2 A;  3FZA A;  1TK5 B;  2LRN A;  3TJJ A;  4IQ1 A;  4FYC A; 
#chains in the Genus database with same CATH topology
 1XZO A;  2HZF A;  2R6K A;  2YWN A;  2E2G A;  2H1B A;  5LCZ A;  2LJA A;  1VF1 A;  4G19 A;  1GTU A;  3TOT A;  1QQ2 A;  5IQY A;  3KGK A;  1O8W A;  1PL1 A;  3KD0 A;  1ZCP A;  4IBP A;  4JR4 A;  1ILO A;  3M8N A;  2PUK C;  4WBR D;  1GTB A;  3MIX A;  4HS1 A;  3IE3 A;  2JZS A;  4JE1 A;  2LEG A;  1M9A A;  2IMI A;  2YWO A;  4BVY A;  4DSR A;  4TOP A;  4POL A;  1JZW A;  1THO A;  2B5Y A;  4HUA A;  4IJ3 A;  1ZYE A;  3VFI A;  5F05 A;  4YH2 A;  2GQL A;  4CY6 A;  2KP2 A;  4TW5 A;  4PQ1 A;  3HJP A;  2YZU A;  4BL7 B;  5GSS A;  4MNN A;  1JLV A;  2LQQ A;  2X99 A;  5IMA A;  3RAZ A;  20GS A;  4F0B A;  2FWG A;  5IMC A;  4ZBD A;  3TJK A;  4IS0 A;  2LNT A;  1W89 A;  2N5F A;  3GFK A;  4I97 A;  4MA9 A;  1ERW A;  22GS A;  2MMN A;  3EU3 A;  2OA7 A;  5DJM A;  4BWS A;  3CSI A;  1EEM A;  3G9B A;  5ECM B;  3OR5 A;  4AJ7 A;  2ZCT A;  3C71 A;  5L71 A;  2HSM A;  4G0K A;  3SWL A;  2JSZ A;  1QUW A;  3W6G A;  2LS5 A;  19GS A;  1XWC A;  4OD7 A;  2FA8 A;  2TRC P;  3IBH A;  1XFL A;  4F82 A;  3MWH A;  5ECL B;  4K7I A;  3ZIJ A;  1OAZ A;  2H73 A;  5G5E A;  3NIV A;  4TVE A;  4GQF A;  1GUL A;  1V9W A;  2P31 A;  3DD3 A;  5ELG A;  8GSS A;  1LBK A;  2PGT A;  2K18 A;  1PMT A;  2C80 A;  3APS A;  1J0F A;  3VLN A;  2LST A;  4Q5Q A;  3VPQ A;  4MPG A;  4O5U A;  4OMV A;  5A5K A;  3ERF A;  1QGV A;  1GTI A;  5IOW A;  4XS4 A;  1TK0 B;  1ML6 A;  10GS A;  4ZBA A;  3QAG A;  1GLP A;  1MDK A;  4NPB A;  3GKM A;  2LTK A;  1TI1 A;  3TJB A;  1J08 A;  5CRE A;  5G1K A;  2KUC A;  3TKQ A;  3ZFB A;  2WGR A;  4GSN A;  4EXJ A;  2AB6 A;  2DSA A;  2BMX A;  2CZ3 A;  1AQW A;  2B5E A;  4E8E A;  5IIZ A;  2R0C A;  2O7K A;  2DC5 A;  1AW9 A;  4Z7X A;  4ZBB A;  5BRT A;  4NV5 A;  2L4C A;  1X9M B;  2WB9 A;  4GCI A;  1T4Z A;  2R0P A;  2DJJ A;  5DQS A;  2MMA A;  2DJK A;  3HVX A;  1GLQ A;  1EEJ A;  2AV4 A;  4HEA 2;  5ECN B;  1M0U A;  3LYP A;  4JBB A;  4IJI A;  1NW2 A;  1X5C A;  4IW9 A;  1AQX A;  3HJM A;  2QC7 A;  2CVK A;  5D96 A;  3IAM 2;  2X8H A;  2LUS A;  2D2Z A;  4OFN A;  4TR3 A;  5LNK e;  5IMD A;  1BQ7 A;  3EU4 A;  2LJK A;  3F6F A;  1OKT A;  3APO A;  3G7J A;  1TRS A;  1DE2 A;  3TGZ A;  1ZZY A;  1BX9 A;  1TI3 A;  3UMA A;  3H4K A;  2G0F A;  2FLS A;  6GST A;  2O85 A;  2O8V B;  2IPA A;  4PNG A;  3VI7 A;  2HLS A;  4AJ6 A;  1K0A A;  5CP1 A;  4RI6 A;  5G5F A;  1Z6N A;  1JZR A;  3AY8 A;  5F06 A;  2VCW A;  3L0H A;  2HSY A;  3LJR A;  3K8N A;  4D73 A;  2PWJ A;  3GMF A;  5J4U A;  5D8I A;  2K6V A;  1E2Y A;  2HZE A;  1WIK A;  3HVV A;  2AYT A;  2B7K A;  4IGJ A;  1FW1 A;  2JL4 A;  4TN8 A;  4DSQ A;  3IK7 A;  1A24 A;  1M2B A;  4X43 A;  2PN8 A;  3TRQ A;  5D9W A;  1PL2 A;  4G2E A;  2C0D A;  1G0T A;  4WF5 A;  3UAR A;  2VCQ A;  3GH6 A;  1EV9 A;  2YJ7 A;  2YN1 A;  4FO5 A;  1MTC A;  2A4H A;  4ZIJ A;  4N10 A;  4CW9 A;  3J7Y b;  3RHB A;  2A4V A;  3PH9 A;  3FKF A;  3FYG A;  1IYH A;  1S3C A;  2VCT A;  1BJX A;  1X9S B;  4XS4 B;  2A2R A;  3FZ4 A;  1UN2 A;  3BCK A;  4EKZ A;  2X8C A;  6GSV A;  1Z6M A;  4OFM A;  2QGV A;  4WBJ A;  9GSS A;  3CYN A;  4WR5 A;  3HJO A;  3F6D A;  2QKE A;  5CRG A;  4N0V A;  1DE1 A;  3G7Y A;  4XTS A;  1JHB A;  2KLX A;  3N5O A;  1TRW A;  2V1M A;  5KN1 A;  2RLI A;  5J41 A;  3ZLP A;  2XBI A;  5ECH B;  3ZML A;  1UA5 A;  3FR6 A;  4NHW A;  3BOA A;  3F8U A;  18GS A;  2B1L A;  1BYE A;  1SD9 A;  4KSO A;  2PU9 C;  1O6J A;  1SK2 A;  5DCH A;  5HR2 A;  2XPE A;  5ECK B;  4YQV A;  4J57 E;  2YNX A;  3GYK A;  1WOU A;  2M66 A;  2K8V A;  2VL2 A;  2CAI A;  5HR3 A;  3I6A A;  2HYX A;  4NMU A;  4ICY A;  2V6K A;  4O32 A;  4ZL7 A;  2C0G A;  3QDN A;  3TRX A;  4MZW A;  3H8Q A;  4KF9 A;  1TRU A;  4ZB8 A;  1T4Y A;  2FWH A;  4ZL8 A;  2HXK A;  1YEX A;  2IME A;  6GSW A;  1ZYP A;  2GT5 A;  2F8F A;  3UBL A;  3TKP A;  3QAW A;  1X9W B;  1SKW B;  2GVP A;  2WS2 A;  1XOA A;  2GZP A;  2L4Q A;  4LL4 B;  3EUR A;  4V1A p;  2BTO T;  1ACV A;  4ECB A;  4OWY A;  4EDY A;  2LRC A;  5ECO B;  2MMZ A;  4RQX A;  4YQU A;  4K2D A;  2NPB A;  3D5J A;  4EE0 A;  2HZE B;  2AHE A;  4EDZ A;  3GIX A;  1WJK A;  2DJ1 A;  4P3Y B;  3UVH A;  1TW9 A;  4TXO B;  2VD1 A;  5CRH A;  3LWA A;  3QMX A;  4KDX A;  4POM A;  2YWM A;  5G1L A;  1M9B A;  2KP1 A;  1NM3 A;  3DIE A;  3DWV A;  3GTU A;  2VOC A;  4MK3 A;  3GN3 A;  2EIQ A;  5IOX A;  2E0Q A;  4JR6 A;  3M3M A;  3FHK A;  1VF3 A;  6GSX A;  1K0D A;  1M99 A;  2GST A;  3BBY A;  4WEY A;  3I9V 2;  1V40 A;  4PQH A;  1FVK A;  1MDJ A;  5JWQ B;  5CRD A;  3UEM A;  1ZGN A;  2REM A;  1GRX A;  2PBJ A;  4KB3 A;  4ILF A;  1GSD A;  3DVW A;  4GF0 A;  1XPV A;  4V2L A;  2VL2 C;  1EWX A;  3V1W A;  3A5I A;  3F3Q A;  3DGQ A;  3L9S A;  2FY6 A;  2L57 A;  3VWU A;  3W8J A;  3F9U A;  2KOK A;  5D73 A;  2DIZ A;  3UVT A;  3PIN A;  1GNW A;  4ID0 A;  2DJ3 A;  2GQK A;  2MZC A;  2VLT A;  2G2Q A;  1PA3 A;  4TR1 B;  3WGX A;  4MJA A;  3VK9 A;  2H0G A;  4HJ2 A;  2VO4 A;  2J9H A;  2YAN A;  3WGD A;  3M9K A;  3UAP A;  4HJM A;  2VCX A;  5HQP A;  3EE2 A;  3C73 A;  3JCM L;  1F3A A;  3QFB C;  2H1A A;  1SYX A;  5IO2 A;  1SJI A;  2WDU A;  11GS A;  2MBS A;  5F8B A;  4HU7 A;  2H6X A;  2R5G A;  5CRW A;  1ZL9 A;  4Q5F A;  3HZ8 A;  3WGE A;  1DSB A;  2HRF A;  3GKN A;  3VPT A;  3MAK A;  2C1Y A;  5CAX A;  3APQ A;  1R26 A;  2ZNM A;  3F4S A;  4OO4 A;  3P8W A;  4KX4 A;  2IWT A;  1YKC A;  1GWC A;  3ME8 A;  5J5N A;  4BVX B;  3BCI A;  2CVD A;  5DCG A;  1XIY A;  2H76 A;  5DQY A;  4JU5 A;  1U3A A;  5JCG A;  5ECS A;  3ZIV A;  2ES7 A;  3RBT A;  2B1K A;  1JZD A;  4JED A;  1SK0 A;  3KTB A;  1GL8 A;  5G30 A;  1USB A;  2IJY A;  1U6T A;  1XBS A;  7GSS A;  2RII A;  1R4W A;  5B6N A;  1U3I A;  1UVZ A;  4FIW A;  2GZY A;  3KMO A;  4MH2 A;  3L9U A;  3Q6O A;  2E7P A;  1Z7P A;  4OO5 A;  2TIR A;  5DAL A;  4FQU A;  4MH3 A;  5HR0 A;  3HD5 A;  4XCS A;  4L0W A;  3ZRD A;  1OE7 A;  3LOR A;  1FB6 A;  2C3N A;  3ZIT A;  3GA4 A;  4YKG A;  1GUK A;  4L0U A;  2M80 A;  5IO0 A;  3HDC A;  1XWB A;  3MSZ A;  3IRA A;  4ULX A;  2YV7 A;  2R3X A;  2K9F A;  3CSH A;  4I8B A;  1AC1 A;  1BG5 A;  4KND A;  2WJU A;  4MCU A;  4Z2R A;  2FCH A;  1KEB A;  2M46 A;  1B9X C;  3KMN A;  1B9Y C;  1O81 A;  5E4W A;  1K0O A;  3Q74 A;  3FR3 A;  2DKI A;  5J3R A;  1FVJ A;  3ERG A;  2CVB A;  4PUR A;  5A4U A;  4HDE A;  2C0F A;  2F8A A;  1PQN A;  3FR9 A;  1N2A A;  5HFG A;  2VL9 A;  4KGI A;  4J2F A;  1M3J A;  1FOV A;  1SJ6 A;  2AJQ B;  2X8G A;  1Z5Y E;  3UIW A;  4NAX A;  1N8J A;  4RQR A;  4K7N A;  3IHQ A;  2YOI A;  2EC4 A;  1XWG A;  5IPH A;  2R0G A;  4HZ4 A;  1XG8 A;  3CBU A;  1E6B A;  3IV4 A;  3ZL5 A;  1YJ6 A;  2JU5 A;  2MYG A;  1PKZ A;  5ENU A;  2KHP A;  1SD8 A;  2EIO A;  4MF7 A;  1GSY A;  5ECR B;  2L6D A;  3VWX A;  5HFI A;  5J9C A;  4DSS A;  1Q4J A;  5FWG A;  1B4P A;  3FZ5 A;  2R37 A;  3C7M A;  3I43 A;  2CQ9 A;  5AIX A;  1S3R A;  1DBY A;  1OC3 A;  1SEN A;  1A2J A;  2PER A;  4L8E A;  1V98 A;  4EF0 A;  3US3 A;  2YV9 A;  3TKS A;  4BVY B;  2YP6 A;  3O76 A;  4NHZ A;  4MF5 A;  1FHE A;  1K0N A;  2DJ0 A;  2HRN A;  3RPP A;  3I69 A;  2RM6 A;  4PUF C;  5H5Q A;  1ZOF A;  3VWV A;  5DVB A;  2PPT A;  1AIU A;  2N5B A;  2X49 A;  4N11 A;  4GXZ A;  5DJL A;  4YKF A;  1TRV A;  1Z3E A;  1Y6E A;  3NOF A;  3UOM A;  1YF1 A;  3GUR A;  1YZX A;  4HQS A;  5ELA A;  4Q5R A;  3TKR A;  4XS1 A;  3TKS E;  2TRX A;  1PFO A;  2DIY A;  1G7D A;  2GSQ A;  1T8E B;  3HA9 A;  1B4Q A;  3ZZX A;  3KM6 A;  4G0I A;  1A2L A;  2DJ2 A;  2OE3 A;  4IN0 A;  2WZ9 A;  3L9V A;  1MD3 A;  4MP4 A;  3QR6 A;  2OBI A;  3HVS A;  5EL8 A;  4F2I A;  2GTU A;  2GSR A;  3C8E A;  5GZZ B;  2IMD A;  5ECQ B;  4IQA A;  1WE0 A;  4GST A;  1JFU A;  1ZYQ B;  3IA1 A;  1G6Y A;  4IEL A;  3LGC A;  1X5D A;  1VF4 A;  5H5S A;  4CHS A;  3RDW A;  3WYW A;  1V58 A;  1FAA A;  1OYJ A;  5GAP D;  1SKR B;  2B6M A;  2BJX A;  2UZ8 A;  1PGT A;  2L5L A;  1DUG A;  3N9J A;  4EUY A;  5E59 A;  2I1U A;  1H4O A;  5AN1 A;  5DDL A;  3F63 A;  1RW1 A;  4I2U A;  4V2M A;  3S9F A;  4TR0 A;  1M2A A;  2FNO A;  2EIR A;  5EPF A;  4Z2T A;  2WRT A;  3TKS C;  2H74 A;  4EO3 A;  1SJZ A;  1RQM A;  5B8B A;  5B7C A;  1I9D A;  2HT9 A;  4HU9 A;  4TKY A;  3PGT A;  4TR4 A;  1B48 A;  3IC8 A;  4KAE A;  4IP6 A;  3R3E A;  3EIN A;  3W8S A;  3A5W A;  3J7Y k;  3WT1 A;  4K6X A;  4F0C A;  1GSQ A;  1SL0 B;  4LMW A;  1EGR A;  4IP1 A;  3PPU A;  4ZIL A;  1XWK A;  2VLV A;  4QL7 A;  2L6C A;  3ZYW A;  1URM A;  2I81 A;  1K3O A;  3U6V A;  13GS A;  1SKS B;  3KJY A;  1T00 A;  2VLU A;  4NWY A;  1ON4 A;  4O7H A;  3ERW A;  3TJF A;  5FHI A;  2OJL A;  5IMF A;  1YKA A;  4L5O A;  3ED3 A;  1YQ1 A;  3ZMK A;  2V6O A;  3DEX A;  1ST9 A;  3DVX A;  5GST A;  1OVN A;  3MYD A;  3DML A;  3FZ9 A;  2B3S A;  1O7U A;  1W4V A;  4BWQ A;  1SL2 B;  2JAC A;  2X4A A;  4DEJ A;  2MMO A;  2DMM A;  3O3T A;  1PX6 A;  4D73 B;  1FO5 A;  1GP1 A;  4IVF A;  4CY8 A;  1RK4 A;  2OAC A;  5DAK A;  1FB0 A;  2GT6 A;  5CNW A;  3UBK A;  1ERU A;  1PX7 A;  3D21 A;  3ME7 A;  2V2G A;  2AAW A;  2PVO C;  2CV4 A;  2IMF A;  2A2S A;  1TDI A;  3FY7 A;  2P5Q A;  1PRX A;  2OBK A;  4XS6 A;  5INY A;  4WXT A;  5JWR B;  1GSU A;  3MDK A;  1YF0 A;  3GL5 A;  1TK8 B;  2Z9S A;  5BMU A;  5IM9 A;  1GSE A;  3TRP A;  5ID2 A;  2C3T A;  3FK8 A;  3LEF A;  1M7T A;  3D22 A;  2H71 A;  2WUL A;  4AF2 A;  3GX0 A;  5D93 A;  2I9H A;  2HSH A;  3GL3 A;  1FG4 A;  2YCD A;  5FT3 A;  4EVM A;  2XHF A;  3KH9 A;  4F03 A;  3EYT A;  3KXO A;  4OCE A;  3KTL A;  4PX1 A;  3R2Q A;  4K7O A;  1X5E A;  2HRA A;  4I5Q A;  3WT2 A;  2A2P A;  1O85 A;  3GSS A;  3TJG A;  1JLW A;  1T1V A;  4N30 A;  1O73 A;  4RUV A;  1OC9 A;  2VUP A;  3DRN A;  2M72 A;  2C4J A;  1TKD B;  2FA4 A;  2C8U A;  2O87 A;  5A4W A;  2RUE A;  1HQO A;  5COH A;  3CRT A;  2FGX A;  2LV3 A;  3BD2 A;  1OC8 A;  2FHE A;  4Q5N A;  4ECJ A;  1XWA A;  1XW5 A;  4OFT A;  1F9M A;  1JZO A;  2RM5 A;  2LQO A;  4ML1 A;  1Z7R A;  5KN2 A;  3GKK A;  2H01 A;  3VUR A;  3IXR A;  1K3L A;  1F2E A;  1C72 A;  5ABR A;  3Q19 A;  2WFC A;  4IKH A;  4EC0 A;  2QA2 A;  1YEP A;  1TU8 A;  1XVQ A;  2HI7 A;  1S3A A;  2LRT A;  2H1G A;  4GLT A;  2C3Q A;  3IAS 2;  3GX8 A;  3LXZ A;  4K5S A;  5EVO A;  2P0G A;  3KH7 A;  3UL3 A;  1F3B A;  3KEB A;  4H86 A;  5G31 A;  2NDO A;  2R2J A;  4WF4 A;  4HOJ A;  4QQ7 A;  5DAK B;  4YAP A;  3F4T A;  1PN9 A;  5F07 A;  3P7X A;  6GSY A;  3IR4 A;  1A0R P;  1ERT A;  3C1S A;  2MBT A;  1EOH A;  2O89 A;  4K0G A;  3GUS A;  5D9V A;  4WET A;  1TJD A;  3P90 A;  5EY6 A;  3EC3 A;  3FW2 A;  3RHC A;  1XW9 A;  3LXT A;  2X64 A;  2F9S A;  3GTU B;  4KCE A;  1J9B A;  2CX3 A;  4OCF A;  4O92 A;  1EGO A;  4KSM A;  2DBC A;  5ID2 B;  1BAY A;  4E8H A;  5JCU A;  2H0H A;  1XCC A;  2ON7 A;  1WMJ A;  3KZQ A;  1OE8 A;  1XOB A;  5KN0 A;  4PUA A;  1CQH A;  5JCW A;  3A3T A;  2XC2 A;  1GSF A;  4ZB6 A;  3VWW A;  2CZ2 A;  2I3Y A;  3IPZ A;  1AQV A;  2DML A;  1A0F A;  1ABA A;  5G2Z A;  5ECP B;  1GTA A;  1PN0 A;  2CAQ A;  3GV1 A;  2YZH A;  4HI7 A;  3CTF A;  5ECI B;  1QXH A;  3QFA C;  1U87 A;  3E9J B;  4PXO A;  2H70 A;  3CSJ A;  3GH9 A;  1NHO A;  4O5R A;  3LYK A;  1X0R A;  5F0G A;  3QD9 A;  1A2M A;  3F3R A;  3H79 A;  1IYI A;  1R5P A;  2QA1 A;  2I4A A;  4POK A;  1OC9 B;  1WRY A;  2H8L A;  12GS A;  4GTU A;  1ZYN A;  4I6X A;  3HXS A;  2JAD A;  3FMW A;  3TOU A;  4KE3 A;  1AUC A;  1F6M C;  2GGT A;  2VL3 A;  1AAZ A;  3IHG A;  2VD0 A;  4V1A g;  1PKW A;  2HNL A;  4MZC A;  4GSS A;  1G7E A;  4HSC X;  4WKW A;  3A2V A;  3ZRE A;  1SL1 B;  5C04 A;  3QAV A;  3CRU A;  3KP9 A;  1EZK A;  2CT6 A;  2JZT A;  2ZUP A;  4HZ2 A;  5CO3 A;  4JRR A;  1PSQ A;  2JZR A;  1G7O A;  1TXX A;  1NSW A;  2QSI A;  4ZL9 A;  3VI5 A;  4NV2 A;  1G6W A;  2IMK A;  3EVI A;  4ML6 A;  3HHV A;  4ECI A;  3RPN A;  1UC7 A;  1ZMA A;  1GSS A;  4XRD A;  4POB A;  2VAF A;  1V57 A;  4K5R A;  4K0N A;  1KNG A;  2JSY A;  4PGT A;  1SK1 A;  4BA7 A;  1K0M A;  5C00 A;  4GRF A;  2NTO A;  4KA0 A;  4TRX A;  3H93 A;  2CX4 A;  4N0Z A;  4LL1 B;  4KCA A;  3GNJ A;  2RUF A;  2H19 A;  5AIS A;  1WPI A;  4EIQ A;  1KBN A;  4QL9 A;  5KOX A;  1Y25 A;  2OE0 A;  2E2M A;  3DXB A;  2H6Z A;  3SBC A;  4LLR A;  2F51 A;  3ZVJ D;  1VF2 A;  1YY7 A;  3D4M A;  5HR1 A;  2YJH A;  3CXG A;  3IK9 A;  3A2X A;  1SU9 A;  5DAL B;  3TCO A;  5H5R A;  3D6I A;  1XXU A;  5B6M A;  4PQI A;  4EL1 A;  1MEK A;  2R4V A;  2FD3 A;  1TU7 A;  4CDO A;  2H72 A;  1T3B A;  4G10 A;  1GNE A;  3EMX A;  4K2X A;  5IMV A;  1EOG A;  1EV4 A;  2P5R A;  4K9Z A;  2VCV A;  5LD0 A;  2FWE A;  3GST A;  3L78 A;  4J56 E;  1A8L A;  2GZZ A;  1QK8 A;  17GS A;  2PVQ A;  2IFQ A;  3QPM A;  2VIM A;  3IC4 A;  3CMI A;  3IOS A;  4HQZ A;  3KIJ A;  4KUN A;  2FWF A;  4ZXG A;  2LKU A;  4X4J A;  4G9H A;  4NXI A;  2PMT A;  1HYU A;  1MDI A;  1Z9H A;  3BJ5 A;  2GDR A;  2H75 A;  4K8M A;  1HD2 A;  2H1D A;  3E3E A;  3FRC A;  4TXV A;  2WCI A;  2IN3 A;  3LW9 A;  2J23 A;  4TXO A;  3HYP A;  1EP7 A;  2HRK A;  4BIK A;  2OE1 A;  1WWJ A;  3D0Z A;  1H75 A;  4MF6 A;  2GSS A;  1YDK A;  1F37 A;  1HNC A;  3HCZ A;  1TOF A;  4FYU A;  1V2A A;  3PR8 A;  3D4T A;  3LQ7 A;  1WP0 A;  1R5A A;  2L59 A;  4MMM A;  2LNS A;  4XRA A;  2AUV A;  4DSS B;  2NVL A;  1GUH A;  4AJ8 A;  4ZB9 A;  1NHY A;  4I2T A;  1EP8 A;  6GSU A;  3CQF A;  1LU4 A;  3UJ1 A;  4BPY A;  3TB2 A;  3GKX A;  3EMP A;  4PNF A;  4ISD A;  4X0X A;  1GUM A;  3U5R E;  1CQG A;  1K3Y A;  2GS3 A;  2C0E A;  2OKA A;  2IIY A;  1M3I A;  1S3D A;  1A23 A;  4G0L A;  4TR1 A;  1THX A;  1VRS D;  1A8Y A;  1ERV A;  5D9T A;  3CTG A;  3DYR A;  2YPM A;  4KH7 A;  3M0F A;  4IHU A;  2H0I A;  2B7J A;  2F3M A;  4F9Z A;  4USS A;  4Z2U A;  3M1G A;  5KN3 A;  3EPT A;  2IL3 A;  1U88 A;  3LSZ A;  4KDU A;  14GS A;  2K8S A;  4JZQ A;  3ISO A;  2VCZ A;  2ALB A;  4L5L A;  3A2W A;  2H66 A;  1OKD A;  2DKH A;  3O6T A;  3HKR A;  4KW6 A;  3EWL A;  1MD4 A;  4MLY A;  3LG6 A;  3TUE A;  4GWR A;  1QMV A;  1B8X A;  2VM1 A;  4LMV A;  1R7H A;  4LA1 A;  1TP9 A;  4ECC A;  1LJR A;  2CA8 A;  2GLR A;  2HFD A;  1HNA A;  4O5Q A;  3NZN A;  5IPG A;  4XHM A;  2IFQ B;  5A4V A;  1T7P B;  3P2A A;  3GRX A;  3E0U A;  4BVX A;  3M9J A;  2NBS A;  4V2N A;  3QCP A;  1Q98 A;  4MDC A;  1FOH A;  3HZ4 A;  2V41 A;  4A5P A;  3KCM A;  4BL7 A;  4MZB A;  1HNB A;  3ZTL A;  3TDG A;  3MNG A;  5D9X A;  4YAV A;  2LJR A;  5AIV A;  3Q18 A;  5AGY A;  5IMZ A;  3F0I A;  1KTE A;  2VM2 A;  4FH8 A;  3HVN A;  4MJB A;  4PTS A;  4X1U A;  4MJC A;  3G7I A;  4AGS A;  1VGL A;  4YQM A;  2YWI A;  1AXD A;  16GS A;  5JWO B;  4ACS A;  2FUG 2;  5HFK A;  3QOU A;  4RI7 A;  2N5A A;  5B8A A;  4WR4 A;  3FEU A;  4FYB A;  1K0B A;  1O8X A;  1K0C A;  4XIH A;  1XW6 A;  3HY2 A;  1BED A;  4DVC A;  3ZFL A;  2XPD A;  1M2D A;  1SYR A;  3H1N A;  5DBQ A;  4MPF A;  2DLX A;  5CYY A;  4MAB A;  3KP8 A;  2H30 A;  4MJE A;  3F4R A;  2H6Y A;  2V32 A;  3DKS A;  6GSS A;  2GQM A;  5GAN D;  4GQC A;  5KEJ A;  1TTZ A;  2HE3 A;  4KDY A;  2L5O A;  2OAD A;  3C1R A;  3GHA A;  3LFL A;  2ON5 A;  3IDV A;  5KOW A;  2B5X A;  4K1F A;  3ZVJ A;  1PD2 1;  3L4N A;  1QFN A;  5J9B A;  2XBQ A;  1I5G A;  3WD6 A;  1XVW A;  1GH2 A;  3FZA A;  4EIP A;  1TK5 B;  2LRN A;  3TJJ A;  4IQ1 A;  4FYC A; 
#chains in the Genus database with same CATH homology
 1XZO A;  2HZF A;  2R6K A;  2YWN A;  2E2G A;  2H1B A;  5LCZ A;  2LJA A;  1VF1 A;  4G19 A;  1GTU A;  3TOT A;  1QQ2 A;  5IQY A;  3KGK A;  1O8W A;  1PL1 A;  3KD0 A;  1ZCP A;  4IBP A;  4JR4 A;  1ILO A;  3M8N A;  2PUK C;  4WBR D;  1GTB A;  3MIX A;  4HS1 A;  3IE3 A;  2JZS A;  4JE1 A;  2LEG A;  1M9A A;  2IMI A;  2YWO A;  4BVY A;  4DSR A;  4TOP A;  4POL A;  1JZW A;  1THO A;  2B5Y A;  4HUA A;  4IJ3 A;  1ZYE A;  3VFI A;  5F05 A;  4YH2 A;  2GQL A;  4CY6 A;  2KP2 A;  4TW5 A;  4PQ1 A;  3HJP A;  2YZU A;  4BL7 B;  5GSS A;  4MNN A;  1JLV A;  2LQQ A;  2X99 A;  5IMA A;  3RAZ A;  20GS A;  4F0B A;  2FWG A;  5IMC A;  4ZBD A;  3TJK A;  4IS0 A;  2LNT A;  1W89 A;  2N5F A;  3GFK A;  4I97 A;  4MA9 A;  1ERW A;  22GS A;  2MMN A;  3EU3 A;  2OA7 A;  5DJM A;  4BWS A;  3CSI A;  1EEM A;  3G9B A;  5ECM B;  3OR5 A;  4AJ7 A;  2ZCT A;  3C71 A;  5L71 A;  2HSM A;  4G0K A;  3SWL A;  2JSZ A;  1QUW A;  3W6G A;  2LS5 A;  19GS A;  1XWC A;  4OD7 A;  2FA8 A;  2TRC P;  3IBH A;  1XFL A;  4F82 A;  3MWH A;  5ECL B;  4K7I A;  3ZIJ A;  1OAZ A;  2H73 A;  5G5E A;  3NIV A;  4TVE A;  4GQF A;  1GUL A;  1V9W A;  2P31 A;  3DD3 A;  5ELG A;  8GSS A;  1LBK A;  2PGT A;  2K18 A;  1PMT A;  2C80 A;  3APS A;  1J0F A;  3VLN A;  2LST A;  4Q5Q A;  3VPQ A;  4MPG A;  4O5U A;  4OMV A;  5A5K A;  3ERF A;  1QGV A;  1GTI A;  5IOW A;  4XS4 A;  1TK0 B;  1ML6 A;  10GS A;  4ZBA A;  3QAG A;  1GLP A;  1MDK A;  4NPB A;  3GKM A;  2LTK A;  1TI1 A;  3TJB A;  1J08 A;  5CRE A;  5G1K A;  2KUC A;  3TKQ A;  3ZFB A;  2WGR A;  4GSN A;  4EXJ A;  2AB6 A;  2DSA A;  2BMX A;  2CZ3 A;  1AQW A;  2B5E A;  4E8E A;  5IIZ A;  2R0C A;  2O7K A;  2DC5 A;  1AW9 A;  4Z7X A;  4ZBB A;  5BRT A;  4NV5 A;  2L4C A;  1X9M B;  2WB9 A;  4GCI A;  1T4Z A;  2R0P A;  2DJJ A;  5DQS A;  2MMA A;  2DJK A;  3HVX A;  1GLQ A;  1EEJ A;  2AV4 A;  4HEA 2;  5ECN B;  1M0U A;  3LYP A;  4JBB A;  4IJI A;  1NW2 A;  1X5C A;  4IW9 A;  1AQX A;  3HJM A;  2QC7 A;  2CVK A;  5D96 A;  3IAM 2;  2X8H A;  2LUS A;  2D2Z A;  4OFN A;  4TR3 A;  5LNK e;  5IMD A;  1BQ7 A;  3EU4 A;  2LJK A;  3F6F A;  1OKT A;  3APO A;  3G7J A;  1TRS A;  1DE2 A;  3TGZ A;  1ZZY A;  1BX9 A;  1TI3 A;  3UMA A;  3H4K A;  2G0F A;  2FLS A;  6GST A;  2O85 A;  2O8V B;  2IPA A;  4PNG A;  3VI7 A;  2HLS A;  4AJ6 A;  1K0A A;  5CP1 A;  4RI6 A;  5G5F A;  1Z6N A;  1JZR A;  3AY8 A;  5F06 A;  2VCW A;  3L0H A;  2HSY A;  3LJR A;  3K8N A;  4D73 A;  2PWJ A;  3GMF A;  5J4U A;  5D8I A;  2K6V A;  1E2Y A;  2HZE A;  1WIK A;  3HVV A;  2AYT A;  2B7K A;  4IGJ A;  1FW1 A;  2JL4 A;  4TN8 A;  4DSQ A;  3IK7 A;  1A24 A;  1M2B A;  4X43 A;  2PN8 A;  3TRQ A;  5D9W A;  1PL2 A;  4G2E A;  2C0D A;  1G0T A;  4WF5 A;  3UAR A;  2VCQ A;  3GH6 A;  1EV9 A;  2YJ7 A;  2YN1 A;  4FO5 A;  1MTC A;  2A4H A;  4ZIJ A;  4N10 A;  4CW9 A;  3J7Y b;  3RHB A;  2A4V A;  3PH9 A;  3FKF A;  3FYG A;  1IYH A;  1S3C A;  2VCT A;  1BJX A;  1X9S B;  4XS4 B;  2A2R A;  3FZ4 A;  1UN2 A;  3BCK A;  4EKZ A;  2X8C A;  6GSV A;  1Z6M A;  4OFM A;  2QGV A;  4WBJ A;  9GSS A;  3CYN A;  4WR5 A;  3HJO A;  3F6D A;  2QKE A;  5CRG A;  4N0V A;  1DE1 A;  3G7Y A;  4XTS A;  1JHB A;  2KLX A;  3N5O A;  1TRW A;  2V1M A;  5KN1 A;  2RLI A;  5J41 A;  3ZLP A;  2XBI A;  5ECH B;  3ZML A;  1UA5 A;  3FR6 A;  4NHW A;  3BOA A;  3F8U A;  18GS A;  2B1L A;  1BYE A;  1SD9 A;  4KSO A;  2PU9 C;  1O6J A;  1SK2 A;  5DCH A;  5HR2 A;  2XPE A;  5ECK B;  4YQV A;  4J57 E;  2YNX A;  3GYK A;  1WOU A;  2M66 A;  2K8V A;  2VL2 A;  2CAI A;  5HR3 A;  3I6A A;  2HYX A;  4NMU A;  4ICY A;  2V6K A;  4O32 A;  4ZL7 A;  2C0G A;  3QDN A;  3TRX A;  4MZW A;  3H8Q A;  4KF9 A;  1TRU A;  4ZB8 A;  1T4Y A;  2FWH A;  4ZL8 A;  2HXK A;  1YEX A;  2IME A;  6GSW A;  1ZYP A;  2GT5 A;  2F8F A;  3UBL A;  3TKP A;  3QAW A;  1X9W B;  1SKW B;  2GVP A;  2WS2 A;  1XOA A;  2GZP A;  2L4Q A;  4LL4 B;  3EUR A;  4V1A p;  2BTO T;  1ACV A;  4ECB A;  4OWY A;  4EDY A;  2LRC A;  5ECO B;  2MMZ A;  4RQX A;  4YQU A;  4K2D A;  2NPB A;  3D5J A;  4EE0 A;  2HZE B;  2AHE A;  4EDZ A;  3GIX A;  1WJK A;  2DJ1 A;  4P3Y B;  3UVH A;  1TW9 A;  4TXO B;  2VD1 A;  5CRH A;  3LWA A;  3QMX A;  4KDX A;  4POM A;  2YWM A;  5G1L A;  1M9B A;  2KP1 A;  1NM3 A;  3DIE A;  3DWV A;  3GTU A;  2VOC A;  4MK3 A;  3GN3 A;  2EIQ A;  5IOX A;  2E0Q A;  4JR6 A;  3M3M A;  3FHK A;  1VF3 A;  6GSX A;  1K0D A;  1M99 A;  2GST A;  3BBY A;  4WEY A;  3I9V 2;  1V40 A;  4PQH A;  1FVK A;  1MDJ A;  5JWQ B;  5CRD A;  3UEM A;  1ZGN A;  2REM A;  1GRX A;  2PBJ A;  4KB3 A;  4ILF A;  1GSD A;  3DVW A;  4GF0 A;  1XPV A;  4V2L A;  2VL2 C;  1EWX A;  3V1W A;  3A5I A;  3F3Q A;  3DGQ A;  3L9S A;  2FY6 A;  2L57 A;  3VWU A;  3W8J A;  3F9U A;  2KOK A;  5D73 A;  2DIZ A;  3UVT A;  3PIN A;  1GNW A;  4ID0 A;  2DJ3 A;  2GQK A;  2MZC A;  2VLT A;  2G2Q A;  1PA3 A;  4TR1 B;  3WGX A;  4MJA A;  3VK9 A;  2H0G A;  4HJ2 A;  2VO4 A;  2J9H A;  2YAN A;  3WGD A;  3M9K A;  3UAP A;  4HJM A;  2VCX A;  5HQP A;  3EE2 A;  3C73 A;  3JCM L;  1F3A A;  3QFB C;  2H1A A;  1SYX A;  5IO2 A;  1SJI A;  2WDU A;  11GS A;  2MBS A;  5F8B A;  4HU7 A;  2H6X A;  2R5G A;  5CRW A;  1ZL9 A;  4Q5F A;  3HZ8 A;  3WGE A;  1DSB A;  2HRF A;  3GKN A;  3VPT A;  3MAK A;  2C1Y A;  5CAX A;  3APQ A;  1R26 A;  2ZNM A;  3F4S A;  4OO4 A;  3P8W A;  4KX4 A;  2IWT A;  1YKC A;  1GWC A;  3ME8 A;  5J5N A;  4BVX B;  3BCI A;  2CVD A;  5DCG A;  1XIY A;  2H76 A;  5DQY A;  4JU5 A;  1U3A A;  5JCG A;  5ECS A;  3ZIV A;  2ES7 A;  3RBT A;  2B1K A;  1JZD A;  4JED A;  1SK0 A;  3KTB A;  1GL8 A;  5G30 A;  1USB A;  2IJY A;  1U6T A;  1XBS A;  7GSS A;  2RII A;  1R4W A;  5B6N A;  1U3I A;  1UVZ A;  4FIW A;  2GZY A;  3KMO A;  4MH2 A;  3L9U A;  3Q6O A;  2E7P A;  1Z7P A;  4OO5 A;  2TIR A;  5DAL A;  4FQU A;  4MH3 A;  5HR0 A;  3HD5 A;  4XCS A;  4L0W A;  3ZRD A;  1OE7 A;  3LOR A;  1FB6 A;  2C3N A;  3ZIT A;  3GA4 A;  4YKG A;  1GUK A;  4L0U A;  2M80 A;  5IO0 A;  3HDC A;  1XWB A;  3MSZ A;  3IRA A;  4ULX A;  2YV7 A;  2R3X A;  2K9F A;  3CSH A;  4I8B A;  1AC1 A;  1BG5 A;  4KND A;  2WJU A;  4MCU A;  4Z2R A;  2FCH A;  1KEB A;  2M46 A;  1B9X C;  3KMN A;  1B9Y C;  1O81 A;  5E4W A;  1K0O A;  3Q74 A;  3FR3 A;  2DKI A;  5J3R A;  1FVJ A;  3ERG A;  2CVB A;  4PUR A;  5A4U A;  4HDE A;  2C0F A;  2F8A A;  1PQN A;  3FR9 A;  1N2A A;  5HFG A;  2VL9 A;  4KGI A;  4J2F A;  1FOV A;  1SJ6 A;  2AJQ B;  2X8G A;  1Z5Y E;  3UIW A;  4NAX A;  1N8J A;  4RQR A;  4K7N A;  3IHQ A;  2YOI A;  2EC4 A;  1XWG A;  5IPH A;  2R0G A;  4HZ4 A;  3CBU A;  1E6B A;  3IV4 A;  3ZL5 A;  1YJ6 A;  2JU5 A;  2MYG A;  1PKZ A;  5ENU A;  2KHP A;  1SD8 A;  2EIO A;  4MF7 A;  1GSY A;  5ECR B;  2L6D A;  3VWX A;  5HFI A;  5J9C A;  4DSS A;  1Q4J A;  5FWG A;  1B4P A;  3FZ5 A;  2R37 A;  3C7M A;  3I43 A;  2CQ9 A;  5AIX A;  1DBY A;  1OC3 A;  1SEN A;  1A2J A;  2PER A;  4L8E A;  1V98 A;  4EF0 A;  3US3 A;  2YV9 A;  3TKS A;  4BVY B;  2YP6 A;  3O76 A;  4NHZ A;  4MF5 A;  1FHE A;  1K0N A;  2DJ0 A;  2HRN A;  3RPP A;  3I69 A;  2RM6 A;  4PUF C;  5H5Q A;  1ZOF A;  3VWV A;  5DVB A;  2PPT A;  1AIU A;  2N5B A;  2X49 A;  4N11 A;  4GXZ A;  5DJL A;  4YKF A;  1TRV A;  1Z3E A;  1Y6E A;  3NOF A;  3UOM A;  1YF1 A;  3GUR A;  1YZX A;  4HQS A;  5ELA A;  4Q5R A;  3TKR A;  4XS1 A;  3TKS E;  2TRX A;  2DIY A;  1G7D A;  2GSQ A;  1T8E B;  3HA9 A;  1B4Q A;  3ZZX A;  3KM6 A;  4G0I A;  1A2L A;  2DJ2 A;  2OE3 A;  4IN0 A;  2WZ9 A;  3L9V A;  1MD3 A;  4MP4 A;  3QR6 A;  2OBI A;  3HVS A;  5EL8 A;  4F2I A;  2GTU A;  2GSR A;  3C8E A;  5GZZ B;  2IMD A;  5ECQ B;  4IQA A;  1WE0 A;  4GST A;  1JFU A;  1ZYQ B;  3IA1 A;  1G6Y A;  4IEL A;  3LGC A;  1X5D A;  1VF4 A;  5H5S A;  4CHS A;  3RDW A;  3WYW A;  1V58 A;  1FAA A;  1OYJ A;  5GAP D;  1SKR B;  2B6M A;  2BJX A;  2UZ8 A;  1PGT A;  2L5L A;  1DUG A;  3N9J A;  4EUY A;  5E59 A;  2I1U A;  1H4O A;  5AN1 A;  5DDL A;  3F63 A;  1RW1 A;  4I2U A;  4V2M A;  3S9F A;  4TR0 A;  1M2A A;  2FNO A;  2EIR A;  5EPF A;  4Z2T A;  2WRT A;  3TKS C;  2H74 A;  4EO3 A;  1SJZ A;  1RQM A;  5B8B A;  5B7C A;  1I9D A;  2HT9 A;  4HU9 A;  4TKY A;  3PGT A;  4TR4 A;  1B48 A;  3IC8 A;  4KAE A;  4IP6 A;  3R3E A;  3EIN A;  3W8S A;  3A5W A;  3J7Y k;  3WT1 A;  4K6X A;  4F0C A;  1GSQ A;  1SL0 B;  4LMW A;  1EGR A;  4IP1 A;  3PPU A;  4ZIL A;  1XWK A;  2VLV A;  4QL7 A;  2L6C A;  3ZYW A;  1URM A;  2I81 A;  1K3O A;  3U6V A;  13GS A;  1SKS B;  3KJY A;  1T00 A;  2VLU A;  4NWY A;  1ON4 A;  4O7H A;  3ERW A;  3TJF A;  5FHI A;  2OJL A;  5IMF A;  1YKA A;  4L5O A;  3ED3 A;  1YQ1 A;  3ZMK A;  2V6O A;  3DEX A;  1ST9 A;  3DVX A;  5GST A;  1OVN A;  3MYD A;  3DML A;  3FZ9 A;  2B3S A;  1O7U A;  1W4V A;  4BWQ A;  1SL2 B;  2JAC A;  2X4A A;  4DEJ A;  2MMO A;  2DMM A;  3O3T A;  1PX6 A;  4D73 B;  1FO5 A;  1GP1 A;  4IVF A;  4CY8 A;  1RK4 A;  2OAC A;  5DAK A;  1FB0 A;  2GT6 A;  5CNW A;  3UBK A;  1ERU A;  1PX7 A;  3D21 A;  3ME7 A;  2V2G A;  2AAW A;  2PVO C;  2CV4 A;  2IMF A;  2A2S A;  1TDI A;  3FY7 A;  2P5Q A;  1PRX A;  2OBK A;  4XS6 A;  5INY A;  4WXT A;  5JWR B;  1GSU A;  3MDK A;  1YF0 A;  3GL5 A;  1TK8 B;  2Z9S A;  5BMU A;  5IM9 A;  1GSE A;  3TRP A;  5ID2 A;  2C3T A;  3FK8 A;  3LEF A;  1M7T A;  3D22 A;  2H71 A;  2WUL A;  4AF2 A;  3GX0 A;  5D93 A;  2I9H A;  2HSH A;  3GL3 A;  1FG4 A;  2YCD A;  5FT3 A;  4EVM A;  2XHF A;  3KH9 A;  4F03 A;  3EYT A;  3KXO A;  4OCE A;  3KTL A;  4PX1 A;  3R2Q A;  4K7O A;  1X5E A;  2HRA A;  4I5Q A;  3WT2 A;  2A2P A;  1O85 A;  3GSS A;  3TJG A;  1JLW A;  1T1V A;  4N30 A;  1O73 A;  4RUV A;  1OC9 A;  2VUP A;  3DRN A;  2M72 A;  2C4J A;  1TKD B;  2FA4 A;  2C8U A;  2O87 A;  5A4W A;  2RUE A;  1HQO A;  5COH A;  3CRT A;  2FGX A;  2LV3 A;  3BD2 A;  1OC8 A;  2FHE A;  4Q5N A;  4ECJ A;  1XWA A;  1XW5 A;  4OFT A;  1F9M A;  1JZO A;  2RM5 A;  2LQO A;  4ML1 A;  1Z7R A;  5KN2 A;  3GKK A;  2H01 A;  3VUR A;  3IXR A;  1K3L A;  1F2E A;  1C72 A;  5ABR A;  3Q19 A;  2WFC A;  4IKH A;  4EC0 A;  2QA2 A;  1YEP A;  1TU8 A;  1XVQ A;  2HI7 A;  1S3A A;  2LRT A;  2H1G A;  4GLT A;  2C3Q A;  3IAS 2;  3GX8 A;  3LXZ A;  4K5S A;  5EVO A;  2P0G A;  3KH7 A;  3UL3 A;  1F3B A;  3KEB A;  4H86 A;  5G31 A;  2NDO A;  2R2J A;  4WF4 A;  4HOJ A;  4QQ7 A;  5DAK B;  4YAP A;  3F4T A;  1PN9 A;  5F07 A;  3P7X A;  6GSY A;  3IR4 A;  1A0R P;  1ERT A;  3C1S A;  2MBT A;  1EOH A;  2O89 A;  4K0G A;  3GUS A;  5D9V A;  4WET A;  1TJD A;  3P90 A;  5EY6 A;  3EC3 A;  3FW2 A;  3RHC A;  1XW9 A;  3LXT A;  2X64 A;  2F9S A;  3GTU B;  4KCE A;  1J9B A;  2CX3 A;  4OCF A;  4O92 A;  1EGO A;  4KSM A;  2DBC A;  5ID2 B;  1BAY A;  4E8H A;  5JCU A;  2H0H A;  1XCC A;  2ON7 A;  1WMJ A;  3KZQ A;  1OE8 A;  1XOB A;  5KN0 A;  4PUA A;  1CQH A;  5JCW A;  3A3T A;  2XC2 A;  1GSF A;  4ZB6 A;  3VWW A;  2CZ2 A;  2I3Y A;  3IPZ A;  1AQV A;  2DML A;  1A0F A;  1ABA A;  5G2Z A;  5ECP B;  1GTA A;  1PN0 A;  2CAQ A;  3GV1 A;  2YZH A;  4HI7 A;  3CTF A;  5ECI B;  1QXH A;  3QFA C;  1U87 A;  3E9J B;  4PXO A;  2H70 A;  3CSJ A;  3GH9 A;  1NHO A;  4O5R A;  3LYK A;  1X0R A;  5F0G A;  3QD9 A;  1A2M A;  3F3R A;  3H79 A;  1IYI A;  1R5P A;  2QA1 A;  2I4A A;  4POK A;  1OC9 B;  1WRY A;  2H8L A;  12GS A;  4GTU A;  1ZYN A;  4I6X A;  3HXS A;  2JAD A;  3FMW A;  3TOU A;  4KE3 A;  1AUC A;  1F6M C;  2GGT A;  2VL3 A;  1AAZ A;  3IHG A;  2VD0 A;  4V1A g;  1PKW A;  2HNL A;  4MZC A;  4GSS A;  1G7E A;  4WKW A;  3A2V A;  3ZRE A;  1SL1 B;  5C04 A;  3QAV A;  3CRU A;  3KP9 A;  1EZK A;  2CT6 A;  2JZT A;  2ZUP A;  4HZ2 A;  5CO3 A;  4JRR A;  1PSQ A;  2JZR A;  1G7O A;  1TXX A;  1NSW A;  2QSI A;  4ZL9 A;  3VI5 A;  4NV2 A;  1G6W A;  2IMK A;  3EVI A;  4ML6 A;  3HHV A;  4ECI A;  3RPN A;  1UC7 A;  1ZMA A;  1GSS A;  4XRD A;  4POB A;  2VAF A;  1V57 A;  4K5R A;  4K0N A;  1KNG A;  2JSY A;  4PGT A;  1SK1 A;  4BA7 A;  1K0M A;  5C00 A;  4GRF A;  2NTO A;  4KA0 A;  4TRX A;  3H93 A;  2CX4 A;  4N0Z A;  4LL1 B;  4KCA A;  3GNJ A;  2RUF A;  2H19 A;  5AIS A;  1WPI A;  4EIQ A;  1KBN A;  4QL9 A;  5KOX A;  1Y25 A;  2OE0 A;  2E2M A;  3DXB A;  2H6Z A;  3SBC A;  4LLR A;  2F51 A;  3ZVJ D;  1VF2 A;  1YY7 A;  3D4M A;  5HR1 A;  2YJH A;  3CXG A;  3IK9 A;  3A2X A;  1SU9 A;  5DAL B;  3TCO A;  5H5R A;  3D6I A;  1XXU A;  5B6M A;  4PQI A;  4EL1 A;  1MEK A;  2R4V A;  2FD3 A;  1TU7 A;  4CDO A;  2H72 A;  1T3B A;  4G10 A;  1GNE A;  3EMX A;  4K2X A;  5IMV A;  1EOG A;  1EV4 A;  2P5R A;  4K9Z A;  2VCV A;  5LD0 A;  2FWE A;  3GST A;  3L78 A;  4J56 E;  1A8L A;  2GZZ A;  1QK8 A;  17GS A;  2PVQ A;  2IFQ A;  3QPM A;  2VIM A;  3IC4 A;  3CMI A;  3IOS A;  4HQZ A;  3KIJ A;  4KUN A;  2FWF A;  4ZXG A;  2LKU A;  4X4J A;  4G9H A;  4NXI A;  2PMT A;  1HYU A;  1MDI A;  1Z9H A;  3BJ5 A;  2GDR A;  2H75 A;  4K8M A;  1HD2 A;  2H1D A;  3E3E A;  3FRC A;  4TXV A;  2WCI A;  2IN3 A;  3LW9 A;  2J23 A;  4TXO A;  3HYP A;  1EP7 A;  2HRK A;  2OE1 A;  1WWJ A;  3D0Z A;  1H75 A;  4MF6 A;  2GSS A;  1YDK A;  1F37 A;  1HNC A;  3HCZ A;  1TOF A;  4FYU A;  1V2A A;  3PR8 A;  3D4T A;  3LQ7 A;  1WP0 A;  1R5A A;  2L59 A;  4MMM A;  2LNS A;  4XRA A;  2AUV A;  4DSS B;  2NVL A;  1GUH A;  4AJ8 A;  4ZB9 A;  1NHY A;  4I2T A;  1EP8 A;  6GSU A;  1LU4 A;  3UJ1 A;  4BPY A;  3TB2 A;  3GKX A;  3EMP A;  4PNF A;  4ISD A;  4X0X A;  1GUM A;  3U5R E;  1CQG A;  1K3Y A;  2GS3 A;  2C0E A;  2OKA A;  2IIY A;  1S3D A;  1A23 A;  4G0L A;  4TR1 A;  1THX A;  1VRS D;  1A8Y A;  1ERV A;  5D9T A;  3CTG A;  3DYR A;  2YPM A;  4KH7 A;  3M0F A;  4IHU A;  2H0I A;  2B7J A;  2F3M A;  4F9Z A;  4USS A;  4Z2U A;  3M1G A;  5KN3 A;  3EPT A;  2IL3 A;  1U88 A;  3LSZ A;  4KDU A;  14GS A;  2K8S A;  4JZQ A;  3ISO A;  2VCZ A;  2ALB A;  4L5L A;  3A2W A;  2H66 A;  1OKD A;  2DKH A;  3O6T A;  3HKR A;  4KW6 A;  3EWL A;  1MD4 A;  4MLY A;  3LG6 A;  3TUE A;  4GWR A;  1QMV A;  1B8X A;  2VM1 A;  4LMV A;  1R7H A;  4LA1 A;  1TP9 A;  4ECC A;  1LJR A;  2CA8 A;  2GLR A;  2HFD A;  1HNA A;  4O5Q A;  3NZN A;  5IPG A;  4XHM A;  2IFQ B;  5A4V A;  1T7P B;  3P2A A;  3GRX A;  3E0U A;  4BVX A;  3M9J A;  2NBS A;  4V2N A;  3QCP A;  1Q98 A;  4MDC A;  1FOH A;  3HZ4 A;  2V41 A;  4A5P A;  3KCM A;  4BL7 A;  4MZB A;  1HNB A;  3ZTL A;  3TDG A;  3MNG A;  5D9X A;  4YAV A;  2LJR A;  5AIV A;  3Q18 A;  5AGY A;  5IMZ A;  3F0I A;  1KTE A;  2VM2 A;  4FH8 A;  4MJB A;  4PTS A;  4X1U A;  4MJC A;  3G7I A;  4AGS A;  1VGL A;  4YQM A;  2YWI A;  1AXD A;  16GS A;  5JWO B;  4ACS A;  2FUG 2;  5HFK A;  3QOU A;  4RI7 A;  2N5A A;  5B8A A;  4WR4 A;  3FEU A;  4FYB A;  1K0B A;  1O8X A;  1K0C A;  4XIH A;  1XW6 A;  3HY2 A;  1BED A;  4DVC A;  3ZFL A;  2XPD A;  1M2D A;  1SYR A;  3H1N A;  5DBQ A;  4MPF A;  2DLX A;  5CYY A;  4MAB A;  3KP8 A;  2H30 A;  4MJE A;  3F4R A;  2H6Y A;  2V32 A;  3DKS A;  6GSS A;  2GQM A;  5GAN D;  4GQC A;  5KEJ A;  1TTZ A;  2HE3 A;  4KDY A;  2L5O A;  2OAD A;  3C1R A;  3GHA A;  3LFL A;  2ON5 A;  3IDV A;  5KOW A;  2B5X A;  4K1F A;  3ZVJ A;  1PD2 1;  3L4N A;  1QFN A;  5J9B A;  2XBQ A;  1I5G A;  3WD6 A;  1XVW A;  1GH2 A;  3FZA A;  4EIP A;  1TK5 B;  2LRN A;  3TJJ A;  4IQ1 A;  4FYC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...