The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
11
|
sequence length |
60
|
structure length |
60
|
Chain Sequence |
WIARINAAVRAYGLNYSTFINGLKKAGIELDRKILADMAVRDPQAFEQVVNKVKEALQVQ
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
NMR Structure of Bacterial Ribosomal Protein L20: Implications for Ribosome Assembly and Translational Control
pubmed doi rcsb |
| molecule tags |
Ribosomal protein
|
| source organism |
Aquifex aeolicus
|
| molecule keywords |
50S RIBOSOMAL PROTEIN L20
|
| total genus |
11
|
| structure length |
60
|
| sequence length |
60
|
| ec nomenclature | |
| pdb deposition date | 2002-05-02 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | c-terminal domain of poly(a) binding protein | Ribosomal protein L20 |
#chains in the Genus database with same CATH superfamily 1GYZ A; 2GHJ A; #chains in the Genus database with same CATH topology 3KUJ A; 1G9L A; 2HH6 A; 2O3L A; 3KUI A; 3KUR A; 2DYD A; 4IVE A; 2RQH B; 1JGN A; 4KXF B; 2O4T A; 2RQG B; 3KUT A; 2X04 A; 3PKN A; 3KUS A; 1JH4 A; 1NMR A; 1I2T A; 3KTP A; 2GHJ A; 1IFW A; 1GYZ A; 3M92 A; 3KTR A; 2LKL A; 3NTW A; 3PTH A; #chains in the Genus database with same CATH homology 1GYZ A; 2GHJ A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
