1ICFI

Crystal structure of mhc class ii associated p41 ii fragment in complex with cathepsin l
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
65
structure length
65
Chain Sequence
LTKCQEEVSHIPAVHPGSFRPKCDENGNYLPLQCYGSIGYCWCVFPNGTEVPNTRSRGHHNCSES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of MHC class II-associated p41 Ii fragment bound to cathepsin L reveals the structural basis for differentiation between cathepsins L and S.
pubmed doi rcsb
molecule keywords PROTEIN (CATHEPSIN L: HEAVY CHAIN)
molecule tags Hydrolase
total genus 12
structure length 65
sequence length 65
chains with identical sequence J
ec nomenclature
pdb deposition date 1999-01-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.800.10 Few Secondary Structures Irregular Invariant Chain; Chain I Thyroglobulin type-1 1icfI00
2DSQG 2DSRG 1L3HA 1RMJA 1ZT3A 2H7TA 1ZT5A 1ICFI
chains in the Genus database with same CATH superfamily
2DSQG 2DSRG 1L3HA 1RMJA 1ZT3A 2H7TA 1ZT5A 1ICFI
chains in the Genus database with same CATH topology
2DSQG 2DSRG 1L3HA 1RMJA 1ZT3A 2H7TA 1ZT5A 1ICFI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DSQ G;  2DSR G;  1L3H A;  1RMJ A;  1ZT3 A;  2H7T A;  1ZT5 A;  1ICF I; 
#chains in the Genus database with same CATH topology
 2DSQ G;  2DSR G;  1L3H A;  1RMJ A;  1ZT3 A;  2H7T A;  1ZT5 A;  1ICF I; 
#chains in the Genus database with same CATH homology
 2DSQ G;  2DSR G;  1L3H A;  1RMJ A;  1ZT3 A;  2H7T A;  1ZT5 A;  1ICF I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...