1RMJA

C-terminal domain of insulin-like growth factor (igf) binding protein-6: structure and interaction with igf-ii
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
107
structure length
107
Chain Sequence
SYYHHHHHHDYDIPTTENLYFQGAMGSGPCRRHLDSVLQQLQTEVYRGAQTLYVPNCDHRGFYRKRQCRSSQGQRRGPCWCVDRMGKSLPGSPDGNGSSSCPTGSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title C-terminal domain of insulin-like growth factor (IGF) binding protein-6: structure and interaction with IGF-II.
pubmed doi rcsb
molecule keywords Insulin-like growth factor binding protein 6
molecule tags Hormone/growth factor
source organism Homo sapiens
total genus 20
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2003-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00086 Thyroglobulin_1 Thyroglobulin type-1 repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.800.10 Few Secondary Structures Irregular Invariant Chain; Chain I Thyroglobulin type-1 1rmjA01
2DSQG 1ICFI 1RMJA 1L3HA 1ZT3A 1ZT5A 2DSRG 2H7TA
chains in the Genus database with same CATH superfamily
2DSQG 1ICFI 1RMJA 1L3HA 1ZT3A 1ZT5A 2DSRG 2H7TA
chains in the Genus database with same CATH topology
2DSQG 1ICFI 1RMJA 1L3HA 1ZT3A 1ZT5A 2DSRG 2H7TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DSQ G;  1ICF I;  1RMJ A;  1L3H A;  1ZT3 A;  1ZT5 A;  2DSR G;  2H7T A; 
#chains in the Genus database with same CATH topology
 2DSQ G;  1ICF I;  1RMJ A;  1L3H A;  1ZT3 A;  1ZT5 A;  2DSR G;  2H7T A; 
#chains in the Genus database with same CATH homology
 2DSQ G;  1ICF I;  1RMJ A;  1L3H A;  1ZT3 A;  1ZT5 A;  2DSR G;  2H7T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...