1L3HA

Nmr structure of p41icf, a potent inhibitor of human cathepsin l
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
65
structure length
65
Chain Sequence
LTKCQEEVSHIPAVHPGSFRPKCDENGNYLPLQCYGSIGYCWCVFPNGTEVPNTRSRGHHNCSES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Synthesis and NMR structure of P41ICF, a potent inhibitor of human cathepsin L
pubmed doi rcsb
molecule keywords MHC CLASS II-ASSOCIATED P41 INVARIANT CHAIN FRAGMENT (P41icf
molecule tags Immune system
total genus 17
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2002-02-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.800.10 Few Secondary Structures Irregular Invariant Chain; Chain I Thyroglobulin type-1 1l3hA00
1ZT3A 2DSRG 1RMJA 1L3HA 2DSQG 2H7TA 1ICFI 1ZT5A
chains in the Genus database with same CATH superfamily
1ZT3A 2DSRG 1RMJA 1L3HA 2DSQG 2H7TA 1ICFI 1ZT5A
chains in the Genus database with same CATH topology
1ZT3A 2DSRG 1RMJA 1L3HA 2DSQG 2H7TA 1ICFI 1ZT5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZT3 A;  2DSR G;  1RMJ A;  1L3H A;  2DSQ G;  2H7T A;  1ICF I;  1ZT5 A; 
#chains in the Genus database with same CATH topology
 1ZT3 A;  2DSR G;  1RMJ A;  1L3H A;  2DSQ G;  2H7T A;  1ICF I;  1ZT5 A; 
#chains in the Genus database with same CATH homology
 1ZT3 A;  2DSR G;  1RMJ A;  1L3H A;  2DSQ G;  2H7T A;  1ICF I;  1ZT5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...