2DSRG

Structural basis for the inhibition of insulin-like growth factors by igf binding proteins
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
79
structure length
79
Chain Sequence
GSCQSELHRALERLAASQSRTHEDLYIIPIPNCDRNGNFHPKQCHPALDGQRGKCWCVDRKTGVKLPGGLEPKGELDCH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the inhibition of insulin-like growth factors by insulin-like growth factor-binding proteins.
pubmed doi rcsb
molecule keywords Insulin-like growth factor-binding protein 4
molecule tags Protein binding/hormone/growth factor
source organism Homo sapiens
total genus 17
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2006-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00086 Thyroglobulin_1 Thyroglobulin type-1 repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.800.10 Few Secondary Structures Irregular Invariant Chain; Chain I Thyroglobulin type-1 2dsrG00
1RMJA 1L3HA 1ZT5A 2DSQG 1ZT3A 2DSRG 1ICFI 2H7TA
chains in the Genus database with same CATH superfamily
1RMJA 1L3HA 1ZT5A 2DSQG 1ZT3A 2DSRG 1ICFI 2H7TA
chains in the Genus database with same CATH topology
1RMJA 1L3HA 1ZT5A 2DSQG 1ZT3A 2DSRG 1ICFI 2H7TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RMJ A;  1L3H A;  1ZT5 A;  2DSQ G;  1ZT3 A;  2DSR G;  1ICF I;  2H7T A; 
#chains in the Genus database with same CATH topology
 1RMJ A;  1L3H A;  1ZT5 A;  2DSQ G;  1ZT3 A;  2DSR G;  1ICF I;  2H7T A; 
#chains in the Genus database with same CATH homology
 1RMJ A;  1L3H A;  1ZT5 A;  2DSQ G;  1ZT3 A;  2DSR G;  1ICF I;  2H7T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...