The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
18
|
sequence length |
98
|
structure length |
98
|
Chain Sequence |
GPLGSPLTASMLASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAKEAAQKAVNSATGVPTV
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structural basis of ligand recognition by PABC, a highly specific peptide-binding domain found in poly(A)-binding protein and a HECT ubiquitin ligase
pubmed doi rcsb |
| molecule keywords |
polyadenylate-binding protein 1
|
| molecule tags |
Rna binding protein
|
| source organism |
Homo sapiens
|
| total genus |
18
|
| structure length |
98
|
| sequence length |
98
|
| ec nomenclature | |
| pdb deposition date | 2001-06-27 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00658 | PABP | Poly-adenylate binding protein, unique domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | c-terminal domain of poly(a) binding protein | c-terminal domain of poly(a) binding protein |
#chains in the Genus database with same CATH superfamily 2HH6 A; 3KUI A; 1G9L A; 1I2T A; 2RQH B; 3KUJ A; 1JGN A; 3KUR A; 3KTP A; 3PKN A; 2RQG B; 1IFW A; 2O3L A; 2DYD A; 2O4T A; 3PTH A; 3KUS A; 3KTR A; 3NTW A; 1JH4 A; 2X04 A; 3KUT A; 4IVE A; 1NMR A; #chains in the Genus database with same CATH topology 2HH6 A; 3KUI A; 1G9L A; 4KXF B; 1I2T A; 1GYZ A; 3M92 A; 2RQH B; 3KUJ A; 1JGN A; 3KUR A; 3KTP A; 3PKN A; 2RQG B; 1IFW A; 2GHJ A; 2O3L A; 2DYD A; 2O4T A; 3PTH A; 3KUS A; 3KTR A; 3NTW A; 1JH4 A; 2LKL A; 2X04 A; 3KUT A; 4IVE A; 1NMR A; #chains in the Genus database with same CATH homology 2HH6 A; 3KUI A; 1G9L A; 4KXF B; 1I2T A; 3M92 A; 2RQH B; 3KUJ A; 1JGN A; 3KUR A; 3KTP A; 3PKN A; 2RQG B; 1IFW A; 2O3L A; 2DYD A; 2O4T A; 3PTH A; 3KUS A; 3KTR A; 3NTW A; 1JH4 A; 2LKL A; 2X04 A; 3KUT A; 4IVE A; 1NMR A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...