The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
34
|
sequence length |
144
|
structure length |
144
|
Chain Sequence |
KSKAHKAIELQMALQGLAQSAYKTEDWTLQDTCEELWNTEPTHCFKKGGQTVQVYFDGNKDNCMTYVAWDSVYYMTDAGTWDKTATCVSHRGLYYVKEGYNTFYIEFKSECEKYGNTGTWEVHFGNNVIDCNDSMCSTSDDTVS
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Viral protein
|
| source organism |
Human papillomavirus type 18
|
| publication title |
Crystal structure of the human papillomavirus type 18 E2 activation domain.
pubmed doi rcsb |
| molecule keywords |
PAPILLOMAVIRUS TRANSCRIPTION FACTOR E2
|
| total genus |
34
|
| structure length |
144
|
| sequence length |
144
|
| ec nomenclature | |
| pdb deposition date | 1999-06-05 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Beta Complex | Regulatory Protein E2; Chain: A; Domain 2 | Regulatory Protein E2; Chain: A; Domain 2 |
#chains in the Genus database with same CATH superfamily 1QQH A; 1R6K A; 2JEX A; 1TUE B; 2JEU A; 2NNU A; 1DTO A; 1R6N A; #chains in the Genus database with same CATH topology 1QQH A; 1R6K A; 2JEX A; 1TUE B; 2JEU A; 2NNU A; 1DTO A; 1R6N A; #chains in the Genus database with same CATH homology 1QQH A; 1R6K A; 2JEX A; 1TUE B; 2JEU A; 2NNU A; 1DTO A; 1R6N A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
