1R6NA

Hpv11 e2 tad complex crystal structure
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
196
structure length
196
Chain Sequence
HEAIAKRLDACQDQLLELYEENSIDIHKHIMHWKCIRLESVLLHKAKQMGLSHIGLQVVPPLTVSETKGHNAIEMQMHLESLAKTQYGVEPWTLQDTSYEMWLTPPKRCFKKQGNTVEVKFDGCEDNVMEYVVWTHIYLQDNDSWVKVTSSVDAKGIYYTCGQFKTYYVNFNKEAQKYGSTNHWEVCYGSTVICSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription, replication
molecule keywords HPV11 REGULATORY PROTEIN E2
publication title Crystal Structure of the E2 Transactivation Domain of Human Papillomavirus Type 11 Bound to a Protein Interaction Inhibitor
pubmed doi rcsb
source organism Human papillomavirus type 11
total genus 64
structure length 196
sequence length 196
ec nomenclature
pdb deposition date 2003-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.30 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1r6nA01
2.170.200.10 Mainly Beta Beta Complex Regulatory Protein E2; Chain: A; Domain 2 Regulatory Protein E2; Chain: A; Domain 2 1r6nA02
1R6KA 1DTOA 1QQHA 1TUEB 2JEUA 2NNUA 1R6NA 2JEXA
chains in the Genus database with same CATH superfamily
1OCOC 1ZL8B 4J7KA 1Q3EA 4JI4B 4CS4A 2WLIB 1XNQO 3AG4C 2NN4A 1VQ5V 1URFA 4DV1B 2EILC 3NR7A 4FLTA 1TGOA 5FPRA 1AR5A 3UCSC 3CJHA 4ICGA 3K5OA 4J80A 1W59A 1HNWB 4IHJB 2VRZA 4X20A 2O57A 1ZX3A 3KZIZ 1YJNV 4YIOA 3OT7A 5H5NA 4UV9A 1N33O 2D2CB 5JQGB 4LFAB 1GRJA 1W2BU 2HHHO 1KKDA 4DV3O 1DF4A 4FFKA 4MVZA 2Y4UA 1PNKA 1NQTA 2HLDG 3TXQA 4DV0O 5B1AC 5EC1C 1IBLB 1DTOA 4KP4A 5EIBD 4FVMA 3JAWA 2IU0A 3SYPA 3AK2A 2Q0OC 1Q6IA 3E2EA 1M93A 4F4LA 3SYQA 3ICXA 4K8XA 3ZX6A 4X9QA 1JVMA 3G6BA 4QPKA 2H3OA 4Q20A 4I4TA 3ZEDA 1G6UA 3RGBA 4FM0A 3S3WA 1JCHA 4O2AA 3HKEB 1IX9A 1OCCB 3K5NA 3G80A 3DC6A 1Q6UA 1BSMA 1Z5VA 2P06A 2KKWA 2X0LA 2ARHA 4XDLA 2C2AA 4FZ0A 2VQFO 1N34O 2HVJC 5GTHZ 4GCZA 4MTGA 4LF9O 3KKYA 4FIPC 1K4DC 1NR7A 1QQHA 4TUYA 3CRCA 4GT1A 4FFBB 1M1KW 3CMEV 2OTJV 3H1IH 4P30A 4LBEC 3S3XA 2DW4A 4X66O 4IIJA 3OMIB 2GV9A 3TETA 5HFMA 1FXKA 2ZDIA 1TVKA 3ZCCA 1S3JA 3ZRVA 1U96A 2YICA 3SR2C 1XMOB 1Z2GA 2ITCC 4JI0O 3K0GA 1RSOB 1ZL8A 3WU2Z 2F23A 1MZEA 5BR8B 1M56B 4LNUB 5F2VO 4IYIA 3QNEA 1GM8A 1TUEB 4LR3A 1JR9A 2OCCC 3QG5A 5BMVB 5GTIZ 4DV7B 2P7TC 1V55B 4IHJA 3UQ8A 1PNLA 3IJ4A 1HWYA 4CC5A 1ROPA 2ZM6B 2UU9B 2CGNA 4YY3O 3AEIA 2ZNJA 4TV8B 4GYCB 4MTFA 2HVKC 4DO2A 3LDEA 2NNUA 4LH6A 4X89A 2B9ZA 1M57B 3CPWU 1I5YA 3BAAA 2R72A 2WLKA 3BY6A 3JARB 3GWKC 4ZOLB 4PJ0Z 5EBWC 1QVGU 1WB7A 2F93B 1VQLV 1THZA 3B77A 1EN6A 2N05A 2E75B 1H8HG 3OW2U 2H8PC 1JQ0A 4DYLA 5J9PC 1VQMV 3SPHA 2V4DA 3E8HA 2ZINA 1PD3A 4JI8B 1R3IC 3L71H 2P22C 2QGNA 2ZR3A 3BHPA 2F4VO 2AZ2A 2QTSA 2ZT9B 2UXDB 4BIZA 1GO3F 5LXTB 5EBMC 3AG4B 1FFTB 2P4VA 2EILB 1NZ6A 4FFBA 5DECA 4JI3B 2X6CA 3CCEV 4PI2A 2WLLB 4B3TB 4MW8A 1ZTEA 1YI2V 3OEHG 4HZ3A 2ZE5A 2XAJA 2LFSA 2BSKB 2IH1C 1WLEA 4TT3G 3FX7A 4MVRA 2QJ1A 3ZN0A 2RCVA 4KXRA 4OXSA 3ABLC 2K9PA 4LFBB 5B1AB 3KCXA 4UVAA 3K58A 1OCZC 1RSOA 4LNUA 3CCQV 4DV5B 4L87A 4N21A 4FLUA 1XNRB 2Q73A 2W0FC 4HNAB 5BMVA 2OCHA 1MABG 1KMIZ 1H2LA 1JPXA 1SF9A 1SS3A 3W7UA 2IJJA 4O4IB 4X65B 3SPCA 4P2ZA 5IWAO 2Q8VA 1VQ7V 2BE3A 5B1NA 1P7GA 2EIKC 3VQYA 3VOUA 1IBMB 3DXRB 3JARA 2Q6AA 4ZOLA 1FJGB 4MT8A 1F4NA 1SQFA 1B06A 2EULA 2Y48A 1IURA 1BQ0A 3RT3C 1F51A 4BIUA 1N36O 3IC9A 4DK0A 5KAIZ 2LFRA 2HEPA 1DF5A 4CS3A 5KMGB 4N23A 2PTMA 1NKDA 4UCRA 4YJ2B 2EZOA 2D3OW 2QWPB 3GB7C 1LUVA 3E35A 4IYHA 2LQTA 3WG7C 3OTOO 1R3LC 1D5NA 3T1CA 4DR1B 1XREA 5LXTA 1M4UA 5LHGA 2JK5C 1I94B 3H01A 3IC7A 2WLLA 1TA8A 1Q7YW 5IDJA 4DR6O 1GN3A 4GKJO 1PP9H 1TUBA 1HR0O 1H38A 2VWJA 2RNBA 4NXNB 2BSKA 1AI4A 2CAZC 3H1HH 3E8BA 4DRXB 3D3QA 2Q0AA 2XAFA 1L0NH 4DR4O 3AG7A 1SQXH 3OEEG 1HP8A 3N2KB 4GX0A 5TISZ 3JASA 3OTFA 2FYUH 1SQPH 2E76B 1K9MW 3P30A 4J41A 1SERA 2DMXA 1HNXO 2OYQA 4FK5C 2XASA 4I9QA 5LMUO 1XILA 3JCUZ 2GTSA 4HNAA 2IJIA 1Q81W 1I0HA 1PKXA 3L75H 3CC7V 1N34B 4YHHO 4FM2A 4B3MB 4LF8B 3TJTA 3A0BZ 2XAQA 2A3QA 3Q4HB 4O4IA 5ITZB 2ADPA 2LGWA 5B3SC 4FPPA 1K73W 2R9IA 2B5UA 2PGGA 1FS0G 4GKKB 1R3JC 2EX3A 3MD0A 3O65A 5D5PA 4TSFG 4C7UA 3I55V 2EZPA 5D5QA 1FYJA 2CUGA 5EYPB 3U10A 1YVWA 4FJCC 4WBNB 2W0XA 1MA1A 4JYCA 3KCYA 2QKAA 3JATB 3OAAG 1BZKA 3DTUB 1VP7A 4O4LB 5EZYB 1BT8A 1NR1A 4JI1O 2CDYA 1JX9A 2E5LB 1FD9A 1F23A 4YJ2A 3X2QC 3G4SV 3U11A 2QDOA 4F6RB 2UXCO 5L3BA 4EEQA 3FB7C 2OTLV 2CTQA 3E22B 3F5TA 3THOA 4UVCA 2WLNA 2E74B 2ZIOA 1YXBA 3B4SA 4JPRA 1GAXA 4UUJC 3FD9A 1JA8A 2EJRA 2Q67A 4DUZO 2QM8A 2IJKA 4PDRA 2BCCH 4DR7B 2FL4A 4DRXA 3ZN1A 1KD1W 4Z2WA 2F43G 3SGIA 1YSCA 1XDCA 3N2KA 1R6KA 1SA0B 2GDSA 5K1PA 3BCCH 2A79B 5C8YB 1DGSA 1UPGA 3CCJV 1KP3A 5EC2C 2NR5A 4QIWF 4DUYO 3AG3B 4LF5B 4RUEA 4D6TH 5KHHA 1Q6HA 1GN6A 1KECA 1XBLA 2X6BA 4JI5O 4WF9V 5J2TB 2WLMA 3Q4HA 2A9HA 3ZHUA 3CEIA 5L3EA 1OCRC 5A9GA 1ZAUA 3HKBB 2N74A 1KQSU 3H1LH 3BRCA 4RQEA 5C93A 1YTFB 4Q6GA 1NVPB 4WFHA 1JFFB 2DJVA 2Y0PA 3D36C 2LW1A 5EYPA 2KSDA 4LFCB 2DYSB 4WBNA 2ZXWC 5LA6A 3WB1A 4O4LA 3CXCU 4NTWA 5KX5B 4MTOA 2UUBB 1AJQA 1CP9A 2Y69C 2YS8A 5LYJB 2QR4A 1O9GA 1KU9A 2ATKC 2LGQA 1NTKH 5KA5A 3EVKA 4F6RA 1XHZA 1N32B 4UVBA 2QKCA 1Q43A 4GX1A 4B7KA 2YI9A 4FLZA 1AP6A 1JJ2U 2UXXA 3EXAA 1BHAA 3E22A 3A0RA 3UT5B 4MTXA 3CRAA 5BZBA 4KL1A 1I08A 4X1YA 1NS1A 1Y74B 1XMQB 4O4HB 1XHXA 2ZQMA 1EBOA 3FKSG 4L8JA 1K3EA 4CBCA 4DR3B 4PELA 1A32A 5EK0A 4XDKA 4YIPA 5B1OA 3M8AA 4JZGA 1WJZA 3T1YB 5KHIA 1XL6A 4DV2O 2QWRB 3HKCB 4U3FH 2AW9A 4UCUA 2CTWA 4KHPB 2RN9A 4DR5O 3T1HO 5KUKA 3ZRXA 1V9PA 1N36B 1M9NA 1AI5A 2VS0A 4BWAA 1SA0A 2FKXA 3VQXA 1RPOA 2DWEC 5C8YA 4X88A 5LHIA 4K0KB 3SJQC 3SDLA 2G38A 4FM1A 4PA4A 2WWWA 3RYHB 3VBBA 2UXBO 4P9PA 5EIBC 3K79A 4RAIA 2W6IG 1IBKO 3F7VC 2YC0A 3X2QB 3CX5F 1PL4A 3HKBA 4JI7O 2PY5A 3ABKB 1K7DA 2Y0IA 1K33A 4DR6B 2N04A 4PA9A 1JFFA 5J2UB 2ZR2A 3BABA 1MZFA 1V54C 3ZMSA 1Z5WA 2RQ6A 2VQEB 2JS5A 2DOSA 3TK1A 5FNVB 2QTOA 1CXZB 2RJZA 4QE9A 3A2FA 5KX5A 1IXMA 3W7XA 1VQ6V 5LYJA 3HPLC 2JRIA 2P5OA 2WLIA 5JVDB 3CB2A 2HP8A 5LMNO 1WP7A 3B09A 1BCCH 3RYFB 1BMFG 4X1IB 4JI6B 3DGEA 4LF4B 3UO3A 3I5DA 2BTQB 1QHTA 2CTRA 2X6AA 3UT5A 4X64B 1Y74A 5JQGA 4D7SA 4X62O 4IT5A 2ZIMA 4O4HA 1VQ9V 3I56V 3IAYA 4NYKA 3CRMA 4P9OA 4H44B 4PI0A 1IVSA 4E2LA 3K9AA 3P3PA 1KYOF 1SETA 4H37A 2KG7B 3L9DA 2QM4A 4W4KA 4U3JB 2EINC 1FXHA 1YCIA 4H33A 3WFVA 3CD6V 2YIDA 5AG2A 3CCUV 5E79Z 3M7MX 4JYAO 1NU1H 3E8FA 3JD1A 4JI1B 2UUAB 4UCTA 3HKEA 2ZXWB 3AG1C 2UXCB 2CH7B 1P7BA 4FLXA 4CH6A 3N2GB 3RYHA 1YJWV 1K92A 3UM7A 3JYCA 2HR3A 1OCOB 1WA8B 5H9CA 4DW1A 1SQQH 3KG2A 1J95A 1X59A 2IJHA 4NXMO 1HNZB 4K35A 1K5QA 1XUQA 5J2UA 1AI6A 2AHYA 4LF6B 1Q86W 4JTAB 4B3RO 4DR2O 1J5EO 1GMGA 2PUSA 3AK1A 3JALB 4QPJA 1AB3A 4E4EA 4AQYB 1VQ4V 4TV9B 5DEDA 5LGUA 3K57A 4OX9O 2Z5UA 2M7WA 5IY5C 4I5SA 1MSDA 2E3CA 3ABTA 1Y4MA 1FKAO 5JVDA 4LWSB 1MSWD 2LP7A 2Q68A 2ODMA 2AGAA 4K3AA 3H1KH 3HB3B 3OE7G 1NTMH 2X7RB 3GWOA 3RYFA 3APOA 4F6EA 3K0DA 3K04A 3RBZA 3K03A 3CRRA 2BTQA 4QJFB 4JI4O 4MVMA 4TV8A 4GLXA 1R6NA 1EN5A 2XAGA 2Q7EA 5CA3A 5CA0B 1HNWO 2KG7A 2JVDA 1K8AW 3BVOA 2YIBA 1KBHA 3T4DA 1VF6C 1OZ0A 4NTYA 5B66Z 1NH2D 2DQ3A 5LP6C 1FXVA 2LJ2A 1JOYA 4J7JA 1N0JA 3C3TA 3OGCC 3FYIB 4EB6B 1IBLO 3JAKB 2EJ7A 4I50B 3D36A 3QO5A 4RUFA 3JAMN 2F66C 1ZUQA 3G67A 1YTFD 1WP8A 2Z3YA 1V54B 2V1DA 5B5EZ 3W7WA 2L35A 1XNQB 5GW7A 1F4MA 1GM7A 2CH7A 4MW3A 3SJBC 5CA1B 4R7CA 1R1BA 3N2GA 4NVPA 4WFFA 1GM9A 2KB1A 1Y6XA 3OMNB 2YUAA 1WA8A 4JZ2A 3LSUA 3T2MA 2A7WA 1N33B 4LCUC 1AI7A 1N8RW 1DLBA 1BQZA 2HHHB 2YSUB 2OCCB 4DV3B 4JF3A 4DV0B 5KHJA 2L6LA 1COWG 5IE9A 4CH3A 2MW2B 2K1EA 1Y76B 3JALA 3SPJA 3APQA 1OJHA 2Y4TA 3ZHSA 4ZIBA 1BS3A 1X4TA 2PYJA 2ITDC 2Q9LA 4TV9A 2GBOA 1FXKC 2ZDIC 1P4RA 1G1XB 4H13B 4IGGA 4CH5A 4MS2A 3VQVA 4MVQA 3ZHQA 1VQPV 3OGIB 1VEWA 2EINB 4LWSA 4KUMA 4FLWA 2YXLA 4K8ZA 1XMOO 1R6TA 3ASOC 2UXBB 4I7ZB 2VQFB 5L3FA 5BR8O 4LF9B 5LGTA 3EHBB 1NJIW 4FMTA 4PA7A 4DK1A 1K4CC 4ZHQB 2XHBA 5B1BC 2OT5A 5CA0A 5LL6Y 1QQCA 4DV7O 4PA6A 3DXRA 4PDLA 4X66B 3ASNC 3FFQA 2ZM6O 3BA9A 2UU9O 1SZTA 3A0HZ 3FYEB 5FL7G 4WFAV 1DK1A 3SPIA 2A0LA 1VF7A 4EB6A 1CEZA 2JJ1G 3JAKA 3LDDA 5IT9N 2IM9A 4LP8A 1QU7A 1R3KC 2GTAA 4BIOA 5KMGA 4JI0B 3LNMB 3CCVV 1NI8A 5EBLC 1S77D 1IZ3A 1K97A 3CXHF 4BR6A 1YDXA 1VQ8V 2MK3A 3C90A 1RPRA 3ABLB 4R8CA 4NR1A 1OCZB 3IFXA 4RWUA 4J9YB 5IY5B 2ZKOA 2R9RB 2HKOA 5JH7B 1S76D 4JI8O 4TQFA 2EIMC 4A5UB 5KHGA 4YXWG 3MAQA 4YY3B 3B8MA 4OPHA 5IJ0B 1H2GA 3RYCB 1LR1A 3ETDA 3OUSA 2UXDO 1US6A 2WA3A 3E83A 4J9ZB 2IU3A 2VWKA 3SJCC 1GKFA 1H2KA 3JD4A 1Y76A 4JYBA 4JI3O 1VARA 1KB9F 2EIKB 3L70H 5LOVB 1B3QA 2AXTZ 1AR4A 3J7AU 3ZMUA 1S5HC 5FPOA 2Q4PA 3JAWB 5KHKA 4B3SO 3CC2V 3HKDB 1SQBH 1F7YA 2FB5A 4TWKA 4R6ZA 5LP6B 1T5EA 2YIBD 4DV6O 3RVYA 2UXNA 3OR6C 1FPOA 2F4VB 1D5AA 4Z1VA 1V55C 4UCVA 1ZWIC 1WPXA 4DV5O 2WLHA 1H2SB 4O2AB 5ITZA 4ZI7B 1XNRO 1QNMA 4ZHQA 2YEVB 1L0LH 3BFRA 4U7OA 3SYOA 3RFRA 1XOUA 3WG7B 1RP3B 1H2NA 2AHZA 2WAMA 3FAVB 1GN2A 2R70A 2B1GA 4X65O 4TUYB 3JATA 4X1KB 4IL6Z 4EFBA 5CB4B 4JV5O 5EZYA 1IBMO 4J11A 3JCZA 4W4LA 4J10A 1CPYA 3CP1A 1S0VA 2DQ0A 4WFGA 3CCMV 3ZIAG 4NB5A 4X8AA 1FJGO 2CK3G 3W7SA 1YZBA 1VIBA 3ABMC 2RMKB 1OHHG 3ZHVA 3EFFK 1TVKB 3RYIB 1LNQA 1RFYA 3VQWA 3JD3A 3G6EV 4DW0A 4WCEV 5HFLA 1Q90D 2GSMB 5JH7A 3ZMTA 3H9VA 2F1MA 1Y67A 1UFIA 5IWAB 3MDSA 3JD0A 3CWBH 3H1JH 4G27B 5IJ0A 2DE0X 3ASOB 3RYCA 1D2DA 2PI4A 1ZSPA 4B08A 3ZMZA 4DR1O 3K3WA 3OFNG 1I5XA 4QE7A 4G28B 2ZE6A 5B3SB 5KA6A 1IXBA 1I94O 4TOIA 2BOBC 3BA8A 5B1BB 4JGSA 5LOVA 3LDCA 4UB6Z 2LO1A 2XOKG 4XDJA 3STLC 1ZLZA 5KUMA 4B7EA 3ASNB 4OGQB 4NXNO 1Q5OA 3HKDA 1VF6A 3ETEA 3ZJZA 3OUFA 5LP6A 4EFEA 4HYOA 4UFZA 2YDEA 3OM3B 4CZZA 1QLNA 4KFMA 4R50A 3ZHTA 5J2TA 3OTOB 3OD4A 2DYRC 2QWNB 4H0LB 1FFXB 3MHHC 4ZI7A 2V7QG 2HJDA 4JAVA 2ETNA 2YEVA 2P67A 3C3SA 4JTCB 2CE4A 3FB6C 1NT2B 4GKJB 1HR0B 4UB8Z 1QVFU 4B3MO 4LF8O 4HAMA 3FAVA 5JWPA 2QE7G 3HR0A 4AILC 2NLJC 4JYYA 4NTXA 4X1KA 4YJ3B 4ASUG 2QWQB 2EIMB 3RN4A 5CB4A 5K1XA 4GKKO 2LW7A 3LSQA 1Q82W 4JI2O 1G8MA 3QO8A 4DR4B 1JJOA 1N0NA 2YI8A 1YHQV 1S72V 3LUTB 1O9HA 3DSQA 3K06A 5H6RA 1HNXB 1KKCA 3AK3A 4TQDA 5LMUB 3F5WC 5JCOC 3DC5A 3RYIA 3L74H 1XI1A 4I55B 2Q5ZA 2XNDG 4PDVA 2HFEC 2R9AA 1MG1A 3PN1A 4O4JB 1ORQC 4LH7A 2E5LO 1I7FA 4YHHB 3J80N 3CE2A 3CSXA 1M90W 2A06H 3K59A 3UKMA 4CS2A 3RW0A 1S5LZ 4QNHB 4DXWA 3CRQA 1MMMA 2JEUA 3HKCA 3M99B 3JSNA 2WA4A 4PDMA 1OCRB 2FTKA 1BE3H 5IYDO 2FMLA 1R73A 1QCEA 1GN4A 2UUCO 4G2KA 1NBMG 4DV4O 2JGUA 1L8DA 4DR7O 1FAFA 4GUNA 5KLVH 1G4YB 4U7NA 1H8EG 2DWDC 2KQXA 2YXHA 2Y69B 4AHCA 2BTOA 1B04A 2HG5C 1S5JA 1QR9A 2Z0AA 4MVSA 3ZRWB 1FFXA 4WFBV 1PL0A 2JDIG 3ABMB 3L72H 4RO2A 4LF5O 3NXSA 1OV9A 2XT9A 2GHYA 3BEHA 1K34A 1SC5B 2H94A 2XTAA 4DUZB 2CTPA 4ABMA 2Q69A 1YIJV 1GH6A 4YJ3A 2WLJA 2EIJC 5FNVA 3LSSA 1AP5A 1N4CA 2ZNIA 3ETGA 4LF7O 1P49A 3R66A 2GUZB 3QVNA 5LBQA 1TUBB 3OMAB 3F7YC 1SZXA 5CMUA 1KP2A 1SQGA 1XQ8A 4LFCO 1RM1C 4PV1B 2ADQB 4B3SB 3WB2A 2CGOA 5IYCO 4DV6B 4DUYB 2P90A 2UUBO 4I55A 4UCOA 4X1IA 4O4JA 1PPJH 1BHBA 4JI5B 5CBHA 4UV8A 2RDCA 2B1IA 3SPGA 3P3NA 3JASB 4MSWC 1W0JG 4DV1O 5CBFA 3SYAA 1N32O 1VQKV 4AI8A 3K5MA 3N27A 3CC4V 5IYBO 2W6JG 1NTZH 4J42A 1EZJA 5IYZB 1ENVA 2QWOB 4CC6A 3TCUA 1BGYH 3AG2C 4U3JA 3A8TA 3CCSV 2DYRB 3QF7A 4LFAO 1WB8A 1XMQO 3L73H 3D3IA 3ZHRA 2PI5A 2YIAA 3E86A 5DM6V 4JV5B 3ZBHA 2QSAA 4DR3O 1BL8A 2JGDB 5L3CA 5BXZA 4RQFA 2IH3C 3T1YO 2QM7A 1NVPD 1SRYA 1AILA 4ZBMA 4KHPO 2JEXA 1VF5B 3AG3C 1YJ9V 3PJSK 3U0ZA 1QLEC 2M6YA 3O9OA 3ZRSA 3ZS8C 1EZVH 1YF2A 1XEQA 1W0KG 1H2MA 4FZ1A 1EM1A 3ZRWA 5GONB 3R65A 4O2BB 4K0KO 4WFEA 5LGNA 2OWOA 4UXNA 3CCRV 2JJ2G 3GVMA 3E89A 3UO2A 3E8GA 5JJEB 3D8CA 3CYOA 3FB5C 1K5SA 4ZKIA 3CHXA 5DN6G 2DYSC 4DV2B 4JAAA 3CCLV 2P4KA 2JIZG 5BY1A 2EBOA 4JTDB 4DR5B 5LHHA 3SJAC 3T1HB 2GUZA 1SKVA 1E1QG 3RWRD 1IDSA 2Q7GA 4GZRB 2VQEO 1KC8W 2WSSG 1UJWB 2JS3A 1AROP 3K5LA 1VQOV 1EFRG 2OIGA 3QO7A 1KUQA 1AR1B 2IW5A 4Z1MG 1Q8IA 3T4ZA 1IBKB 3AG1B 1M5IA 1HDJA 4JI7B 4UCSA 4PD4F 4I9WA 3CS5A 4BW9A 3ML0A 5IYZA 4JI6O 4LF4O 5H6QA 4EKWA 4X64O 3B2EE 3CMAV 1AVMA 1Y66A 1WPBA 3JD2A 1HW7A 3JSLA 4OPAA 3WB0A 2JGDA 4JI2B 3MHSC 4I50A 4I0XB 1LUWA 3QTCA 5JJJB 4BAYA 1OCCC 2EIJB 5LA6B 2XUMA 1GTOA 5CA1A 5LMNB 4FLYA 2PZSA 3TXSA 5IJ9B 1QBZA 4D7TA 5L3DA 2UUAO 3FB8C 5GONA 1RM1B 4O2BA 1YEWA 2HJFC 2ILMA 4X62B 2F95B 2BOCC 3ABKC 3ETQA 5JCOA 4CH4A 5FLXN 1WAZA 3CJHB 4HBNA 1VMGA 2PYLA 1EN4A 4X20B 2QA4V 4X1YB 3OR7C 5CN0A 1P84F 4PHZA 4QGPA 4FLVA 3K08A 3B40A 1HNZO 1PV0A 1VQNV 1QR8A 4B3TO 5KAFZ 3TGUH 3G71V 4JYAB 3K9SA 1MOFA 4PA3A 2OIEA 4LF6O 1JMKC 3AG2B 3P32A 1B6QA 1SESA 5CBGA 1M56C 4JASA 3SYCA 2UUCB 4AQYO 4DV4B 3LNNA 2ZE7A 1E1RG 3B8NA 3W7TA 3STZC 1AJPA 4XBFA 4LFBO 5E1AC 4I4TB 5H2FZ 1WNSA 1E79G 5L3GA 4NXMB 1PM9A 1WN7A 2DN9A 1QLEB 5A2QN 2PF4E 4GX5A 1NH2B 4GX2A 2ZD9A 1M57C 2IBZH 4B3RB 3IGAC 4DR2B 2XAHA 1J5EB 1GK9A 4LC1A 4MVUA 1TAEA 1PNMA 2ZCEA 4JAUA 2YXYA 3BPZA 2QEXV 3RVZA 4LF7B 4MVOA 2P6JA 2QKSA 1L1FA 2ZE8A 4OX9B 4I0XA 3J81N 2WPDG 4IIJB 1U97A 1AJNA 3ZMVA 1XL4A 4J7ZA 2Q7HA 3ABUA 2AZ0A 5JJNB 4NKGB 4BW5A 1FXKB 1YITV 1SQVH 5IJ9A 1MNGA
chains in the Genus database with same CATH topology
1K8AW 1OCOC 3T4DA 3UKMA 3RW0A 1OZ0A 4QNHB 2WLIB 1NH2D 2DQ3A 4DXWA 1FXVA 3AG4C 1VQ5V 1JOYA 2EILC 1NR1A 2JEUA 1JX9A 3M99B 1F23A 3OGCC 3FYIB 4PDMA 3X2QC 3G4SV 1OCRB 2FTKA 5L3BA 3D36A 5IYDO 3QO5A 4RUFA 1YTFD 3FB7C 2Z3YA 1V54B 2V1DA 1YJNV 3W7WA 4UV9A 2OTLV 1R73A 5GW7A 1QCEA 1F4MA 1GM7A 4MW3A 1W2BU 1KKDA 4R7CA 1DF4A 4MVZA 4WFFA 1PNKA 1NQTA 2HLDG 4G2KA 1NBMG 4UVCA 1GM9A 2KB1A 2WLNA 3OMNB 5B1AC 5EC1C 1DTOA 4KP4A 1G4YB 4U7NA 4JPRA 1H8EG 2DWDC 2IU0A 3SYPA 2Y69B 3T2MA 3E2EA 4LCUC 2HG5C 4UUJC 1AI7A 1QR9A 2EJRA 2Q67A 1N8RW 1DLBA 2QM8A 4MVSA 3SYQA 3ZRWB 2IJKA 4F4LA 2YSUB 2OCCB 4WFBV 1PL0A 4JF3A 1JVMA 4PDRA 2JDIG 4QPKA 3ABMB 4Q20A 4RO2A 1COWG 3NXSA 3ZN1A 2GHYA 1KD1W 1JCHA 2K1EA 3BEHA 1OCCB 3SPJA 1K34A 2F43G 1YSCA 2H94A 1R6KA 2ITDC 1FXKC 2ZDIC 1P4RA 2A79B 2X0LA 2Q69A 1YIJV 4XDLA 3CCJV 2C2AA 2WLJA 1KP3A 2EIJC 5EC2C 3LSSA 4QIWF 2HVJC 4MS2A 4GCZA 3ETGA 4MVQA 1VQPV 3AG3B 4MTGA 4RUEA 4FIPC 1K4DC 2EINB 1KECA 1NR7A 1QQHA 5LBQA 3OMAB 2X6BA 4KUMA 4GT1A 3F7YC 4WF9V 5CMUA 1KP2A 2WLMA 1RM1C 1M1KW 2A9HA 3CMEV 3ASOC 2OTJV 5L3EA 1OCRC 4P30A 4LBEC 2DW4A 5IYCO 5L3FA 1KQSU 2P90A 5LGTA 3EHBB 4RQEA 1NJIW 5C93A 1YTFB 3OMIB 4FMTA 4PA7A 1NVPB 4WFHA 3TETA 1BHBA 1K4CC 5CBHA 4UV8A 5HFMA 2B1IA 1FXKA 2ZDIA 3SPGA 3ZCCA 1S3JA 2DYSB 5B1BC 3ZRVA 4MSWC 1W0JG 2ZXWC 2OT5A 5CBFA 3SYAA 4PA6A 1VQKV 4PDLA 2ITCC 3K0GA 3ASNC 3CXCU 3CC4V 5IYBO 1M56B 2W6JG 4MTOA 1AJQA 1CP9A 3QNEA 2Y69C 1EZJA 1SZTA 3FYEB 5FL7G 1GM8A 1ENVA 4WFAV 1TUEB 3SPIA 3TCUA 2A0LA 3AG2C 3CCSV 2DYRB 2ATKC 5KA5A 2OCCC 3D3IA 2JJ1G 1CEZA 3LDDA 2PI5A 3E86A 4LP8A 4UVBA 1R3KC 2P7TC 1V55B 3LNMB 1PNLA 3CCVV 5EBLC 5DM6V 4GX1A 1S77D 1HWYA 1BL8A 5L3CA 1ROPA 1K97A 4RQFA 1JJ2U 2UXXA 2IH3C 1VQ8V 1BHAA 3AEIA 2QM7A 3A0RA 2MK3A 4MTXA 5BZBA 1NVPD 1RPRA 1SRYA 3ABLB 4R8CA 4MTFA 2HVKC 4DO2A 3LDEA 2NNUA 4ZBMA 2JEXA 1OCZB 3IFXA 4J9YB 3AG3C 5IY5B 1YJ9V 3PJSK 4X89A 2ZQMA 1EBOA 1QLEC 1M57B 2HKOA 2R9RB 3FKSG 1I5YA 3CPWU 2WLKA 1K3EA 3BY6A 3ZRSA 4CBCA 1S76D 4PELA 5EK0A 4XDKA 5EBWC 1QVGU 2EIMC 5B1OA 4YXWG 1W0KG 3ZRWA 1XL6A 3B8MA 1VQLV 3R65A 1THZA 3B77A 4WFEA 1H2GA 5LGNA 3ETDA 1H8HG 3OUSA 3OW2U 2H8PC 3E83A 4J9ZB 4UXNA 1JQ0A 3CCRV 1VQMV 5J9PC 2IU3A 5KUKA 3ZRXA 3SPHA 1GKFA 2JJ2G 1M9NA 3E89A 3JD4A 1AI5A 3E8HA 3E8GA 4JYBA 1PD3A 3CYOA 3FB5C 1R3IC 1K5SA 4ZKIA 2ZR3A 1RPOA 2EIKB 5DN6G 2DYSC 2DWEC 5LHIA 4X88A 3CCLV 3SJQC 2JIZG 2EBOA 3ZMUA 1S5HC 4JTDB 4BIZA 4PA4A 5LHHA 2WWWA 3CC2V 1GO3F 3VBBA 1E1QG 4P9PA 4TWKA 4R6ZA 5EBMC 3AG4B 3K79A 1FFTB 4RAIA 2EILB 2W6IG 3RVYA 2X6CA 3CCEV 3F7VC 2WLLB 2UXNA 1KC8W 2WSSG 4MW8A 3X2QB 1UJWB 3OR6C 1AROP 1VQOV 1YI2V 1EFRG 3OEHG 4HZ3A 3ABKB 1V55C 1K7DA 2XAJA 2LFSA 1ZWIC 2IH1C 3QO7A 1WLEA 1WPXA 2WLHA 1K33A 2IW5A 1AR1B 4PA9A 4TT3G 4MVRA 2ZR2A 4Z1MG 3ZN0A 3T4ZA 4OXSA 2YEVB 1V54C 3ABLC 3ZMSA 3AG1B 4U7OA 3SYOA 5B1AB 3TK1A 4UVAA 3WG7B 1OCZC 2AHZA 2WAMA 2QTOA 4QE9A 3CCQV 1IXMA 2B1GA 4I9WA 3W7XA 1VQ6V 4L87A 3ML0A 5H6QA 4N21A 3HPLC 4EKWA 2W0FC 3CMAV 2WLIA 3JCZA 1Y66A 3JD2A 1CPYA 1MABG 3CP1A 1S0VA 2DQ0A 4WFGA 3CCMV 3ZIAG 1JPXA 4X8AA 3W7UA 2IJJA 2CK3G 3W7SA 3MHSC 3SPCA 1BMFG 3ABMC 4P2ZA 3DGEA 1OHHG 1VQ7V 3EFFK 2X6AA 5B1NA 2EIKC 1LNQA 3VOUA 4BAYA 1OCCC 3JD3A 2EIJB 1VQ9V 3I56V 3G6EV 1GTOA 4WCEV 5HFLA 2GSMB 4P9OA 2Q6AA 4MT8A 4E2LA 3K9AA 1F4NA 3ZMTA 1QBZA 2Y48A 1SETA 5L3DA 4H37A 3FB8C 1F51A 4BIUA 3JD0A 1RM1B 2EINC 1FXHA 4G27B 3ASOB 2HJFC 2LFRA 2PI4A 1DF5A 4H33A 3WFVA 3CD6V 2BOCC 3ZMZA 3ABKC 3K3WA 3OFNG 4N23A 3CCUV 1I5XA 4QE7A 1NKDA 4G28B 5B3SB 2EZOA 2D3OW 5KA6A 3E8FA 3JD1A 2BOBC 5B1BB 4JGSA 2QA4V 2ZXWB 3GB7C 3AG1C 3LDCA 2XOKG 3OR7C 3E35A 5CN0A 4XDJA 3STLC 3K08A 3WG7C 1VQNV 1R3LC 5KUMA 1P7BA 3ASNB 3T1CA 1QR8A 3ETEA 3ZJZA 3OUFA 3G71V 5LHGA 1YJWV 2JK5C 4HYOA 1MOFA 1K92A 4PA3A 3UM7A 3JYCA 2HR3A 3AG2B 1OCOB 3H01A 3IC7A 3P32A 1B6QA 2WLLA 1SESA 5CBGA 1Q7YW 1M56C 4JASA 5IDJA 5H9CA 3OM3B 4CZZA 3KG2A 3SYCA 1J95A 1QLNA 2IJHA 4KFMA 4R50A 1H38A 1E1RG 2DYRC 3B8NA 1K5QA 3W7TA 3STZC 1AJPA 4XBFA 5E1AC 1AI4A 3MHHC 2V7QG 1AI6A 2AHYA 3E8BA 4JAVA 2YEVA 1Q86W 4JTAB 2P67A 2XAFA 4JTCB 3FB6C 3OEEG 1GMGA 4QPJA 1E79G 5L3GA 1QVFU 1VQ4V 4HAMA 4GX0A 2QE7G 1QLEB 2NLJC 5LGUA 1K9MW 3P30A 1SERA 4ASUG 2Z5UA 4GX5A 4FK5C 2XASA 2EIMB 2M7WA 4GX2A 2ZD9A 1NH2B 5IY5C 1M57C 4I5SA 2IJIA 3ABTA 1Q81W 1Y4MA 3IGAC 3LSQA 1Q82W 1G8MA 3QO8A 1MSWD 2LP7A 2XAHA 1GK9A 2Q68A 4LC1A 4MVUA 1PKXA 3CC7V 1PNMA 4JAUA 1YHQV 2QEXV 2XAQA 1S72V 3RVZA 3LUTB 4MVOA 3HB3B 3OE7G 2P6JA 2QKSA 2X7RB 1L1FA 3GWOA 3K06A 5H6RA 3K0DA 5B3SC 3K04A 4FPPA 2WPDG 2R9IA 3K03A 3RBZA 1K73W 2B5UA 3F5WC 1FS0G 4QJFB 1AJNA 3ZMVA 1R3JC 1XL4A 3MD0A 2XNDG 4MVMA 4TSFG 4PDVA 2HFEC 1MG1A 3ABUA 1ORQC 3I55V 2EZPA 4BW5A 1FXKB 1YITV 1R6NA 4FJCC 2XAGA 1M90W 4JYCA 5CA3A 3OAAG 3DTUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R6K A;  1DTO A;  1QQH A;  1TUE B;  2JEU A;  2NNU A;  1R6N A;  2JEX A; 
#chains in the Genus database with same CATH topology
 1OCO C;  1ZL8 B;  4J7K A;  1Q3E A;  4JI4 B;  4CS4 A;  2WLI B;  1XNQ O;  3AG4 C;  2NN4 A;  1VQ5 V;  1URF A;  4DV1 B;  2EIL C;  3NR7 A;  4FLT A;  1TGO A;  5FPR A;  1AR5 A;  3UCS C;  3CJH A;  4ICG A;  3K5O A;  4J80 A;  1W59 A;  1HNW B;  4IHJ B;  2VRZ A;  4X20 A;  2O57 A;  1ZX3 A;  3KZI Z;  1YJN V;  4YIO A;  3OT7 A;  5H5N A;  4UV9 A;  1N33 O;  2D2C B;  5JQG B;  4LFA B;  1GRJ A;  1W2B U;  2HHH O;  1KKD A;  4DV3 O;  1DF4 A;  4FFK A;  4MVZ A;  2Y4U A;  1PNK A;  1NQT A;  2HLD G;  3TXQ A;  4DV0 O;  5B1A C;  5EC1 C;  1IBL B;  1DTO A;  4KP4 A;  5EIB D;  4FVM A;  3JAW A;  2IU0 A;  3SYP A;  3AK2 A;  2Q0O C;  1Q6I A;  3E2E A;  1M93 A;  4F4L A;  3SYQ A;  3ICX A;  4K8X A;  3ZX6 A;  4X9Q A;  1JVM A;  3G6B A;  4QPK A;  2H3O A;  4Q20 A;  4I4T A;  3ZED A;  1G6U A;  3RGB A;  4FM0 A;  3S3W A;  1JCH A;  4O2A A;  3HKE B;  1IX9 A;  1OCC B;  3K5N A;  3G80 A;  3DC6 A;  1Q6U A;  1BSM A;  1Z5V A;  2P06 A;  2KKW A;  2X0L A;  2ARH A;  4XDL A;  2C2A A;  4FZ0 A;  2VQF O;  1N34 O;  2HVJ C;  5GTH Z;  4GCZ A;  4MTG A;  4LF9 O;  3KKY A;  4FIP C;  1K4D C;  1NR7 A;  1QQH A;  4TUY A;  3CRC A;  4GT1 A;  4FFB B;  1M1K W;  3CME V;  2OTJ V;  3H1I H;  4P30 A;  4LBE C;  3S3X A;  2DW4 A;  4X66 O;  4IIJ A;  3OMI B;  2GV9 A;  3TET A;  5HFM A;  1FXK A;  2ZDI A;  1TVK A;  3ZCC A;  1S3J A;  3ZRV A;  1U96 A;  2YIC A;  3SR2 C;  1XMO B;  1Z2G A;  2ITC C;  4JI0 O;  3K0G A;  1RSO B;  1ZL8 A;  3WU2 Z;  2F23 A;  1MZE A;  5BR8 B;  1M56 B;  4LNU B;  5F2V O;  4IYI A;  3QNE A;  1GM8 A;  1TUE B;  4LR3 A;  1JR9 A;  2OCC C;  3QG5 A;  5BMV B;  5GTI Z;  4DV7 B;  2P7T C;  1V55 B;  4IHJ A;  3UQ8 A;  1PNL A;  3IJ4 A;  1HWY A;  4CC5 A;  1ROP A;  2ZM6 B;  2UU9 B;  2CGN A;  4YY3 O;  3AEI A;  2ZNJ A;  4TV8 B;  4GYC B;  4MTF A;  2HVK C;  4DO2 A;  3LDE A;  2NNU A;  4LH6 A;  4X89 A;  2B9Z A;  1M57 B;  3CPW U;  1I5Y A;  3BAA A;  2R72 A;  2WLK A;  3BY6 A;  3JAR B;  3GWK C;  4ZOL B;  4PJ0 Z;  5EBW C;  1QVG U;  1WB7 A;  2F93 B;  1VQL V;  1THZ A;  3B77 A;  1EN6 A;  2N05 A;  2E75 B;  1H8H G;  3OW2 U;  2H8P C;  1JQ0 A;  4DYL A;  5J9P C;  1VQM V;  3SPH A;  2V4D A;  3E8H A;  2ZIN A;  1PD3 A;  4JI8 B;  1R3I C;  3L71 H;  2P22 C;  2QGN A;  2ZR3 A;  3BHP A;  2F4V O;  2AZ2 A;  2QTS A;  2ZT9 B;  2UXD B;  4BIZ A;  1GO3 F;  5LXT B;  5EBM C;  3AG4 B;  1FFT B;  2P4V A;  2EIL B;  1NZ6 A;  4FFB A;  5DEC A;  4JI3 B;  2X6C A;  3CCE V;  4PI2 A;  2WLL B;  4B3T B;  4MW8 A;  1ZTE A;  1YI2 V;  3OEH G;  4HZ3 A;  2ZE5 A;  2XAJ A;  2LFS A;  2BSK B;  2IH1 C;  1WLE A;  4TT3 G;  3FX7 A;  4MVR A;  2QJ1 A;  3ZN0 A;  2RCV A;  4KXR A;  4OXS A;  3ABL C;  2K9P A;  4LFB B;  5B1A B;  3KCX A;  4UVA A;  3K58 A;  1OCZ C;  1RSO A;  4LNU A;  3CCQ V;  4DV5 B;  4L87 A;  4N21 A;  4FLU A;  1XNR B;  2Q73 A;  2W0F C;  4HNA B;  5BMV A;  2OCH A;  1MAB G;  1KMI Z;  1H2L A;  1JPX A;  1SF9 A;  1SS3 A;  3W7U A;  2IJJ A;  4O4I B;  4X65 B;  3SPC A;  4P2Z A;  5IWA O;  2Q8V A;  1VQ7 V;  2BE3 A;  5B1N A;  1P7G A;  2EIK C;  3VQY A;  3VOU A;  1IBM B;  3DXR B;  3JAR A;  2Q6A A;  4ZOL A;  1FJG B;  4MT8 A;  1F4N A;  1SQF A;  1B06 A;  2EUL A;  2Y48 A;  1IUR A;  1BQ0 A;  3RT3 C;  1F51 A;  4BIU A;  1N36 O;  3IC9 A;  4DK0 A;  5KAI Z;  2LFR A;  2HEP A;  1DF5 A;  4CS3 A;  5KMG B;  4N23 A;  2PTM A;  1NKD A;  4UCR A;  4YJ2 B;  2EZO A;  2D3O W;  2QWP B;  3GB7 C;  1LUV A;  3E35 A;  4IYH A;  2LQT A;  3WG7 C;  3OTO O;  1R3L C;  1D5N A;  3T1C A;  4DR1 B;  1XRE A;  5LXT A;  1M4U A;  5LHG A;  2JK5 C;  1I94 B;  3H01 A;  3IC7 A;  2WLL A;  1TA8 A;  1Q7Y W;  5IDJ A;  4DR6 O;  1GN3 A;  4GKJ O;  1PP9 H;  1TUB A;  1HR0 O;  1H38 A;  2VWJ A;  2RNB A;  4NXN B;  2BSK A;  1AI4 A;  2CAZ C;  3H1H H;  3E8B A;  4DRX B;  3D3Q A;  2Q0A A;  2XAF A;  1L0N H;  4DR4 O;  3AG7 A;  1SQX H;  3OEE G;  1HP8 A;  3N2K B;  4GX0 A;  5TIS Z;  3JAS A;  3OTF A;  2FYU H;  1SQP H;  2E76 B;  1K9M W;  3P30 A;  4J41 A;  1SER A;  2DMX A;  1HNX O;  2OYQ A;  4FK5 C;  2XAS A;  4I9Q A;  5LMU O;  1XIL A;  3JCU Z;  2GTS A;  4HNA A;  2IJI A;  1Q81 W;  1I0H A;  1PKX A;  3L75 H;  3CC7 V;  1N34 B;  4YHH O;  4FM2 A;  4B3M B;  4LF8 B;  3TJT A;  3A0B Z;  2XAQ A;  2A3Q A;  3Q4H B;  4O4I A;  5ITZ B;  2ADP A;  2LGW A;  5B3S C;  4FPP A;  1K73 W;  2R9I A;  2B5U A;  2PGG A;  1FS0 G;  4GKK B;  1R3J C;  2EX3 A;  3MD0 A;  3O65 A;  5D5P A;  4TSF G;  4C7U A;  3I55 V;  2EZP A;  5D5Q A;  1FYJ A;  2CUG A;  5EYP B;  3U10 A;  1YVW A;  4FJC C;  4WBN B;  2W0X A;  1MA1 A;  4JYC A;  3KCY A;  2QKA A;  3JAT B;  3OAA G;  1BZK A;  3DTU B;  1VP7 A;  4O4L B;  5EZY B;  1BT8 A;  1NR1 A;  4JI1 O;  2CDY A;  1JX9 A;  2E5L B;  1FD9 A;  1F23 A;  4YJ2 A;  3X2Q C;  3G4S V;  3U11 A;  2QDO A;  4F6R B;  2UXC O;  5L3B A;  4EEQ A;  3FB7 C;  2OTL V;  2CTQ A;  3E22 B;  3F5T A;  3THO A;  4UVC A;  2WLN A;  2E74 B;  2ZIO A;  1YXB A;  3B4S A;  4JPR A;  1GAX A;  4UUJ C;  3FD9 A;  1JA8 A;  2EJR A;  2Q67 A;  4DUZ O;  2QM8 A;  2IJK A;  4PDR A;  2BCC H;  4DR7 B;  2FL4 A;  4DRX A;  3ZN1 A;  1KD1 W;  4Z2W A;  2F43 G;  3SGI A;  1YSC A;  1XDC A;  3N2K A;  1R6K A;  1SA0 B;  2GDS A;  5K1P A;  3BCC H;  2A79 B;  5C8Y B;  1DGS A;  1UPG A;  3CCJ V;  1KP3 A;  5EC2 C;  2NR5 A;  4QIW F;  4DUY O;  3AG3 B;  4LF5 B;  4RUE A;  4D6T H;  5KHH A;  1Q6H A;  1GN6 A;  1KEC A;  1XBL A;  2X6B A;  4JI5 O;  4WF9 V;  5J2T B;  2WLM A;  3Q4H A;  2A9H A;  3ZHU A;  3CEI A;  5L3E A;  1OCR C;  5A9G A;  1ZAU A;  3HKB B;  2N74 A;  1KQS U;  3H1L H;  3BRC A;  4RQE A;  5C93 A;  1YTF B;  4Q6G A;  1NVP B;  4WFH A;  1JFF B;  2DJV A;  2Y0P A;  3D36 C;  2LW1 A;  5EYP A;  2KSD A;  4LFC B;  2DYS B;  4WBN A;  2ZXW C;  5LA6 A;  3WB1 A;  4O4L A;  3CXC U;  4NTW A;  5KX5 B;  4MTO A;  2UUB B;  1AJQ A;  1CP9 A;  2Y69 C;  2YS8 A;  5LYJ B;  2QR4 A;  1O9G A;  1KU9 A;  2ATK C;  2LGQ A;  1NTK H;  5KA5 A;  3EVK A;  4F6R A;  1XHZ A;  1N32 B;  4UVB A;  2QKC A;  1Q43 A;  4GX1 A;  4B7K A;  2YI9 A;  4FLZ A;  1AP6 A;  1JJ2 U;  2UXX A;  3EXA A;  1BHA A;  3E22 A;  3A0R A;  3UT5 B;  4MTX A;  3CRA A;  5BZB A;  4KL1 A;  1I08 A;  4X1Y A;  1NS1 A;  1Y74 B;  1XMQ B;  4O4H B;  1XHX A;  2ZQM A;  1EBO A;  3FKS G;  4L8J A;  1K3E A;  4CBC A;  4DR3 B;  4PEL A;  1A32 A;  5EK0 A;  4XDK A;  4YIP A;  5B1O A;  3M8A A;  4JZG A;  1WJZ A;  3T1Y B;  5KHI A;  1XL6 A;  4DV2 O;  2QWR B;  3HKC B;  4U3F H;  2AW9 A;  4UCU A;  2CTW A;  4KHP B;  2RN9 A;  4DR5 O;  3T1H O;  5KUK A;  3ZRX A;  1V9P A;  1N36 B;  1M9N A;  1AI5 A;  2VS0 A;  4BWA A;  1SA0 A;  2FKX A;  3VQX A;  1RPO A;  2DWE C;  5C8Y A;  4X88 A;  5LHI A;  4K0K B;  3SJQ C;  3SDL A;  2G38 A;  4FM1 A;  4PA4 A;  2WWW A;  3RYH B;  3VBB A;  2UXB O;  4P9P A;  5EIB C;  3K79 A;  4RAI A;  2W6I G;  1IBK O;  3F7V C;  2YC0 A;  3X2Q B;  3CX5 F;  1PL4 A;  3HKB A;  4JI7 O;  2PY5 A;  3ABK B;  1K7D A;  2Y0I A;  1K33 A;  4DR6 B;  2N04 A;  4PA9 A;  1JFF A;  5J2U B;  2ZR2 A;  3BAB A;  1MZF A;  1V54 C;  3ZMS A;  1Z5W A;  2RQ6 A;  2VQE B;  2JS5 A;  2DOS A;  3TK1 A;  5FNV B;  2QTO A;  1CXZ B;  2RJZ A;  4QE9 A;  3A2F A;  5KX5 A;  1IXM A;  3W7X A;  1VQ6 V;  5LYJ A;  3HPL C;  2JRI A;  2P5O A;  2WLI A;  5JVD B;  3CB2 A;  2HP8 A;  5LMN O;  1WP7 A;  3B09 A;  1BCC H;  3RYF B;  1BMF G;  4X1I B;  4JI6 B;  3DGE A;  4LF4 B;  3UO3 A;  3I5D A;  2BTQ B;  1QHT A;  2CTR A;  2X6A A;  3UT5 A;  4X64 B;  1Y74 A;  5JQG A;  4D7S A;  4X62 O;  4IT5 A;  2ZIM A;  4O4H A;  1VQ9 V;  3I56 V;  3IAY A;  4NYK A;  3CRM A;  4P9O A;  4H44 B;  4PI0 A;  1IVS A;  4E2L A;  3K9A A;  3P3P A;  1KYO F;  1SET A;  4H37 A;  2KG7 B;  3L9D A;  2QM4 A;  4W4K A;  4U3J B;  2EIN C;  1FXH A;  1YCI A;  4H33 A;  3WFV A;  3CD6 V;  2YID A;  5AG2 A;  3CCU V;  5E79 Z;  3M7M X;  4JYA O;  1NU1 H;  3E8F A;  3JD1 A;  4JI1 B;  2UUA B;  4UCT A;  3HKE A;  2ZXW B;  3AG1 C;  2UXC B;  2CH7 B;  1P7B A;  4FLX A;  4CH6 A;  3N2G B;  3RYH A;  1YJW V;  1K92 A;  3UM7 A;  3JYC A;  2HR3 A;  1OCO B;  1WA8 B;  5H9C A;  4DW1 A;  1SQQ H;  3KG2 A;  1J95 A;  1X59 A;  2IJH A;  4NXM O;  1HNZ B;  4K35 A;  1K5Q A;  1XUQ A;  5J2U A;  1AI6 A;  2AHY A;  4LF6 B;  1Q86 W;  4JTA B;  4B3R O;  4DR2 O;  1J5E O;  1GMG A;  2PUS A;  3AK1 A;  3JAL B;  4QPJ A;  1AB3 A;  4E4E A;  4AQY B;  1VQ4 V;  4TV9 B;  5DED A;  5LGU A;  3K57 A;  4OX9 O;  2Z5U A;  2M7W A;  5IY5 C;  4I5S A;  1MSD A;  2E3C A;  3ABT A;  1Y4M A;  1FKA O;  5JVD A;  4LWS B;  1MSW D;  2LP7 A;  2Q68 A;  2ODM A;  2AGA A;  4K3A A;  3H1K H;  3HB3 B;  3OE7 G;  1NTM H;  2X7R B;  3GWO A;  3RYF A;  3APO A;  4F6E A;  3K0D A;  3K04 A;  3RBZ A;  3K03 A;  3CRR A;  2BTQ A;  4QJF B;  4JI4 O;  4MVM A;  4TV8 A;  4GLX A;  1R6N A;  1EN5 A;  2XAG A;  2Q7E A;  5CA3 A;  5CA0 B;  1HNW O;  2KG7 A;  2JVD A;  1K8A W;  3BVO A;  2YIB A;  1KBH A;  3T4D A;  1VF6 C;  1OZ0 A;  4NTY A;  5B66 Z;  1NH2 D;  2DQ3 A;  5LP6 C;  1FXV A;  2LJ2 A;  1JOY A;  4J7J A;  1N0J A;  3C3T A;  3OGC C;  3FYI B;  4EB6 B;  1IBL O;  3JAK B;  2EJ7 A;  4I50 B;  3D36 A;  3QO5 A;  4RUF A;  3JAM N;  2F66 C;  1ZUQ A;  3G67 A;  1YTF D;  1WP8 A;  2Z3Y A;  1V54 B;  2V1D A;  5B5E Z;  3W7W A;  2L35 A;  1XNQ B;  5GW7 A;  1F4M A;  1GM7 A;  2CH7 A;  4MW3 A;  3SJB C;  5CA1 B;  4R7C A;  1R1B A;  3N2G A;  4NVP A;  4WFF A;  1GM9 A;  2KB1 A;  1Y6X A;  3OMN B;  2YUA A;  1WA8 A;  4JZ2 A;  3LSU A;  3T2M A;  2A7W A;  1N33 B;  4LCU C;  1AI7 A;  1N8R W;  1DLB A;  1BQZ A;  2HHH B;  2YSU B;  2OCC B;  4DV3 B;  4JF3 A;  4DV0 B;  5KHJ A;  2L6L A;  1COW G;  5IE9 A;  4CH3 A;  2MW2 B;  2K1E A;  1Y76 B;  3JAL A;  3SPJ A;  3APQ A;  1OJH A;  2Y4T A;  3ZHS A;  4ZIB A;  1BS3 A;  1X4T A;  2PYJ A;  2ITD C;  2Q9L A;  4TV9 A;  2GBO A;  1FXK C;  2ZDI C;  1P4R A;  1G1X B;  4H13 B;  4IGG A;  4CH5 A;  4MS2 A;  3VQV A;  4MVQ A;  3ZHQ A;  1VQP V;  3OGI B;  1VEW A;  2EIN B;  4LWS A;  4KUM A;  4FLW A;  2YXL A;  4K8Z A;  1XMO O;  1R6T A;  3ASO C;  2UXB B;  4I7Z B;  2VQF B;  5L3F A;  5BR8 O;  4LF9 B;  5LGT A;  3EHB B;  1NJI W;  4FMT A;  4PA7 A;  4DK1 A;  1K4C C;  4ZHQ B;  2XHB A;  5B1B C;  2OT5 A;  5CA0 A;  5LL6 Y;  1QQC A;  4DV7 O;  4PA6 A;  3DXR A;  4PDL A;  4X66 B;  3ASN C;  3FFQ A;  2ZM6 O;  3BA9 A;  2UU9 O;  1SZT A;  3A0H Z;  3FYE B;  5FL7 G;  4WFA V;  1DK1 A;  3SPI A;  2A0L A;  1VF7 A;  4EB6 A;  1CEZ A;  2JJ1 G;  3JAK A;  3LDD A;  5IT9 N;  2IM9 A;  4LP8 A;  1QU7 A;  1R3K C;  2GTA A;  4BIO A;  5KMG A;  4JI0 B;  3LNM B;  3CCV V;  1NI8 A;  5EBL C;  1S77 D;  1IZ3 A;  1K97 A;  3CXH F;  4BR6 A;  1YDX A;  1VQ8 V;  2MK3 A;  3C90 A;  1RPR A;  3ABL B;  4R8C A;  4NR1 A;  1OCZ B;  3IFX A;  4RWU A;  4J9Y B;  5IY5 B;  2ZKO A;  2R9R B;  2HKO A;  5JH7 B;  1S76 D;  4JI8 O;  4TQF A;  2EIM C;  4A5U B;  5KHG A;  4YXW G;  3MAQ A;  4YY3 B;  3B8M A;  4OPH A;  5IJ0 B;  1H2G A;  3RYC B;  1LR1 A;  3ETD A;  3OUS A;  2UXD O;  1US6 A;  2WA3 A;  3E83 A;  4J9Z B;  2IU3 A;  2VWK A;  3SJC C;  1GKF A;  1H2K A;  3JD4 A;  1Y76 A;  4JYB A;  4JI3 O;  1VAR A;  1KB9 F;  2EIK B;  3L70 H;  5LOV B;  1B3Q A;  2AXT Z;  1AR4 A;  3J7A U;  3ZMU A;  1S5H C;  5FPO A;  2Q4P A;  3JAW B;  5KHK A;  4B3S O;  3CC2 V;  3HKD B;  1SQB H;  1F7Y A;  2FB5 A;  4TWK A;  4R6Z A;  5LP6 B;  1T5E A;  2YIB D;  4DV6 O;  3RVY A;  2UXN A;  3OR6 C;  1FPO A;  2F4V B;  1D5A A;  4Z1V A;  1V55 C;  4UCV A;  1ZWI C;  1WPX A;  4DV5 O;  2WLH A;  1H2S B;  4O2A B;  5ITZ A;  4ZI7 B;  1XNR O;  1QNM A;  4ZHQ A;  2YEV B;  1L0L H;  3BFR A;  4U7O A;  3SYO A;  3RFR A;  1XOU A;  3WG7 B;  1RP3 B;  1H2N A;  2AHZ A;  2WAM A;  3FAV B;  1GN2 A;  2R70 A;  2B1G A;  4X65 O;  4TUY B;  3JAT A;  4X1K B;  4IL6 Z;  4EFB A;  5CB4 B;  4JV5 O;  5EZY A;  1IBM O;  4J11 A;  3JCZ A;  4W4L A;  4J10 A;  1CPY A;  3CP1 A;  1S0V A;  2DQ0 A;  4WFG A;  3CCM V;  3ZIA G;  4NB5 A;  4X8A A;  1FJG O;  2CK3 G;  3W7S A;  1YZB A;  1VIB A;  3ABM C;  2RMK B;  1OHH G;  3ZHV A;  3EFF K;  1TVK B;  3RYI B;  1LNQ A;  1RFY A;  3VQW A;  3JD3 A;  3G6E V;  4DW0 A;  4WCE V;  5HFL A;  1Q90 D;  2GSM B;  5JH7 A;  3ZMT A;  3H9V A;  2F1M A;  1Y67 A;  1UFI A;  5IWA B;  3MDS A;  3JD0 A;  3CWB H;  3H1J H;  4G27 B;  5IJ0 A;  2DE0 X;  3ASO B;  3RYC A;  1D2D A;  2PI4 A;  1ZSP A;  4B08 A;  3ZMZ A;  4DR1 O;  3K3W A;  3OFN G;  1I5X A;  4QE7 A;  4G28 B;  2ZE6 A;  5B3S B;  5KA6 A;  1IXB A;  1I94 O;  4TOI A;  2BOB C;  3BA8 A;  5B1B B;  4JGS A;  5LOV A;  3LDC A;  4UB6 Z;  2LO1 A;  2XOK G;  4XDJ A;  3STL C;  1ZLZ A;  5KUM A;  4B7E A;  3ASN B;  4OGQ B;  4NXN O;  1Q5O A;  3HKD A;  1VF6 A;  3ETE A;  3ZJZ A;  3OUF A;  5LP6 A;  4EFE A;  4HYO A;  4UFZ A;  2YDE A;  3OM3 B;  4CZZ A;  1QLN A;  4KFM A;  4R50 A;  3ZHT A;  5J2T A;  3OTO B;  3OD4 A;  2DYR C;  2QWN B;  4H0L B;  1FFX B;  3MHH C;  4ZI7 A;  2V7Q G;  2HJD A;  4JAV A;  2ETN A;  2YEV A;  2P67 A;  3C3S A;  4JTC B;  2CE4 A;  3FB6 C;  1NT2 B;  4GKJ B;  1HR0 B;  4UB8 Z;  1QVF U;  4B3M O;  4LF8 O;  4HAM A;  3FAV A;  5JWP A;  2QE7 G;  3HR0 A;  4AIL C;  2NLJ C;  4JYY A;  4NTX A;  4X1K A;  4YJ3 B;  4ASU G;  2QWQ B;  2EIM B;  3RN4 A;  5CB4 A;  5K1X A;  4GKK O;  2LW7 A;  3LSQ A;  1Q82 W;  4JI2 O;  1G8M A;  3QO8 A;  4DR4 B;  1JJO A;  1N0N A;  2YI8 A;  1YHQ V;  1S72 V;  3LUT B;  1O9H A;  3DSQ A;  3K06 A;  5H6R A;  1HNX B;  1KKC A;  3AK3 A;  4TQD A;  5LMU B;  3F5W C;  5JCO C;  3DC5 A;  3RYI A;  3L74 H;  1XI1 A;  4I55 B;  2Q5Z A;  2XND G;  4PDV A;  2HFE C;  2R9A A;  1MG1 A;  3PN1 A;  4O4J B;  1ORQ C;  4LH7 A;  2E5L O;  1I7F A;  4YHH B;  3J80 N;  3CE2 A;  3CSX A;  1M90 W;  2A06 H;  3K59 A;  3UKM A;  4CS2 A;  3RW0 A;  1S5L Z;  4QNH B;  4DXW A;  3CRQ A;  1MMM A;  2JEU A;  3HKC A;  3M99 B;  3JSN A;  2WA4 A;  4PDM A;  1OCR B;  2FTK A;  1BE3 H;  5IYD O;  2FML A;  1R73 A;  1QCE A;  1GN4 A;  2UUC O;  4G2K A;  1NBM G;  4DV4 O;  2JGU A;  1L8D A;  4DR7 O;  1FAF A;  4GUN A;  5KLV H;  1G4Y B;  4U7N A;  1H8E G;  2DWD C;  2KQX A;  2YXH A;  2Y69 B;  4AHC A;  2BTO A;  1B04 A;  2HG5 C;  1S5J A;  1QR9 A;  2Z0A A;  4MVS A;  3ZRW B;  1FFX A;  4WFB V;  1PL0 A;  2JDI G;  3ABM B;  3L72 H;  4RO2 A;  4LF5 O;  3NXS A;  1OV9 A;  2XT9 A;  2GHY A;  3BEH A;  1K34 A;  1SC5 B;  2H94 A;  2XTA A;  4DUZ B;  2CTP A;  4ABM A;  2Q69 A;  1YIJ V;  1GH6 A;  4YJ3 A;  2WLJ A;  2EIJ C;  5FNV A;  3LSS A;  1AP5 A;  1N4C A;  2ZNI A;  3ETG A;  4LF7 O;  1P49 A;  3R66 A;  2GUZ B;  3QVN A;  5LBQ A;  1TUB B;  3OMA B;  3F7Y C;  1SZX A;  5CMU A;  1KP2 A;  1SQG A;  1XQ8 A;  4LFC O;  1RM1 C;  4PV1 B;  2ADQ B;  4B3S B;  3WB2 A;  2CGO A;  5IYC O;  4DV6 B;  4DUY B;  2P90 A;  2UUB O;  4I55 A;  4UCO A;  4X1I A;  4O4J A;  1PPJ H;  1BHB A;  4JI5 B;  5CBH A;  4UV8 A;  2RDC A;  2B1I A;  3SPG A;  3P3N A;  3JAS B;  4MSW C;  1W0J G;  4DV1 O;  5CBF A;  3SYA A;  1N32 O;  1VQK V;  4AI8 A;  3K5M A;  3N27 A;  3CC4 V;  5IYB O;  2W6J G;  1NTZ H;  4J42 A;  1EZJ A;  5IYZ B;  1ENV A;  2QWO B;  4CC6 A;  3TCU A;  1BGY H;  3AG2 C;  4U3J A;  3A8T A;  3CCS V;  2DYR B;  3QF7 A;  4LFA O;  1WB8 A;  1XMQ O;  3L73 H;  3D3I A;  3ZHR A;  2PI5 A;  2YIA A;  3E86 A;  5DM6 V;  4JV5 B;  3ZBH A;  2QSA A;  4DR3 O;  1BL8 A;  2JGD B;  5L3C A;  5BXZ A;  4RQF A;  2IH3 C;  3T1Y O;  2QM7 A;  1NVP D;  1SRY A;  1AIL A;  4ZBM A;  4KHP O;  2JEX A;  1VF5 B;  3AG3 C;  1YJ9 V;  3PJS K;  3U0Z A;  1QLE C;  2M6Y A;  3O9O A;  3ZRS A;  3ZS8 C;  1EZV H;  1YF2 A;  1XEQ A;  1W0K G;  1H2M A;  4FZ1 A;  1EM1 A;  3ZRW A;  5GON B;  3R65 A;  4O2B B;  4K0K O;  4WFE A;  5LGN A;  2OWO A;  4UXN A;  3CCR V;  2JJ2 G;  3GVM A;  3E89 A;  3UO2 A;  3E8G A;  5JJE B;  3D8C A;  3CYO A;  3FB5 C;  1K5S A;  4ZKI A;  3CHX A;  5DN6 G;  2DYS C;  4DV2 B;  4JAA A;  3CCL V;  2P4K A;  2JIZ G;  5BY1 A;  2EBO A;  4JTD B;  4DR5 B;  5LHH A;  3SJA C;  3T1H B;  2GUZ A;  1SKV A;  1E1Q G;  3RWR D;  1IDS A;  2Q7G A;  4GZR B;  2VQE O;  1KC8 W;  2WSS G;  1UJW B;  2JS3 A;  1ARO P;  3K5L A;  1VQO V;  1EFR G;  2OIG A;  3QO7 A;  1KUQ A;  1AR1 B;  2IW5 A;  4Z1M G;  1Q8I A;  3T4Z A;  1IBK B;  3AG1 B;  1M5I A;  1HDJ A;  4JI7 B;  4UCS A;  4PD4 F;  4I9W A;  3CS5 A;  4BW9 A;  3ML0 A;  5IYZ A;  4JI6 O;  4LF4 O;  5H6Q A;  4EKW A;  4X64 O;  3B2E E;  3CMA V;  1AVM A;  1Y66 A;  1WPB A;  3JD2 A;  1HW7 A;  3JSL A;  4OPA A;  3WB0 A;  2JGD A;  4JI2 B;  3MHS C;  4I50 A;  4I0X B;  1LUW A;  3QTC A;  5JJJ B;  4BAY A;  1OCC C;  2EIJ B;  5LA6 B;  2XUM A;  1GTO A;  5CA1 A;  5LMN B;  4FLY A;  2PZS A;  3TXS A;  5IJ9 B;  1QBZ A;  4D7T A;  5L3D A;  2UUA O;  3FB8 C;  5GON A;  1RM1 B;  4O2B A;  1YEW A;  2HJF C;  2ILM A;  4X62 B;  2F95 B;  2BOC C;  3ABK C;  3ETQ A;  5JCO A;  4CH4 A;  5FLX N;  1WAZ A;  3CJH B;  4HBN A;  1VMG A;  2PYL A;  1EN4 A;  4X20 B;  2QA4 V;  4X1Y B;  3OR7 C;  5CN0 A;  1P84 F;  4PHZ A;  4QGP A;  4FLV A;  3K08 A;  3B40 A;  1HNZ O;  1PV0 A;  1VQN V;  1QR8 A;  4B3T O;  5KAF Z;  3TGU H;  3G71 V;  4JYA B;  3K9S A;  1MOF A;  4PA3 A;  2OIE A;  4LF6 O;  1JMK C;  3AG2 B;  3P32 A;  1B6Q A;  1SES A;  5CBG A;  1M56 C;  4JAS A;  3SYC A;  2UUC B;  4AQY O;  4DV4 B;  3LNN A;  2ZE7 A;  1E1R G;  3B8N A;  3W7T A;  3STZ C;  1AJP A;  4XBF A;  4LFB O;  5E1A C;  4I4T B;  5H2F Z;  1WNS A;  1E79 G;  5L3G A;  4NXM B;  1PM9 A;  1WN7 A;  2DN9 A;  1QLE B;  5A2Q N;  2PF4 E;  4GX5 A;  1NH2 B;  4GX2 A;  2ZD9 A;  1M57 C;  2IBZ H;  4B3R B;  3IGA C;  4DR2 B;  2XAH A;  1J5E B;  1GK9 A;  4LC1 A;  4MVU A;  1TAE A;  1PNM A;  2ZCE A;  4JAU A;  2YXY A;  3BPZ A;  2QEX V;  3RVZ A;  4LF7 B;  4MVO A;  2P6J A;  2QKS A;  1L1F A;  2ZE8 A;  4OX9 B;  4I0X A;  3J81 N;  2WPD G;  4IIJ B;  1U97 A;  1AJN A;  3ZMV A;  1XL4 A;  4J7Z A;  2Q7H A;  3ABU A;  2AZ0 A;  5JJN B;  4NKG B;  4BW5 A;  1FXK B;  1YIT V;  1SQV H;  5IJ9 A;  1MNG A; 
#chains in the Genus database with same CATH homology
 1K8A W;  1OCO C;  3T4D A;  3UKM A;  3RW0 A;  1OZ0 A;  4QNH B;  2WLI B;  1NH2 D;  2DQ3 A;  4DXW A;  1FXV A;  3AG4 C;  1VQ5 V;  1JOY A;  2EIL C;  1NR1 A;  2JEU A;  1JX9 A;  3M99 B;  1F23 A;  3OGC C;  3FYI B;  4PDM A;  3X2Q C;  3G4S V;  1OCR B;  2FTK A;  5L3B A;  3D36 A;  5IYD O;  3QO5 A;  4RUF A;  1YTF D;  3FB7 C;  2Z3Y A;  1V54 B;  2V1D A;  1YJN V;  3W7W A;  4UV9 A;  2OTL V;  1R73 A;  5GW7 A;  1QCE A;  1F4M A;  1GM7 A;  4MW3 A;  1W2B U;  1KKD A;  4R7C A;  1DF4 A;  4MVZ A;  4WFF A;  1PNK A;  1NQT A;  2HLD G;  4G2K A;  1NBM G;  4UVC A;  1GM9 A;  2KB1 A;  2WLN A;  3OMN B;  5B1A C;  5EC1 C;  1DTO A;  4KP4 A;  1G4Y B;  4U7N A;  4JPR A;  1H8E G;  2DWD C;  2IU0 A;  3SYP A;  2Y69 B;  3T2M A;  3E2E A;  4LCU C;  2HG5 C;  4UUJ C;  1AI7 A;  1QR9 A;  2EJR A;  2Q67 A;  1N8R W;  1DLB A;  2QM8 A;  4MVS A;  3SYQ A;  3ZRW B;  2IJK A;  4F4L A;  2YSU B;  2OCC B;  4WFB V;  1PL0 A;  4JF3 A;  1JVM A;  4PDR A;  2JDI G;  4QPK A;  3ABM B;  4Q20 A;  4RO2 A;  1COW G;  3NXS A;  3ZN1 A;  2GHY A;  1KD1 W;  1JCH A;  2K1E A;  3BEH A;  1OCC B;  3SPJ A;  1K34 A;  2F43 G;  1YSC A;  2H94 A;  1R6K A;  2ITD C;  1FXK C;  2ZDI C;  1P4R A;  2A79 B;  2X0L A;  2Q69 A;  1YIJ V;  4XDL A;  3CCJ V;  2C2A A;  2WLJ A;  1KP3 A;  2EIJ C;  5EC2 C;  3LSS A;  4QIW F;  2HVJ C;  4MS2 A;  4GCZ A;  3ETG A;  4MVQ A;  1VQP V;  3AG3 B;  4MTG A;  4RUE A;  4FIP C;  1K4D C;  2EIN B;  1KEC A;  1NR7 A;  1QQH A;  5LBQ A;  3OMA B;  2X6B A;  4KUM A;  4GT1 A;  3F7Y C;  4WF9 V;  5CMU A;  1KP2 A;  2WLM A;  1RM1 C;  1M1K W;  2A9H A;  3CME V;  3ASO C;  2OTJ V;  5L3E A;  1OCR C;  4P30 A;  4LBE C;  2DW4 A;  5IYC O;  5L3F A;  1KQS U;  2P90 A;  5LGT A;  3EHB B;  4RQE A;  1NJI W;  5C93 A;  1YTF B;  3OMI B;  4FMT A;  4PA7 A;  1NVP B;  4WFH A;  3TET A;  1BHB A;  1K4C C;  5CBH A;  4UV8 A;  5HFM A;  2B1I A;  1FXK A;  2ZDI A;  3SPG A;  3ZCC A;  1S3J A;  2DYS B;  5B1B C;  3ZRV A;  4MSW C;  1W0J G;  2ZXW C;  2OT5 A;  5CBF A;  3SYA A;  4PA6 A;  1VQK V;  4PDL A;  2ITC C;  3K0G A;  3ASN C;  3CXC U;  3CC4 V;  5IYB O;  1M56 B;  2W6J G;  4MTO A;  1AJQ A;  1CP9 A;  3QNE A;  2Y69 C;  1EZJ A;  1SZT A;  3FYE B;  5FL7 G;  1GM8 A;  1ENV A;  4WFA V;  1TUE B;  3SPI A;  3TCU A;  2A0L A;  3AG2 C;  3CCS V;  2DYR B;  2ATK C;  5KA5 A;  2OCC C;  3D3I A;  2JJ1 G;  1CEZ A;  3LDD A;  2PI5 A;  3E86 A;  4LP8 A;  4UVB A;  1R3K C;  2P7T C;  1V55 B;  3LNM B;  1PNL A;  3CCV V;  5EBL C;  5DM6 V;  4GX1 A;  1S77 D;  1HWY A;  1BL8 A;  5L3C A;  1ROP A;  1K97 A;  4RQF A;  1JJ2 U;  2UXX A;  2IH3 C;  1VQ8 V;  1BHA A;  3AEI A;  2QM7 A;  3A0R A;  2MK3 A;  4MTX A;  5BZB A;  1NVP D;  1RPR A;  1SRY A;  3ABL B;  4R8C A;  4MTF A;  2HVK C;  4DO2 A;  3LDE A;  2NNU A;  4ZBM A;  2JEX A;  1OCZ B;  3IFX A;  4J9Y B;  3AG3 C;  5IY5 B;  1YJ9 V;  3PJS K;  4X89 A;  2ZQM A;  1EBO A;  1QLE C;  1M57 B;  2HKO A;  2R9R B;  3FKS G;  1I5Y A;  3CPW U;  2WLK A;  1K3E A;  3BY6 A;  3ZRS A;  4CBC A;  1S76 D;  4PEL A;  5EK0 A;  4XDK A;  5EBW C;  1QVG U;  2EIM C;  5B1O A;  4YXW G;  1W0K G;  3ZRW A;  1XL6 A;  3B8M A;  1VQL V;  3R65 A;  1THZ A;  3B77 A;  4WFE A;  1H2G A;  5LGN A;  3ETD A;  1H8H G;  3OUS A;  3OW2 U;  2H8P C;  3E83 A;  4J9Z B;  4UXN A;  1JQ0 A;  3CCR V;  1VQM V;  5J9P C;  2IU3 A;  5KUK A;  3ZRX A;  3SPH A;  1GKF A;  2JJ2 G;  1M9N A;  3E89 A;  3JD4 A;  1AI5 A;  3E8H A;  3E8G A;  4JYB A;  1PD3 A;  3CYO A;  3FB5 C;  1R3I C;  1K5S A;  4ZKI A;  2ZR3 A;  1RPO A;  2EIK B;  5DN6 G;  2DYS C;  2DWE C;  5LHI A;  4X88 A;  3CCL V;  3SJQ C;  2JIZ G;  2EBO A;  3ZMU A;  1S5H C;  4JTD B;  4BIZ A;  4PA4 A;  5LHH A;  2WWW A;  3CC2 V;  1GO3 F;  3VBB A;  1E1Q G;  4P9P A;  4TWK A;  4R6Z A;  5EBM C;  3AG4 B;  3K79 A;  1FFT B;  4RAI A;  2EIL B;  2W6I G;  3RVY A;  2X6C A;  3CCE V;  3F7V C;  2WLL B;  2UXN A;  1KC8 W;  2WSS G;  4MW8 A;  3X2Q B;  1UJW B;  3OR6 C;  1ARO P;  1VQO V;  1YI2 V;  1EFR G;  3OEH G;  4HZ3 A;  3ABK B;  1V55 C;  1K7D A;  2XAJ A;  2LFS A;  1ZWI C;  2IH1 C;  3QO7 A;  1WLE A;  1WPX A;  2WLH A;  1K33 A;  2IW5 A;  1AR1 B;  4PA9 A;  4TT3 G;  4MVR A;  2ZR2 A;  4Z1M G;  3ZN0 A;  3T4Z A;  4OXS A;  2YEV B;  1V54 C;  3ABL C;  3ZMS A;  3AG1 B;  4U7O A;  3SYO A;  5B1A B;  3TK1 A;  4UVA A;  3WG7 B;  1OCZ C;  2AHZ A;  2WAM A;  2QTO A;  4QE9 A;  3CCQ V;  1IXM A;  2B1G A;  4I9W A;  3W7X A;  1VQ6 V;  4L87 A;  3ML0 A;  5H6Q A;  4N21 A;  3HPL C;  4EKW A;  2W0F C;  3CMA V;  2WLI A;  3JCZ A;  1Y66 A;  3JD2 A;  1CPY A;  1MAB G;  3CP1 A;  1S0V A;  2DQ0 A;  4WFG A;  3CCM V;  3ZIA G;  1JPX A;  4X8A A;  3W7U A;  2IJJ A;  2CK3 G;  3W7S A;  3MHS C;  3SPC A;  1BMF G;  3ABM C;  4P2Z A;  3DGE A;  1OHH G;  1VQ7 V;  3EFF K;  2X6A A;  5B1N A;  2EIK C;  1LNQ A;  3VOU A;  4BAY A;  1OCC C;  3JD3 A;  2EIJ B;  1VQ9 V;  3I56 V;  3G6E V;  1GTO A;  4WCE V;  5HFL A;  2GSM B;  4P9O A;  2Q6A A;  4MT8 A;  4E2L A;  3K9A A;  1F4N A;  3ZMT A;  1QBZ A;  2Y48 A;  1SET A;  5L3D A;  4H37 A;  3FB8 C;  1F51 A;  4BIU A;  3JD0 A;  1RM1 B;  2EIN C;  1FXH A;  4G27 B;  3ASO B;  2HJF C;  2LFR A;  2PI4 A;  1DF5 A;  4H33 A;  3WFV A;  3CD6 V;  2BOC C;  3ZMZ A;  3ABK C;  3K3W A;  3OFN G;  4N23 A;  3CCU V;  1I5X A;  4QE7 A;  1NKD A;  4G28 B;  5B3S B;  2EZO A;  2D3O W;  5KA6 A;  3E8F A;  3JD1 A;  2BOB C;  5B1B B;  4JGS A;  2QA4 V;  2ZXW B;  3GB7 C;  3AG1 C;  3LDC A;  2XOK G;  3OR7 C;  3E35 A;  5CN0 A;  4XDJ A;  3STL C;  3K08 A;  3WG7 C;  1VQN V;  1R3L C;  5KUM A;  1P7B A;  3ASN B;  3T1C A;  1QR8 A;  3ETE A;  3ZJZ A;  3OUF A;  3G71 V;  5LHG A;  1YJW V;  2JK5 C;  4HYO A;  1MOF A;  1K92 A;  4PA3 A;  3UM7 A;  3JYC A;  2HR3 A;  3AG2 B;  1OCO B;  3H01 A;  3IC7 A;  3P32 A;  1B6Q A;  2WLL A;  1SES A;  5CBG A;  1Q7Y W;  1M56 C;  4JAS A;  5IDJ A;  5H9C A;  3OM3 B;  4CZZ A;  3KG2 A;  3SYC A;  1J95 A;  1QLN A;  2IJH A;  4KFM A;  4R50 A;  1H38 A;  1E1R G;  2DYR C;  3B8N A;  1K5Q A;  3W7T A;  3STZ C;  1AJP A;  4XBF A;  5E1A C;  1AI4 A;  3MHH C;  2V7Q G;  1AI6 A;  2AHY A;  3E8B A;  4JAV A;  2YEV A;  1Q86 W;  4JTA B;  2P67 A;  2XAF A;  4JTC B;  3FB6 C;  3OEE G;  1GMG A;  4QPJ A;  1E79 G;  5L3G A;  1QVF U;  1VQ4 V;  4HAM A;  4GX0 A;  2QE7 G;  1QLE B;  2NLJ C;  5LGU A;  1K9M W;  3P30 A;  1SER A;  4ASU G;  2Z5U A;  4GX5 A;  4FK5 C;  2XAS A;  2EIM B;  2M7W A;  4GX2 A;  2ZD9 A;  1NH2 B;  5IY5 C;  1M57 C;  4I5S A;  2IJI A;  3ABT A;  1Q81 W;  1Y4M A;  3IGA C;  3LSQ A;  1Q82 W;  1G8M A;  3QO8 A;  1MSW D;  2LP7 A;  2XAH A;  1GK9 A;  2Q68 A;  4LC1 A;  4MVU A;  1PKX A;  3CC7 V;  1PNM A;  4JAU A;  1YHQ V;  2QEX V;  2XAQ A;  1S72 V;  3RVZ A;  3LUT B;  4MVO A;  3HB3 B;  3OE7 G;  2P6J A;  2QKS A;  2X7R B;  1L1F A;  3GWO A;  3K06 A;  5H6R A;  3K0D A;  5B3S C;  3K04 A;  4FPP A;  2WPD G;  2R9I A;  3K03 A;  3RBZ A;  1K73 W;  2B5U A;  3F5W C;  1FS0 G;  4QJF B;  1AJN A;  3ZMV A;  1R3J C;  1XL4 A;  3MD0 A;  2XND G;  4MVM A;  4TSF G;  4PDV A;  2HFE C;  1MG1 A;  3ABU A;  1ORQ C;  3I55 V;  2EZP A;  4BW5 A;  1FXK B;  1YIT V;  1R6N A;  4FJC C;  2XAG A;  1M90 W;  4JYC A;  5CA3 A;  3OAA G;  3DTU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...