1DTOA

Crystal structure of the complete transactivation domain of e2 protein from the human papillomavirus type 16
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
202
structure length
200
Chain Sequence
HMETLCQRLNVCQDKILTHYENDSTDLRDHIDYWKHMRLECAIYYKAREMGFKHINHQVVPTLAVSKNKALQAIELQLTLETIYNSQYSNEKWTLQDVSLEVYLTAPTGCIKKHGYTVEVQFDGDNTMHYTNWTHIYICEEASVTVVEGQVDYYGLYYVHEGIRTYFVQFKDDAEKYSKNKVWEVHAGGQVILCPTSVFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords REGULATORY PROTEIN E2
publication title Structure of the intact transactivation domain of the human papillomavirus E2 protein.
pubmed doi rcsb
source organism Human papillomavirus type 16
total genus 63
structure length 200
sequence length 202
ec nomenclature
pdb deposition date 2000-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00508 PPV_E2_N E2 (early) protein, N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.30 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1dtoA01
2.170.200.10 Mainly Beta Beta Complex Regulatory Protein E2; Chain: A; Domain 2 Regulatory Protein E2; Chain: A; Domain 2 1dtoA02
1R6NA 2JEXA 1TUEB 2JEUA 1DTOA 1QQHA 1R6KA 2NNUA
chains in the Genus database with same CATH superfamily
1J5EB 1YSCA 3DGEA 4MS2A 2HJFC 2Q0AA 4XDKA 4DV2B 1XI1A 4X62B 4DR1O 4CS4A 1PNLA 5LBQA 2KG7B 4LF9B 2KSDA 4WBNA 2UU9O 1IXMA 3JD1A 1CEZA 3G6EV 1K97A 1R3IC 2LFRA 1OCCC 3B8MA 3FAVA 1VQ7V 3HKBA 3DXRB 1VIBA 4U3JA 1VQNV 1L1FA 3JALA 2IU3A 3AG1B 2WSSG 4N21A 2LGWA 3ZIAG 1Q86W 3IAYA 4TQFA 2UUBO 4IIJA 5CA0B 3E2EA 4YY3B 4DR5O 1HP8A 4LP8A 3WB2A 2UXDO 1Z2GA 4GYCB 4RQEA 2IJJA 3OR7C 3CPWU 3K04A 4DK1A 2HEPA 2V7QG 1U97A 4YIPA 4WFBV 1YZBA 1J5EO 1SQBH 3ZRSA 1FAFA 3TXQA 1QU7A 3B2EE 3CCRV 1QVFU 3CE2A 2Q5ZA 2NN4A 4LF9O 1O9HA 1TVKA 2JIZG 4H37A 5IE9A 4KUMA 5LMNB 4X66O 1H2GA 4U7NA 2JK5C 4WFFA 5KX5B 1Y67A 3H1KH 2PYLA 2QSAA 4GKKB 2QWOB 1JCHA 1FPOA 1SS3A 5DM6V 4LF8B 5D5PA 4B3TB 2ZR2A 3FB7C 1HNXO 4K3AA 3SYQA 2YIAA 4MVZA 1LUWA 1N32O 2X6AA 3K5MA 5E1AC 4TUYB 1IX9A 3OEEG 5LGNA 3LSSA 3Q4HB 4FJCC 2GHYA 4IT5A 1B3QA 4IYIA 4HBNA 1M4UA 5EC1C 4D7TA 4K35A 3D36C 4NVPA 1Q90D 2F1MA 3CRQA 3AG1C 5LXTB 2IBZH 1M93A 1Y4MA 2XHBA 2BOBC 5LP6B 4O2BA 2QGNA 5GTHZ 5L3EA 5JH7A 1Y6XA 3UT5A 3OT7A 1K73W 1MMMA 4X1IB 4FLUA 4NXMB 5LHGA 5LMNO 1RP3B 2VS0A 2FMLA 1TAEA 3K03A 5H5NA 2RN9A 2YC0A 4GKKO 1M90W 3N2KB 2CAZC 1ZAUA 4PV1B 3PN1A 2JGDB 2WLNA 4IHJB 1N8RW 3B40A 4DUZO 2CE4A 2QKAA 3OM3B 4FM0A 5EYPB 3PJSK 1R6TA 2PY5A 2AXTZ 1BGYH 2A79B 1M57B 2UUAB 1WNSA 2JEUA 4EFBA 3H1LH 5EBLC 1RPOA 4LFCO 3FKSG 1GK9A 3BY6A 2JDIG 4X1KB 3W7SA 1JPXA 1XNQB 3E8BA 5GW7A 2EX3A 1K33A 3JCZA 3WB1A 3N2GB 4UV8A 1FFXB 1MNGA 2EINB 3SYAA 3P32A 4BIUA 2KG7A 4ZI7B 5KAFZ 2PUSA 3O9OA 3RW0A 1BMFG 1OCRC 3DXRA 1PL0A 3D36A 1UFIA 2XOKG 3AEIA 3RYHB 3HKEB 1K9MW 3CCUV 5LP6C 3LDEA 1WAZA 1W2BU 2ILMA 2EILB 3BA9A 3ZS8C 5CA0A 2UUAO 1ZWIC 4O4LB 4J41A 3RFRA 1SQGA 3UCSC 4K8XA 5LYJB 2X6BA 1AI4A 2RNBA 1THZA 4H13B 1B6QA 4QNHB 3WG7B 1KYOF 2BE3A 3KKYA 2Q69A 4I0XB 1QQHA 3ETGA 2X6CA 5KLVH 1R1BA 1SKVA 1TUBB 3SPIA 1FXVA 3M99B 1M1KW 3M8AA 4MW8A 4UCVA 3MHSC 4OPHA 5IYZB 2XT9A 5KHIA 1M57C 5DECA 1WN7A 4NKGB 2MK3A 1G6UA 4PDLA 5KX5A 1XEQA 1BL8A 4OX9O 4KL1A 5EZYA 2DYRB 5HFLA 1BQZA 2QDOA 1I5XA 4RUEA 4PI0A 1AI7A 3JD3A 2ADQB 1R6KA 4NTYA 4G27B 4LF7B 1WB8A 2ZIOA 2O57A 2EINC 4ICGA 5IJ9B 4LBEC 4DR3B 3CCEV 4TUYA 2XAHA 3CEIA 1R3JC 2H8PC 4FLZA 3Q4HA 2LGQA 4CC6A 5BR8B 2ZM6O 3G6BA 3OD4A 4I5SA 1KP2A 4GLXA 4YHHO 2Y69B 1YEWA 2JEXA 5LXTA 1W59A 4DV7B 4HNAA 4UCRA 4ASUG 4W4LA 4PHZA 2ZXWB 4X88A 1IDSA 2EULA 2XASA 5LP6A 4O4IA 4JYBA 4PA6A 4PDRA 4JYAB 4X1IA 5JQGB 1PPJH 1JFFB 3E89A 4GT1A 3B4SA 3VQVA 4B7EA 2E5LO 3KCXA 3WG7C 5CA1B 1ZX3A 2Z3YA 2W0XA 4LWSB 4I9WA 4F6EA 4DR2B 4LFBB 4DXWA 1K4CC 4G28B 3N2KA 1B04A 4JYCA 2JGDA 4IHJA 2Q7GA 3F7YC 4MTXA 3RWRD 4LF7O 1XMOB 5EYPA 1S76D 3M7MX 1H2SB 4BR6A 2R9RB 4MSWC 2AHYA 4FIPC 1L0LH 3K06A 1Y74B 3GWOA 3RGBA 3CC4V 3IFXA 1URFA 3LDDA 4KHPB 1BHAA 4DV5B 1VARA 1VQ5V 2EIKB 1Q5OA 4X1KA 1S3JA 1NT2B 3SDLA 1D5NA 1V54C 1SQVH 1A32A 2Q7HA 3CCLV 1WA8B 2LW7A 2E76B 1BHBA 2EJ7A 3N2GA 1FFXA 5CBFA 3CD6V 1S5LZ 1KKCA 1HNWB 2F4VB 4GX1A 3T2MA 3JATB 4ZI7A 5KA5A 4DYLA 2XAFA 4O4JB 4K0KB 5J9PC 4LFBO 1HR0B 3K08A 2Y69C 2QM8A 2YXYA 1IBKO 4J11A 1HWYA 2W6JG 2YI8A 1L0NH 3RYHA 1YDXA 3ZRVA 3HKEA 2ZXWC 1XMOO 2GBOA 1EN5A 1EZVH 1N34B 2A9HA 2XTAA 3D3IA 1KU9A 4F4LA 2QM7A 4O4LA 2RCVA 3SGIA 3OGIB 1DK1A 3DTUB 1HW7A 3OTOB 2FYUH 2L35A 2EIMB 5C93A 5LYJA 3AK1A 3MAQA 2ATKC 3T1YB 2QEXV 4DV5O 4WFEA 3LSUA 4PA9A 4E4EA 1SETA 1AILA 4I0XA 5FPRA 3U0ZA 4GX5A 3OGCC 3CRCA 1TUBA 4B08A 3CCJV 5IDJA 4FFBB 4RWUA 1R3KC 2A06H 1XUQA 1IBMB 2Y0PA 2WLIB 4B3RB 5IYZA 3APOA 2C2AA 1HNWO 1F51A 2F4VO 1VEWA 1O9GA 3G4SV 4E2LA 4G2KA 4I55B 4DR1B 1YITV 2Y4TA 4BW5A 2ZE7A 4NTWA 3GB7C 2EIKC 1GH6A 1FS0G 2HLDG 2DWDC 3BVOA 3IC7A 2AZ2A 2OCCB 2WLKA 4YXWG 3EHBB 2ZE6A 5IJ9A 1DF5A 2HKOA 5ITZB 4O4HA 3L74H 2ZCEA 3STLC 4N23A 4PD4F 4RO2A 4QGPA 2UUBB 1GN4A 4PJ0Z 2GV9A 3GWKC 4LC1A 4DR5B 1R73A 2UXDB 4I7ZB 5LL6Y 1EZJA 3TK1A 4MVUA 4PDMA 2YEVB 5JCOA 2Y0IA 1IBMO 4B3RO 4UVBA 2YIDA 2E75B 1M9NA 4JAAA 1LUVA 1SZXA 3SR2C 4AQYO 2EIMC 4FZ1A 5JQGA 2P06A 3ZRWB 3RYCB 1JFFA 3BEHA 2QTOA 1HDJA 3STZC 5CA1A 3E8GA 3CRMA 4LWSA 2OYQA 2R72A 1GTOA 1NU1H 3DSQA 4X66B 1Q81W 2X7RB 1G8MA 1YTFB 4BIOA 3CMAV 4AILC 3BABA 3HPLC 1JJOA 2PZSA 1Q43A 1TUEB 2ADPA 3D3QA 1Q7YW 1JMKC 5IYDO 4XDJA 2B5UA 1SERA 1Y74A 1HNXB 4QIWF 3VQWA 1YJWV 4DRXB 3P30A 5CBHA 3LNNA 5JVDB 1N32B 1GM8A 2A0LA 1EBOA 1WPXA 3RVZA 1QVGU 1K92A 2OCCC 4UFZA 2DMXA 1PM9A 1GM9A 1WA8A 5EIBD 1IZ3A 2Q73A 3T1HB 1OHHG 4HAMA 1YTFD 3JATA 1H8HG 2W0FC 5B1OA 2CK3G 4O4JA 1N4CA 1SQXH 3K9AA 3SYCA 3OMNB 1E1RG 2HP8A 3QTCA 4JASA 4WFHA 3UO2A 4JF3A 1R3LC 1FKAO 3ZCCA 3JAMN 5IJ0B 4X89A 3UKMA 1XL6A 5LHHA 2JGUA 5GONB 1FYJA 3JYCA 1WP8A 4D6TH 4DUZB 4GZRB 3CX5F 2F95B 2UXBO 5EIBC 1PNKA 3OUSA 3UO3A 2CTPA 2IU0A 4OGQB 3AG4B 4LFCB 4Q6GA 1FFTB 2IW5A 4DV4O 5H6RA 2VRZA 5B1NA 1YIJV 4FFBA 2Q8VA 1OCRB 4JI4O 4UCUA 1GRJA 2HHHB 5GTIZ 2ZNIA 1N0NA 2WWWA 3T1HO 2WLIA 4NR1A 4X8AA 5JJNB 1DTOA 2P7TC 2P67A 1AP6A 3A8TA 4R50A 1VQMV 2Q67A 2EZOA 4JTCB 1VP7A 2CH7B 1PKXA 4P9PA 2CUGA 2F66C 4DV1B 4JI1O 4I55A 3O65A 5KUKA 2BTQB 1X4TA 3K57A 1BE3H 5CN0A 4L87A 4UB8Z 1YJ9V 1MABG 2OT5A 4DW0A 3JARA 4FPPA 2JRIA 2YDEA 4J42A 5KHJA 5JJJB 2Q7EA 4ZHQB 1US6A 5L3GA 1H2LA 5ITZA 2R70A 2QR4A 3E86A 5BXZA 1JQ0A 2DQ3A 3CS5A 3MHHC 4CS2A 5BMVB 5IYCO 4B7KA 2ZE8A 1V55B 3ASOB 3X2QB 3NXSA 3ZJZA 1RPRA 3L73H 3OR6C 4Z2WA 4PELA 1I94O 1TGOA 4EB6B 4JAUA 3OUFA 2HHHO 1MOFA 2V1DA 2YEVA 2PI4A 3R66A 4FM1A 3UM7A 3ZRXA 3N27A 4UVAA 3B8NA 2JS3A 5LMUB 3RYCA 2P90A 4DV1O 1KP3A 2YSUB 1K3EA 2YI9A 1H2NA 3JAKB 4MVQA 4DV0O 3AG4C 3KZIZ 4CH6A 2QA4V 4Z1VA 1BSMA 4ABMA 4XDLA 5IWAO 2H3OA 3OEHG 2N05A 4OX9B 2OIEA 2WPDG 2BCCH 1MA1A 1H2KA 3L71H 3GVMA 4LH6A 4R7CA 3B09A 3RT3C 3ABMB 4XBFA 3ZHSA 4DRXA 1AR1B 1JVMA 5JVDA 4MTGA 2GTAA 3S3XA 1MZEA 3H9VA 1XILA 3ZHUA 4I50B 1E1QG 2ZM6B 4U7OA 3FB8C 1VQKV 3T4ZA 3IC9A 3E8HA 4YHHB 1D5AA 3CCMV 3SJQC 3CSXA 3BPZA 4RUFA 1NS1A 3ZBHA 3SPHA 4QE7A 3CHXA 5LMUO 5FL7G 4NTXA 1NVPB 4P2ZA 3CRRA 3VQYA 3CCVV 1V55C 3ASOC 3X2QC 3FB6C 1PNMA 1ZSPA 5IJ0A 3AK2A 1JR9A 5EBWC 2EJRA 4QJFB 3P3PA 2E5LB 4WF9V 1KKDA 4X9QA 2B1IA 3CC7V 1AROP 1F4MA 4L8JA 4NYKA 4IGGA 1ZL8B 1V54B 3ETQA 5B5EZ 2ITDC 2UUCO 4CH5A 4PA7A 4D7SA 1IVSA 1HNZB 1J95A 2E3CA 2ZINA 4PDVA 1N0JA 2AW9A 1PV0A 2LW1A 1NVPD 4LNUB 3DC6A 3L70H 1RSOB 3BFRA 1AR4A 2B9ZA 3A0RA 1OCZB 3ABMC 3OMIB 1GO3F 2CH7A 1KMIZ 2YXHA 1CPYA 1K8AW 1CP9A 3K5OA 4J9YB 4FZ0A 2N04A 3DC5A 4UCOA 4TWKA 4UCTA 2BTQA 1PL4A 4I9QA 2QWRB 2WLLB 3JCUZ 3A2FA 2ARHA 4DV6B 3CMEV 3FFQA 4MVOA 1IBKB 2GDSA 1YF2A 1M56B 1YVWA 3ZEDA 5LA6B 2HG5C 1QLNA 1Y76B 1HNZO 3E22B 2XUMA 1Z5WA 4W4KA 4JTAB 5LOVB 1YHQV 4EB6A 1VQ8V 2WLHA 2ZE5A 5J2UB 2X0LA 1DLBA 1FJGO 1I08A 4BW9A 1AB3A 5B66Z 1AJNA 3D8CA 1XREA 1ORQC 4LR3A 4JI0O 1NJIW 2OIGA 3JASB 3JAKA 4IIJB 2WA4A 2ZT9B 3S3WA 4ZIBA 3I56V 2QJ1A 2YICA 3LUTB 2ZDIC 3QF7A 3EXAA 1FXHA 2ZQMA 1OV9A 5J2TB 2PF4E 3FYEB 4DV6O 1KB9F 2M7WA 3F7VC 3I55V 3K5LA 2PYJA 1OCZC 5A2QN 1DGSA 4CH3A 1XBLA 4JI3B 2UXCB 1FXKC 3JSLA 3LNMB 3ETDA 5LHIA 3ICXA 3W7TA 3T4DA 5CBGA 5BZBA 1I7FA 2RQ6A 2P4KA 5IYBO 4I50A 5HFMA 1SESA 4KP4A 4GKJO 4U3FH 4JV5B 3QG5A 5JWPA 3IGAC 2QE7G 1YCIA 1M56C 3ZX6A 5CB4B 1VF5B 1MG1A 3E8FA 3LSQA 4FFKA 1NTMH 4JYYA 5C8YB 1YJNV 5IY5B 2ODMA 1QLEB 4LH7A 2BOCC 1GN3A 4AQYB 1K34A 1K4DC 4JI5B 4CBCA 1VQPV 2OWOA 4X64B 5CMUA 3WU2Z 1IBLO 4MT8A 1VF6C 4JAVA 4B3MO 1ZL8A 2GTSA 1VQ9V 5KHKA 4JI3O 3ZHVA 3ML0A 2UXCO 2K1EA 1SA0B 3HB3B 4Q20A 2RMKB 1BCCH 3HKCB 1WJZA 1XNRO 3J80N 3OTFA 2ZDIA 3F5TA 2Z0AA 4LNUA 4JV5O 4B3SB 4ZBMA 1X59A 4AHCA 2HR3A 1RSOA 3K5NA 2EZPA 2DYSC 3ETEA 4WCEV 4BWAA 4GX0A 3FD9A 1KUQA 1T5EA 4JZ2A 1YI2V 1AVMA 2FB5A 2JVDA 1F23A 1Q6UA 3CCSV 4JI8O 4DR7O 2CGNA 1BQ0A 3HKDB 5AG2A 2F93B 4JI5O 4R6ZA 4J9ZB 1WPBA 4X64O 2DW4A 2F23A 2Z5UA 3BAAA 2HFEC 3U10A 2D3OW 2QTSA 4X1YB 5H9CA 3P3NA 2UXNA 1WP7A 3OW2U 1I5YA 2LQTA 3AG2B 2G38A 5LA6A 5IY5C 1NKDA 1QLEC 2IJHA 1Y76A 1AJPA 3G80A 3E22A 3SPJA 3C3SA 2IJIA 2UXBB 1GM7A 1SRYA 5LOVA 4B3SO 1S0VA 5KHGA 5J2UA 3SYOA 5L3FA 1VF6A 2KQXA 1VMGA 2NNUA 4DV4B 1MZFA 1NTKH 1MSWD 3J81N 4JI4B 4UV9A 1YXBA 2A7WA 4PA3A 4JI6B 1BT8A 3C90A 2DOSA 3JASA 1AI6A 2ZD9A 1KD1W 3K3WA 2HVJC 4HYOA 4DK0A 4UUJC 1UPGA 1JOYA 3K59A 2LJ2A 2RJZA 3K0DA 4JI1B 4P9OA 1B06A 4NB5A 5J2TA 2GSMB 1AJQA 4QPKA 2ZR3A 2JS5A 5LGUA 1Q6IA 2QWNB 4R8CA 1Q3EA 4FK5C 2JJ1G 4JGSA 3E83A 1EFRG 4LCUC 4DUYB 4DV2O 5B1BB 1M5IA 4OPAA 3WFVA 4X62O 1SQQH 3RBZA 2XNDG 3J7AU 2NLJC 3CCQV 2AGAA 1V9PA 4TV9B 4GUNA 4DR6B 3QO5A 1ZUQA 2VWKA 5KUMA 5FNVB 3OFNG 1EN4A 2F43G 5EZYB 1NTZH 3CYOA 3G71V 3IJ4A 2Q6AA 1QCEA 1I94B 3ZHQA 3AG2C 1AR5A 1NR1A 5CB4A 1S5HC 2ZKOA 4JI6O 3SPGA 1W0KG 4H33A 2XAQA 1P49A 5C8YA 2CDYA 1QQCA 4FLWA 3ABTA 4YY3O 2OTLV 4X20B 1K5QA 1GMGA 2KB1A 3C3TA 3BHPA 4EKWA 1K7DA 2R9AA 3L9DA 4A5UB 3JD2A 1XOUA 3L75H 1PP9H 1LNQA 3A0HZ 1AP5A 4DV0B 1Z5VA 2VWJA 4YJ3B 1P84F 4QE9A 2V4DA 2RDCA 4HNAB 4DUYO 1P4RA 5D5QA 5IWAB 3VQXA 3W7WA 1SF9A 1NR7A 1SA0A 2DQ0A 4O4IB 4YIOA 4J7KA 2ITCC 2WA3A 5B1AB 4DR6O 3HKCA 1L8DA 3CJHB 3TJTA 2IH3C 3RVYA 5F2VO 3L72H 2LP7A 4J7JA 2H94A 5KAIZ 3JAWB 3MDSA 2ZIMA 4J7ZA 1EN6A 2QKSA 3RYIB 4LF8O 4JZGA 2IM9A 4B3TO 5B1BC 5EC2C 1XQ8A 3SJCC 1QNMA 4FLTA 3HKDA 1GN6A 3ZMVA 3SYPA 2WLMA 2Y4UA 4TT3G 3ZRWA 5E79Z 4NXNB 5KMGB 4JI2B 2D2CB 2YUAA 2L6LA 5TISZ 4DR4B 4TV8B 2EIJB 2YXLA 2BSKB 4UB6Z 4X1YA 1WLEA 4I4TB 1KQSU 4F6RB 4JI7B 3SJAC 2CTWA 3K58A 1SQFA 2Q68A 5K1XA 1H2MA 4FVMA 1BS3A 4FLVA 3WB0A 3B77A 2P22C 2Q4PA 4CH4A 2HJDA 3CXCU 1IXBA 3K0GA 3AK3A 2M6YA 4NXMO 1GAXA 2UUCB 1IURA 1UJWB 3QNEA 2GUZB 4BIZA 1Y66A 4QPJA 1BZKA 3F5WC 4X65B 3H1JH 1D2DA 3RYFB 1WB7A 3ZMSA 3H1HH 5B1AC 3K9SA 1ZLZA 4IL6Z 5LGTA 4KFMA 2DJVA 4NXNO 4AI8A 4JTDB 3E35A 4PA4A 4JI2O 3A0BZ 2CTQA 4DR4O 3ZHTA 2A3QA 5L3DA 2Q9LA 2DWEC 5FPOA 1KBHA 4JI7O 1F4NA 3EFFK 1XNQO 1VF7A 3OAAG 1GKFA 2E74B 3OMAB 4FLXA 1RM1B 1OJHA 5GONA 1QHTA 3K79A 4MTOA 3SJBC 1MSDA 5FLXN 2LFSA 4TV9A 4MVSA 4CZZA 2ETNA 3CXHF 2AHZA 4TSFG 2DN9A 4ZKIA 2BTOA 3NR7A 3TETA 3AG3B 4DO2A 4DW1A 3FB5C 5B3SB 5FNVA 5JJEB 4O2AB 2EIJC 2B1GA 4UXNA 1SC5B 2FKXA 4YJ2B 1COWG 1XDCA 3QO7A 4X65O 4ZOLB 5EBMC 3KCYA 4J80A 5K1PA 5L3BA 2JJ2G 1QR8A 1FJGB 2VQEB 2Y48A 3CWBH 4MTFA 4O4HB 3BCCH 3H1IH 2P6JA 3CB2A 4H0LB 1SQPH 1S72V 4X20A 1OZ0A 4HZ3A 1XL4A 3RN4A 2NR5A 4CS3A 4J10A 3MD0A 2PGGA 1FXKB 2DE0X 3VOUA 1VQ4V 4JI0B 1GN2A 4Z1MG 5L3CA 4YJ3A 3QVNA 2CGOA 2MW2B 4EEQA 1TA8A 3UQ8A 5DN6G 2WLJA 2W6IG 1K5SA 2VQFB 4ZHQA 2EILC 3APQA 4FMTA 3ZMTA 3TGUH 2YS8A 1G4YB 4MVMA 3H01A 5IT9N 3CJHA 1H8EG 3ZN0A 2IH1C 2YIBD 1VQ6V 5BMVA 1N33B 3T1CA 3JAWA 3ZMUA 4LF5B 4DV3B 2ZNJA 1S5JA 4LFAB 3BA8A 4WBNB 4K8ZA 2EBOA 3RYIA 1S77D 1RM1C 1H38A 1N36B 4GKJB 3FAVB 1P7BA 3W7XA 1RFYA 1EM1A 3ABKB 3HKBB 3JSNA 4RAIA 3ZMZA 2VQEO 1Q8IA 4U3JB 1NI8A 1XHZA 4DR3O 3JALB 1Q6HA 3THOA 1XHXA 4MVRA 1KECA 3AG3C 3ABUA 5B3SC 1AI5A 1QBZA 5KMGA 5BR8O 2QM4A 1F7YA 4EFEA 4OXSA 3QO8A 4TV8A 3AG7A 3FYIB 2DYRC 2XAGA 2AZ0A 1OCOB 2BSKA 3G67A 1JA8A 4I4TA 3U11A 4F6RA 4DV7O 3CRAA 2XAJA 4JPRA 3ZN1A 2FTKA 2OCHA 2VQFO 3TXSA 1P7GA 1IBLB 2DYSB 3SPCA 5BY1A 4JYAO 4B3MB 4UVCA 1VQOV 2P4VA 1SZTA 3I5DA 2OTJV 1NH2B 3HR0A 3KG2A 4UCSA 1N33O 1DF4A 1I0HA 2K9PA 4LF5O 4DV3O 4LFAO 4DR2O 1Q82W 1CXZB 3ASNB 1TVKB 2GUZA 3FX7A 3BRCA 1XNRB 2WAMA 3R65A 3ZHRA 1N36O 3CP1A 5JCOC 3LDCA 4WFGA 3ABLB 3JD0A 2P5OA 2IJKA 3RYFA 1R6NA 2HVKC 5KA6A 1QR9A 4LF4B 3EVKA 4JI8B 4DR7B 1PD3A 4KHPO 4TQDA 1G1XB 4LF6B 1JJ2U 1ROPA 5A9GA 4IYHA 1NH2D 4GCZA 5EK0A 1JX9A 1XMQB 3ABKC 1OCCB 5DEDA 2PI5A 5KHHA 2QKCA 4C7UA 1KC8W 4PI2A 3VBBA 2Q0OC 1NQTA 1VQLV 4O2BB 4FM2A 5JH7B 4K0KO 5H2FZ 4O2AA 3UT5B 4GX2A 5H6QA 1HR0O 1OCOC 2FL4A 4YJ2A 2R9IA 5CA3A 2UU9B 2LO1A 3TCUA 4CC5A 4RQFA 4ZOLA 4FLYA 2YIBA 3JARB 1N34O 4TOIA 2CTRA 4MW3A 2KKWA 4H44B 1U96A 4LF4O 3OTOO 1NBMG 2QWQB 1FXKA 4P30A 3CC2V 3T1YO 4WFAV 2QWPB 3ASNC 3OE7G 4LF6O 3JD4A 1FD9A 2UXXA 1LR1A 1NZ6A 1ENVA 1W0JG 2WLLA 2N74A 4KXRA 1XMQO 3ABLC 1ZTEA 1E79G 4BAYA 3W7UA 2PTMA
chains in the Genus database with same CATH topology
1YSCA 3DGEA 5KA5A 4MS2A 2HJFC 1P4RA 2XAFA 4XDKA 4QJFB 5EBWC 2EJRA 3W7WA 1KKDA 4WF9V 1NR7A 2DQ0A 5J9PC 1PNLA 2B1IA 3CC7V 2ITCC 3K08A 1AROP 1F4MA 2Y69C 5LBQA 2QM8A 5B1AB 1HWYA 1IXMA 2W6JG 3JD1A 1CEZA 1V54B 3G6EV 3ZRVA 1K97A 1R3IC 2IH3C 2ITDC 2LFRA 2ZXWC 3RVYA 1OCCC 3B8MA 2LP7A 1VQ7V 2H94A 4PA7A 2A9HA 3D3IA 4F4LA 1VQNV 1L1FA 1J95A 2QM7A 2IU3A 3AG1B 4PDVA 2QKSA 3DTUB 2WSSG 4N21A 2EIMB 3ZIAG 5C93A 1NVPD 1Q86W 5B1BC 5EC2C 2ATKC 2QEXV 4WFEA 4PA9A 3E2EA 1SETA 3A0RA 4LP8A 4GX5A 3OGCC 1OCZB 3ZMVA 3SYPA 2WLMA 3CCJV 3ABMC 3OMIB 4TT3G 3ZRWA 1GO3F 5IDJA 4RQEA 2IJJA 3OR7C 1CPYA 1R3KC 1K8AW 1CP9A 3CPWU 3K04A 4J9YB 2V7QG 2WLIB 2EIJB 2C2AA 4TWKA 1F51A 4WFBV 1WLEA 1KQSU 2WLLB 3ZRSA 3G4SV 4E2LA 4G2KA 3CCRV 2Q68A 1QVFU 1YITV 4BW5A 3CMEV 3GB7C 2EIKC 3B77A 4MVOA 3CXCU 2JIZG 4H37A 1FS0G 3K0GA 2HLDG 2DWDC 4KUMA 1M56B 1H2GA 4U7NA 2JK5C 3IC7A 4WFFA 2OCCB 2HG5C 1QLNA 2WLKA 4YXWG 3EHBB 1UJWB 1DF5A 2HKOA 3QNEA 1JCHA 4BIZA 1Y66A 4QPJA 5DM6V 3STLC 3F5WC 4JTAB 4N23A 2ZR2A 3FB7C 4RO2A 3SYQA 1YHQV 1VQ8V 2WLHA 4MVZA 2X0LA 4LC1A 3ZMSA 2X6AA 1DLBA 1R73A 5E1AC 5B1AC 3OEEG 5LGTA 5LGNA 3LSSA 1AJNA 4KFMA 4FJCC 2GHYA 4JTDB 1EZJA 3E35A 4PA4A 4MVUA 1ORQC 3TK1A 4PDMA 2YEVB 5EC1C 1NJIW 4UVBA 5L3DA 3I56V 3AG1C 1M9NA 2DWEC 3LUTB 1F4NA 3EFFK 3OAAG 1GKFA 2ZDIC 2EIMC 1Y4MA 3OMAB 3ZRWB 3BEHA 1FXHA 2ZQMA 2BOBC 1RM1B 2QTOA 5L3EA 3K79A 3FYEB 3STZC 3E8GA 4MTOA 2M7WA 3F7VC 2LFSA 1K73W 4MVSA 1GTOA 4CZZA 3I55V 1OCZC 5LHGA 1Q81W 1YTFB 2X7RB 1G8MA 2AHZA 4TSFG 4ZKIA 3K03A 3TETA 3CMAV 3AG3B 4DO2A 5B3SB 3FB5C 3HPLC 1FXKC 2EIJC 2B1GA 3ETDA 3LNMB 4UXNA 5LHIA 1M90W 3W7TA 1TUEB 3T4DA 2WLNA 5CBGA 1COWG 5BZBA 1Q7YW 1N8RW 5IYDO 4XDJA 2B5UA 1SERA 3QO7A 5IYBO 3OM3B 5EBMC 3PJSK 5HFMA 1SESA 4KP4A 4QIWF 1YJWV 3P30A 5L3BA 5CBHA 2JJ2G 1QR8A 3IGAC 1GM8A 2QE7G 2Y48A 2A79B 1M57B 2A0LA 4MTFA 2P6JA 1EBOA 1WPXA 1M56C 1S72V 2JEUA 1OZ0A 5EBLC 3RVZA 1RPOA 4HZ3A 1QVGU 3FKSG 1GK9A 3BY6A 1XL4A 1K92A 1MG1A 2OCCC 3E8FA 3MD0A 3LSQA 1FXKB 1GM9A 3VOUA 1VQ4V 1YJNV 5IY5B 1QLEB 4Z1MG 2JDIG 2BOCC 5L3CA 3W7SA 1OHHG 1JPXA 4HAMA 1K34A 1K4DC 1YTFD 3E8BA 4CBCA 1VQPV 5CMUA 5GW7A 5DN6G 1H8HG 2W0FC 1K33A 3JCZA 5B1OA 2CK3G 2WLJA 4UV8A 2W6IG 1K5SA 2EINB 3K9AA 3SYCA 2EILC 3OMNB 4FMTA 3SYAA 1E1RG 3P32A 3ZMTA 4JASA 4WFHA 4MT8A 4BIUA 4JF3A 1R3LC 3ZCCA 4JAVA 4X89A 3UKMA 1G4YB 1XL6A 4MVMA 3H01A 5LHHA 1VQ9V 1H8EG 3ZN0A 2IH1C 3RW0A 1BMFG 3ML0A 1VQ6V 1OCRC 2K1EA 3HB3B 4Q20A 3T1CA 3ZMUA 3JYCA 1PL0A 3D36A 2XOKG 3AEIA 2EBOA 1K9MW 1S77D 2ZDIA 1RM1C 3CCUV 1H38A 1P7BA 3LDEA 3W7XA 3ABKB 1W2BU 1PNKA 4ZBMA 4RAIA 3OUSA 2HR3A 3ZMZA 2EILB 1ZWIC 2EZPA 2DYSC 3ETEA 2IU0A 4WCEV 3AG4B 1FFTB 4GX0A 4MVRA 2IW5A 5H6RA 1KECA 1YI2V 3AG3C 3ABUA 5B1NA 5B3SC 1YIJV 1AI5A 1OCRB 1QBZA 1F23A 2X6BA 1AI4A 1THZA 3CCSV 1B6QA 4OXSA 4QNHB 3WG7B 2WWWA 3QO8A 2WLIA 4X8AA 1DTOA 2DYRC 2P7TC 2Q69A 2XAGA 2P67A 3FYIB 1OCOB 3ETGA 4R50A 1QQHA 1VQMV 2Q67A 2EZOA 2X6CA 4JTCB 3SPIA 1FXVA 4R6ZA 3M99B 4J9ZB 2DW4A 1PKXA 4P9PA 1M1KW 2Z5UA 2XAJA 4JPRA 4MW8A 3ZN1A 2HFEC 2FTKA 3MHSC 5KUKA 2D3OW 1M57C 5CN0A 5H9CA 2DYSB 3SPCA 4L87A 2UXNA 4UVCA 1VQOV 2MK3A 3OW2U 1SZTA 1I5YA 2OTJV 1NH2B 1YJ9V 3KG2A 1MABG 2OT5A 3AG2B 4PDLA 1DF4A 4FPPA 1BL8A 5IY5C 1NKDA 1QLEC 2IJHA 1AJPA 1Q82W 2DYRB 5L3GA 3ASNB 3SPJA 5HFLA 1I5XA 3E86A 1JQ0A 2DQ3A 1AI7A 3JD3A 4RUEA 3MHHC 2WAMA 1R6KA 3R65A 4G27B 2IJIA 3CP1A 1GM7A 1SRYA 3LDCA 1S0VA 5IYCO 4WFGA 3ABLB 2EINC 3JD0A 2IJKA 3SYOA 4LBEC 1V55B 1R6NA 5L3FA 3CCEV 3ASOB 3X2QB 3NXSA 2XAHA 3ZJZA 1R3JC 1RPRA 2HVKC 3OR6C 5KA6A 1QR9A 2H8PC 2NNUA 4PELA 1MSWD 4JAUA 4UV9A 3OUFA 4PA3A 1MOFA 2V1DA 2YEVA 1PD3A 2PI4A 4I5SA 1KP2A 1AI6A 2ZD9A 1KD1W 2Y69B 3K3WA 2HVJC 1JJ2U 4HYOA 1ROPA 2JEXA 3UM7A 3ZRXA 4UUJC 1JOYA 4UVAA 4GCZA 1NH2D 3B8NA 5EK0A 4ASUG 3K0DA 2ZXWB 1JX9A 2P90A 4X88A 3ABKC 1KP3A 1OCCB 1K3EA 2XASA 2YSUB 4P9OA 2PI5A 2GSMB 4JYBA 4PA6A 1AJQA 4QPKA 2ZR3A 4MVQA 4PDRA 5LGUA 4R8CA 3AG4C 2QA4V 4FK5C 2JJ1G 1KC8W 4JGSA 3E83A 1EFRG 4LCUC 3VBBA 1NQTA 3E89A 1VQLV 4GT1A 4XDLA 5B1BB 3OEHG 3WFVA 3WG7C 3RBZA 2XNDG 2NLJC 2Z3YA 3CCQV 4I9WA 2WPDG 4GX2A 5H6QA 4DXWA 1K4CC 1OCOC 4G28B 4JYCA 2R9IA 5CA3A 3F7YC 4MTXA 4R7CA 3QO5A 3TCUA 3ABMB 4XBFA 4RQFA 5KUMA 1S76D 3OFNG 2F43G 1JVMA 1AR1B 3CYOA 4MTGA 4MW3A 2R9RB 4MSWC 2AHYA 4FIPC 3K06A 3G71V 2Q6AA 1QCEA 3GWOA 3CC4V 3AG2C 1E1QG 1NBMG 3IFXA 1NR1A 3LDDA 4U7OA 1S5HC 3FB8C 1VQKV 3SPGA 1W0KG 1FXKA 2XAQA 4H33A 4P30A 3T4ZA 1BHAA 3CC2V 3E8HA 4WFAV 3ASNC 3OE7G 3ABTA 1VQ5V 2EIKB 3JD4A 3CCMV 3SJQC 2OTLV 2UXXA 4RUFA 1S3JA 1ENVA 1K5QA 1W0JG 1GMGA 2WLLA 1V54C 3SPHA 2KB1A 4QE7A 4EKWA 1K7DA 5FL7G 3JD2A 1NVPB 3CCLV 4P2ZA 3CCVV 1LNQA 3ABLC 1BHBA 1E79G 1V55C 4BAYA 5CBFA 3ASOC 3X2QC 3CD6V 3FB6C 4GX1A 3T2MA 4QE9A 3W7UA 1PNMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R6N A;  2JEX A;  1TUE B;  2JEU A;  1DTO A;  1QQH A;  1R6K A;  2NNU A; 
#chains in the Genus database with same CATH topology
 1J5E B;  1YSC A;  3DGE A;  4MS2 A;  2HJF C;  2Q0A A;  4XDK A;  4DV2 B;  1XI1 A;  4X62 B;  4DR1 O;  4CS4 A;  1PNL A;  5LBQ A;  2KG7 B;  4LF9 B;  2KSD A;  4WBN A;  2UU9 O;  1IXM A;  3JD1 A;  1CEZ A;  3G6E V;  1K97 A;  1R3I C;  2LFR A;  1OCC C;  3B8M A;  3FAV A;  1VQ7 V;  3HKB A;  3DXR B;  1VIB A;  4U3J A;  1VQN V;  1L1F A;  3JAL A;  2IU3 A;  3AG1 B;  2WSS G;  4N21 A;  2LGW A;  3ZIA G;  1Q86 W;  3IAY A;  4TQF A;  2UUB O;  4IIJ A;  5CA0 B;  3E2E A;  4YY3 B;  4DR5 O;  1HP8 A;  4LP8 A;  3WB2 A;  2UXD O;  1Z2G A;  4GYC B;  4RQE A;  2IJJ A;  3OR7 C;  3CPW U;  3K04 A;  4DK1 A;  2HEP A;  2V7Q G;  1U97 A;  4YIP A;  4WFB V;  1YZB A;  1J5E O;  1SQB H;  3ZRS A;  1FAF A;  3TXQ A;  1QU7 A;  3B2E E;  3CCR V;  1QVF U;  3CE2 A;  2Q5Z A;  2NN4 A;  4LF9 O;  1O9H A;  1TVK A;  2JIZ G;  4H37 A;  5IE9 A;  4KUM A;  5LMN B;  4X66 O;  1H2G A;  4U7N A;  2JK5 C;  4WFF A;  5KX5 B;  1Y67 A;  3H1K H;  2PYL A;  2QSA A;  4GKK B;  2QWO B;  1JCH A;  1FPO A;  1SS3 A;  5DM6 V;  4LF8 B;  5D5P A;  4B3T B;  2ZR2 A;  3FB7 C;  1HNX O;  4K3A A;  3SYQ A;  2YIA A;  4MVZ A;  1LUW A;  1N32 O;  2X6A A;  3K5M A;  5E1A C;  4TUY B;  1IX9 A;  3OEE G;  5LGN A;  3LSS A;  3Q4H B;  4FJC C;  2GHY A;  4IT5 A;  1B3Q A;  4IYI A;  4HBN A;  1M4U A;  5EC1 C;  4D7T A;  4K35 A;  3D36 C;  4NVP A;  1Q90 D;  2F1M A;  3CRQ A;  3AG1 C;  5LXT B;  2IBZ H;  1M93 A;  1Y4M A;  2XHB A;  2BOB C;  5LP6 B;  4O2B A;  2QGN A;  5GTH Z;  5L3E A;  5JH7 A;  1Y6X A;  3UT5 A;  3OT7 A;  1K73 W;  1MMM A;  4X1I B;  4FLU A;  4NXM B;  5LHG A;  5LMN O;  1RP3 B;  2VS0 A;  2FML A;  1TAE A;  3K03 A;  5H5N A;  2RN9 A;  2YC0 A;  4GKK O;  1M90 W;  3N2K B;  2CAZ C;  1ZAU A;  4PV1 B;  3PN1 A;  2JGD B;  2WLN A;  4IHJ B;  1N8R W;  3B40 A;  4DUZ O;  2CE4 A;  2QKA A;  3OM3 B;  4FM0 A;  5EYP B;  3PJS K;  1R6T A;  2PY5 A;  2AXT Z;  1BGY H;  2A79 B;  1M57 B;  2UUA B;  1WNS A;  2JEU A;  4EFB A;  3H1L H;  5EBL C;  1RPO A;  4LFC O;  3FKS G;  1GK9 A;  3BY6 A;  2JDI G;  4X1K B;  3W7S A;  1JPX A;  1XNQ B;  3E8B A;  5GW7 A;  2EX3 A;  1K33 A;  3JCZ A;  3WB1 A;  3N2G B;  4UV8 A;  1FFX B;  1MNG A;  2EIN B;  3SYA A;  3P32 A;  4BIU A;  2KG7 A;  4ZI7 B;  5KAF Z;  2PUS A;  3O9O A;  3RW0 A;  1BMF G;  1OCR C;  3DXR A;  1PL0 A;  3D36 A;  1UFI A;  2XOK G;  3AEI A;  3RYH B;  3HKE B;  1K9M W;  3CCU V;  5LP6 C;  3LDE A;  1WAZ A;  1W2B U;  2ILM A;  2EIL B;  3BA9 A;  3ZS8 C;  5CA0 A;  2UUA O;  1ZWI C;  4O4L B;  4J41 A;  3RFR A;  1SQG A;  3UCS C;  4K8X A;  5LYJ B;  2X6B A;  1AI4 A;  2RNB A;  1THZ A;  4H13 B;  1B6Q A;  4QNH B;  3WG7 B;  1KYO F;  2BE3 A;  3KKY A;  2Q69 A;  4I0X B;  1QQH A;  3ETG A;  2X6C A;  5KLV H;  1R1B A;  1SKV A;  1TUB B;  3SPI A;  1FXV A;  3M99 B;  1M1K W;  3M8A A;  4MW8 A;  4UCV A;  3MHS C;  4OPH A;  5IYZ B;  2XT9 A;  5KHI A;  1M57 C;  5DEC A;  1WN7 A;  4NKG B;  2MK3 A;  1G6U A;  4PDL A;  5KX5 A;  1XEQ A;  1BL8 A;  4OX9 O;  4KL1 A;  5EZY A;  2DYR B;  5HFL A;  1BQZ A;  2QDO A;  1I5X A;  4RUE A;  4PI0 A;  1AI7 A;  3JD3 A;  2ADQ B;  1R6K A;  4NTY A;  4G27 B;  4LF7 B;  1WB8 A;  2ZIO A;  2O57 A;  2EIN C;  4ICG A;  5IJ9 B;  4LBE C;  4DR3 B;  3CCE V;  4TUY A;  2XAH A;  3CEI A;  1R3J C;  2H8P C;  4FLZ A;  3Q4H A;  2LGQ A;  4CC6 A;  5BR8 B;  2ZM6 O;  3G6B A;  3OD4 A;  4I5S A;  1KP2 A;  4GLX A;  4YHH O;  2Y69 B;  1YEW A;  2JEX A;  5LXT A;  1W59 A;  4DV7 B;  4HNA A;  4UCR A;  4ASU G;  4W4L A;  4PHZ A;  2ZXW B;  4X88 A;  1IDS A;  2EUL A;  2XAS A;  5LP6 A;  4O4I A;  4JYB A;  4PA6 A;  4PDR A;  4JYA B;  4X1I A;  5JQG B;  1PPJ H;  1JFF B;  3E89 A;  4GT1 A;  3B4S A;  3VQV A;  4B7E A;  2E5L O;  3KCX A;  3WG7 C;  5CA1 B;  1ZX3 A;  2Z3Y A;  2W0X A;  4LWS B;  4I9W A;  4F6E A;  4DR2 B;  4LFB B;  4DXW A;  1K4C C;  4G28 B;  3N2K A;  1B04 A;  4JYC A;  2JGD A;  4IHJ A;  2Q7G A;  3F7Y C;  4MTX A;  3RWR D;  4LF7 O;  1XMO B;  5EYP A;  1S76 D;  3M7M X;  1H2S B;  4BR6 A;  2R9R B;  4MSW C;  2AHY A;  4FIP C;  1L0L H;  3K06 A;  1Y74 B;  3GWO A;  3RGB A;  3CC4 V;  3IFX A;  1URF A;  3LDD A;  4KHP B;  1BHA A;  4DV5 B;  1VAR A;  1VQ5 V;  2EIK B;  1Q5O A;  4X1K A;  1S3J A;  1NT2 B;  3SDL A;  1D5N A;  1V54 C;  1SQV H;  1A32 A;  2Q7H A;  3CCL V;  1WA8 B;  2LW7 A;  2E76 B;  1BHB A;  2EJ7 A;  3N2G A;  1FFX A;  5CBF A;  3CD6 V;  1S5L Z;  1KKC A;  1HNW B;  2F4V B;  4GX1 A;  3T2M A;  3JAT B;  4ZI7 A;  5KA5 A;  4DYL A;  2XAF A;  4O4J B;  4K0K B;  5J9P C;  4LFB O;  1HR0 B;  3K08 A;  2Y69 C;  2QM8 A;  2YXY A;  1IBK O;  4J11 A;  1HWY A;  2W6J G;  2YI8 A;  1L0N H;  3RYH A;  1YDX A;  3ZRV A;  3HKE A;  2ZXW C;  1XMO O;  2GBO A;  1EN5 A;  1EZV H;  1N34 B;  2A9H A;  2XTA A;  3D3I A;  1KU9 A;  4F4L A;  2QM7 A;  4O4L A;  2RCV A;  3SGI A;  3OGI B;  1DK1 A;  3DTU B;  1HW7 A;  3OTO B;  2FYU H;  2L35 A;  2EIM B;  5C93 A;  5LYJ A;  3AK1 A;  3MAQ A;  2ATK C;  3T1Y B;  2QEX V;  4DV5 O;  4WFE A;  3LSU A;  4PA9 A;  4E4E A;  1SET A;  1AIL A;  4I0X A;  5FPR A;  3U0Z A;  4GX5 A;  3OGC C;  3CRC A;  1TUB A;  4B08 A;  3CCJ V;  5IDJ A;  4FFB B;  4RWU A;  1R3K C;  2A06 H;  1XUQ A;  1IBM B;  2Y0P A;  2WLI B;  4B3R B;  5IYZ A;  3APO A;  2C2A A;  1HNW O;  1F51 A;  2F4V O;  1VEW A;  1O9G A;  3G4S V;  4E2L A;  4G2K A;  4I55 B;  4DR1 B;  1YIT V;  2Y4T A;  4BW5 A;  2ZE7 A;  4NTW A;  3GB7 C;  2EIK C;  1GH6 A;  1FS0 G;  2HLD G;  2DWD C;  3BVO A;  3IC7 A;  2AZ2 A;  2OCC B;  2WLK A;  4YXW G;  3EHB B;  2ZE6 A;  5IJ9 A;  1DF5 A;  2HKO A;  5ITZ B;  4O4H A;  3L74 H;  2ZCE A;  3STL C;  4N23 A;  4PD4 F;  4RO2 A;  4QGP A;  2UUB B;  1GN4 A;  4PJ0 Z;  2GV9 A;  3GWK C;  4LC1 A;  4DR5 B;  1R73 A;  2UXD B;  4I7Z B;  5LL6 Y;  1EZJ A;  3TK1 A;  4MVU A;  4PDM A;  2YEV B;  5JCO A;  2Y0I A;  1IBM O;  4B3R O;  4UVB A;  2YID A;  2E75 B;  1M9N A;  4JAA A;  1LUV A;  1SZX A;  3SR2 C;  4AQY O;  2EIM C;  4FZ1 A;  5JQG A;  2P06 A;  3ZRW B;  3RYC B;  1JFF A;  3BEH A;  2QTO A;  1HDJ A;  3STZ C;  5CA1 A;  3E8G A;  3CRM A;  4LWS A;  2OYQ A;  2R72 A;  1GTO A;  1NU1 H;  3DSQ A;  4X66 B;  1Q81 W;  2X7R B;  1G8M A;  1YTF B;  4BIO A;  3CMA V;  4AIL C;  3BAB A;  3HPL C;  1JJO A;  2PZS A;  1Q43 A;  1TUE B;  2ADP A;  3D3Q A;  1Q7Y W;  1JMK C;  5IYD O;  4XDJ A;  2B5U A;  1SER A;  1Y74 A;  1HNX B;  4QIW F;  3VQW A;  1YJW V;  4DRX B;  3P30 A;  5CBH A;  3LNN A;  5JVD B;  1N32 B;  1GM8 A;  2A0L A;  1EBO A;  1WPX A;  3RVZ A;  1QVG U;  1K92 A;  2OCC C;  4UFZ A;  2DMX A;  1PM9 A;  1GM9 A;  1WA8 A;  5EIB D;  1IZ3 A;  2Q73 A;  3T1H B;  1OHH G;  4HAM A;  1YTF D;  3JAT A;  1H8H G;  2W0F C;  5B1O A;  2CK3 G;  4O4J A;  1N4C A;  1SQX H;  3K9A A;  3SYC A;  3OMN B;  1E1R G;  2HP8 A;  3QTC A;  4JAS A;  4WFH A;  3UO2 A;  4JF3 A;  1R3L C;  1FKA O;  3ZCC A;  3JAM N;  5IJ0 B;  4X89 A;  3UKM A;  1XL6 A;  5LHH A;  2JGU A;  5GON B;  1FYJ A;  3JYC A;  1WP8 A;  4D6T H;  4DUZ B;  4GZR B;  3CX5 F;  2F95 B;  2UXB O;  5EIB C;  1PNK A;  3OUS A;  3UO3 A;  2CTP A;  2IU0 A;  4OGQ B;  3AG4 B;  4LFC B;  4Q6G A;  1FFT B;  2IW5 A;  4DV4 O;  5H6R A;  2VRZ A;  5B1N A;  1YIJ V;  4FFB A;  2Q8V A;  1OCR B;  4JI4 O;  4UCU A;  1GRJ A;  2HHH B;  5GTI Z;  2ZNI A;  1N0N A;  2WWW A;  3T1H O;  2WLI A;  4NR1 A;  4X8A A;  5JJN B;  1DTO A;  2P7T C;  2P67 A;  1AP6 A;  3A8T A;  4R50 A;  1VQM V;  2Q67 A;  2EZO A;  4JTC B;  1VP7 A;  2CH7 B;  1PKX A;  4P9P A;  2CUG A;  2F66 C;  4DV1 B;  4JI1 O;  4I55 A;  3O65 A;  5KUK A;  2BTQ B;  1X4T A;  3K57 A;  1BE3 H;  5CN0 A;  4L87 A;  4UB8 Z;  1YJ9 V;  1MAB G;  2OT5 A;  4DW0 A;  3JAR A;  4FPP A;  2JRI A;  2YDE A;  4J42 A;  5KHJ A;  5JJJ B;  2Q7E A;  4ZHQ B;  1US6 A;  5L3G A;  1H2L A;  5ITZ A;  2R70 A;  2QR4 A;  3E86 A;  5BXZ A;  1JQ0 A;  2DQ3 A;  3CS5 A;  3MHH C;  4CS2 A;  5BMV B;  5IYC O;  4B7K A;  2ZE8 A;  1V55 B;  3ASO B;  3X2Q B;  3NXS A;  3ZJZ A;  1RPR A;  3L73 H;  3OR6 C;  4Z2W A;  4PEL A;  1I94 O;  1TGO A;  4EB6 B;  4JAU A;  3OUF A;  2HHH O;  1MOF A;  2V1D A;  2YEV A;  2PI4 A;  3R66 A;  4FM1 A;  3UM7 A;  3ZRX A;  3N27 A;  4UVA A;  3B8N A;  2JS3 A;  5LMU B;  3RYC A;  2P90 A;  4DV1 O;  1KP3 A;  2YSU B;  1K3E A;  2YI9 A;  1H2N A;  3JAK B;  4MVQ A;  4DV0 O;  3AG4 C;  3KZI Z;  4CH6 A;  2QA4 V;  4Z1V A;  1BSM A;  4ABM A;  4XDL A;  5IWA O;  2H3O A;  3OEH G;  2N05 A;  4OX9 B;  2OIE A;  2WPD G;  2BCC H;  1MA1 A;  1H2K A;  3L71 H;  3GVM A;  4LH6 A;  4R7C A;  3B09 A;  3RT3 C;  3ABM B;  4XBF A;  3ZHS A;  4DRX A;  1AR1 B;  1JVM A;  5JVD A;  4MTG A;  2GTA A;  3S3X A;  1MZE A;  3H9V A;  1XIL A;  3ZHU A;  4I50 B;  1E1Q G;  2ZM6 B;  4U7O A;  3FB8 C;  1VQK V;  3T4Z A;  3IC9 A;  3E8H A;  4YHH B;  1D5A A;  3CCM V;  3SJQ C;  3CSX A;  3BPZ A;  4RUF A;  1NS1 A;  3ZBH A;  3SPH A;  4QE7 A;  3CHX A;  5LMU O;  5FL7 G;  4NTX A;  1NVP B;  4P2Z A;  3CRR A;  3VQY A;  3CCV V;  1V55 C;  3ASO C;  3X2Q C;  3FB6 C;  1PNM A;  1ZSP A;  5IJ0 A;  3AK2 A;  1JR9 A;  5EBW C;  2EJR A;  4QJF B;  3P3P A;  2E5L B;  4WF9 V;  1KKD A;  4X9Q A;  2B1I A;  3CC7 V;  1ARO P;  1F4M A;  4L8J A;  4NYK A;  4IGG A;  1ZL8 B;  1V54 B;  3ETQ A;  5B5E Z;  2ITD C;  2UUC O;  4CH5 A;  4PA7 A;  4D7S A;  1IVS A;  1HNZ B;  1J95 A;  2E3C A;  2ZIN A;  4PDV A;  1N0J A;  2AW9 A;  1PV0 A;  2LW1 A;  1NVP D;  4LNU B;  3DC6 A;  3L70 H;  1RSO B;  3BFR A;  1AR4 A;  2B9Z A;  3A0R A;  1OCZ B;  3ABM C;  3OMI B;  1GO3 F;  2CH7 A;  1KMI Z;  2YXH A;  1CPY A;  1K8A W;  1CP9 A;  3K5O A;  4J9Y B;  4FZ0 A;  2N04 A;  3DC5 A;  4UCO A;  4TWK A;  4UCT A;  2BTQ A;  1PL4 A;  4I9Q A;  2QWR B;  2WLL B;  3JCU Z;  3A2F A;  2ARH A;  4DV6 B;  3CME V;  3FFQ A;  4MVO A;  1IBK B;  2GDS A;  1YF2 A;  1M56 B;  1YVW A;  3ZED A;  5LA6 B;  2HG5 C;  1QLN A;  1Y76 B;  1HNZ O;  3E22 B;  2XUM A;  1Z5W A;  4W4K A;  4JTA B;  5LOV B;  1YHQ V;  4EB6 A;  1VQ8 V;  2WLH A;  2ZE5 A;  5J2U B;  2X0L A;  1DLB A;  1FJG O;  1I08 A;  4BW9 A;  1AB3 A;  5B66 Z;  1AJN A;  3D8C A;  1XRE A;  1ORQ C;  4LR3 A;  4JI0 O;  1NJI W;  2OIG A;  3JAS B;  3JAK A;  4IIJ B;  2WA4 A;  2ZT9 B;  3S3W A;  4ZIB A;  3I56 V;  2QJ1 A;  2YIC A;  3LUT B;  2ZDI C;  3QF7 A;  3EXA A;  1FXH A;  2ZQM A;  1OV9 A;  5J2T B;  2PF4 E;  3FYE B;  4DV6 O;  1KB9 F;  2M7W A;  3F7V C;  3I55 V;  3K5L A;  2PYJ A;  1OCZ C;  5A2Q N;  1DGS A;  4CH3 A;  1XBL A;  4JI3 B;  2UXC B;  1FXK C;  3JSL A;  3LNM B;  3ETD A;  5LHI A;  3ICX A;  3W7T A;  3T4D A;  5CBG A;  5BZB A;  1I7F A;  2RQ6 A;  2P4K A;  5IYB O;  4I50 A;  5HFM A;  1SES A;  4KP4 A;  4GKJ O;  4U3F H;  4JV5 B;  3QG5 A;  5JWP A;  3IGA C;  2QE7 G;  1YCI A;  1M56 C;  3ZX6 A;  5CB4 B;  1VF5 B;  1MG1 A;  3E8F A;  3LSQ A;  4FFK A;  1NTM H;  4JYY A;  5C8Y B;  1YJN V;  5IY5 B;  2ODM A;  1QLE B;  4LH7 A;  2BOC C;  1GN3 A;  4AQY B;  1K34 A;  1K4D C;  4JI5 B;  4CBC A;  1VQP V;  2OWO A;  4X64 B;  5CMU A;  3WU2 Z;  1IBL O;  4MT8 A;  1VF6 C;  4JAV A;  4B3M O;  1ZL8 A;  2GTS A;  1VQ9 V;  5KHK A;  4JI3 O;  3ZHV A;  3ML0 A;  2UXC O;  2K1E A;  1SA0 B;  3HB3 B;  4Q20 A;  2RMK B;  1BCC H;  3HKC B;  1WJZ A;  1XNR O;  3J80 N;  3OTF A;  2ZDI A;  3F5T A;  2Z0A A;  4LNU A;  4JV5 O;  4B3S B;  4ZBM A;  1X59 A;  4AHC A;  2HR3 A;  1RSO A;  3K5N A;  2EZP A;  2DYS C;  3ETE A;  4WCE V;  4BWA A;  4GX0 A;  3FD9 A;  1KUQ A;  1T5E A;  4JZ2 A;  1YI2 V;  1AVM A;  2FB5 A;  2JVD A;  1F23 A;  1Q6U A;  3CCS V;  4JI8 O;  4DR7 O;  2CGN A;  1BQ0 A;  3HKD B;  5AG2 A;  2F93 B;  4JI5 O;  4R6Z A;  4J9Z B;  1WPB A;  4X64 O;  2DW4 A;  2F23 A;  2Z5U A;  3BAA A;  2HFE C;  3U10 A;  2D3O W;  2QTS A;  4X1Y B;  5H9C A;  3P3N A;  2UXN A;  1WP7 A;  3OW2 U;  1I5Y A;  2LQT A;  3AG2 B;  2G38 A;  5LA6 A;  5IY5 C;  1NKD A;  1QLE C;  2IJH A;  1Y76 A;  1AJP A;  3G80 A;  3E22 A;  3SPJ A;  3C3S A;  2IJI A;  2UXB B;  1GM7 A;  1SRY A;  5LOV A;  4B3S O;  1S0V A;  5KHG A;  5J2U A;  3SYO A;  5L3F A;  1VF6 A;  2KQX A;  1VMG A;  2NNU A;  4DV4 B;  1MZF A;  1NTK H;  1MSW D;  3J81 N;  4JI4 B;  4UV9 A;  1YXB A;  2A7W A;  4PA3 A;  4JI6 B;  1BT8 A;  3C90 A;  2DOS A;  3JAS A;  1AI6 A;  2ZD9 A;  1KD1 W;  3K3W A;  2HVJ C;  4HYO A;  4DK0 A;  4UUJ C;  1UPG A;  1JOY A;  3K59 A;  2LJ2 A;  2RJZ A;  3K0D A;  4JI1 B;  4P9O A;  1B06 A;  4NB5 A;  5J2T A;  2GSM B;  1AJQ A;  4QPK A;  2ZR3 A;  2JS5 A;  5LGU A;  1Q6I A;  2QWN B;  4R8C A;  1Q3E A;  4FK5 C;  2JJ1 G;  4JGS A;  3E83 A;  1EFR G;  4LCU C;  4DUY B;  4DV2 O;  5B1B B;  1M5I A;  4OPA A;  3WFV A;  4X62 O;  1SQQ H;  3RBZ A;  2XND G;  3J7A U;  2NLJ C;  3CCQ V;  2AGA A;  1V9P A;  4TV9 B;  4GUN A;  4DR6 B;  3QO5 A;  1ZUQ A;  2VWK A;  5KUM A;  5FNV B;  3OFN G;  1EN4 A;  2F43 G;  5EZY B;  1NTZ H;  3CYO A;  3G71 V;  3IJ4 A;  2Q6A A;  1QCE A;  1I94 B;  3ZHQ A;  3AG2 C;  1AR5 A;  1NR1 A;  5CB4 A;  1S5H C;  2ZKO A;  4JI6 O;  3SPG A;  1W0K G;  4H33 A;  2XAQ A;  1P49 A;  5C8Y A;  2CDY A;  1QQC A;  4FLW A;  3ABT A;  4YY3 O;  2OTL V;  4X20 B;  1K5Q A;  1GMG A;  2KB1 A;  3C3T A;  3BHP A;  4EKW A;  1K7D A;  2R9A A;  3L9D A;  4A5U B;  3JD2 A;  1XOU A;  3L75 H;  1PP9 H;  1LNQ A;  3A0H Z;  1AP5 A;  4DV0 B;  1Z5V A;  2VWJ A;  4YJ3 B;  1P84 F;  4QE9 A;  2V4D A;  2RDC A;  4HNA B;  4DUY O;  1P4R A;  5D5Q A;  5IWA B;  3VQX A;  3W7W A;  1SF9 A;  1NR7 A;  1SA0 A;  2DQ0 A;  4O4I B;  4YIO A;  4J7K A;  2ITC C;  2WA3 A;  5B1A B;  4DR6 O;  3HKC A;  1L8D A;  3CJH B;  3TJT A;  2IH3 C;  3RVY A;  5F2V O;  3L72 H;  2LP7 A;  4J7J A;  2H94 A;  5KAI Z;  3JAW B;  3MDS A;  2ZIM A;  4J7Z A;  1EN6 A;  2QKS A;  3RYI B;  4LF8 O;  4JZG A;  2IM9 A;  4B3T O;  5B1B C;  5EC2 C;  1XQ8 A;  3SJC C;  1QNM A;  4FLT A;  3HKD A;  1GN6 A;  3ZMV A;  3SYP A;  2WLM A;  2Y4U A;  4TT3 G;  3ZRW A;  5E79 Z;  4NXN B;  5KMG B;  4JI2 B;  2D2C B;  2YUA A;  2L6L A;  5TIS Z;  4DR4 B;  4TV8 B;  2EIJ B;  2YXL A;  2BSK B;  4UB6 Z;  4X1Y A;  1WLE A;  4I4T B;  1KQS U;  4F6R B;  4JI7 B;  3SJA C;  2CTW A;  3K58 A;  1SQF A;  2Q68 A;  5K1X A;  1H2M A;  4FVM A;  1BS3 A;  4FLV A;  3WB0 A;  3B77 A;  2P22 C;  2Q4P A;  4CH4 A;  2HJD A;  3CXC U;  1IXB A;  3K0G A;  3AK3 A;  2M6Y A;  4NXM O;  1GAX A;  2UUC B;  1IUR A;  1UJW B;  3QNE A;  2GUZ B;  4BIZ A;  1Y66 A;  4QPJ A;  1BZK A;  3F5W C;  4X65 B;  3H1J H;  1D2D A;  3RYF B;  1WB7 A;  3ZMS A;  3H1H H;  5B1A C;  3K9S A;  1ZLZ A;  4IL6 Z;  5LGT A;  4KFM A;  2DJV A;  4NXN O;  4AI8 A;  4JTD B;  3E35 A;  4PA4 A;  4JI2 O;  3A0B Z;  2CTQ A;  4DR4 O;  3ZHT A;  2A3Q A;  5L3D A;  2Q9L A;  2DWE C;  5FPO A;  1KBH A;  4JI7 O;  1F4N A;  3EFF K;  1XNQ O;  1VF7 A;  3OAA G;  1GKF A;  2E74 B;  3OMA B;  4FLX A;  1RM1 B;  1OJH A;  5GON A;  1QHT A;  3K79 A;  4MTO A;  3SJB C;  1MSD A;  5FLX N;  2LFS A;  4TV9 A;  4MVS A;  4CZZ A;  2ETN A;  3CXH F;  2AHZ A;  4TSF G;  2DN9 A;  4ZKI A;  2BTO A;  3NR7 A;  3TET A;  3AG3 B;  4DO2 A;  4DW1 A;  3FB5 C;  5B3S B;  5FNV A;  5JJE B;  4O2A B;  2EIJ C;  2B1G A;  4UXN A;  1SC5 B;  2FKX A;  4YJ2 B;  1COW G;  1XDC A;  3QO7 A;  4X65 O;  4ZOL B;  5EBM C;  3KCY A;  4J80 A;  5K1P A;  5L3B A;  2JJ2 G;  1QR8 A;  1FJG B;  2VQE B;  2Y48 A;  3CWB H;  4MTF A;  4O4H B;  3BCC H;  3H1I H;  2P6J A;  3CB2 A;  4H0L B;  1SQP H;  1S72 V;  4X20 A;  1OZ0 A;  4HZ3 A;  1XL4 A;  3RN4 A;  2NR5 A;  4CS3 A;  4J10 A;  3MD0 A;  2PGG A;  1FXK B;  2DE0 X;  3VOU A;  1VQ4 V;  4JI0 B;  1GN2 A;  4Z1M G;  5L3C A;  4YJ3 A;  3QVN A;  2CGO A;  2MW2 B;  4EEQ A;  1TA8 A;  3UQ8 A;  5DN6 G;  2WLJ A;  2W6I G;  1K5S A;  2VQF B;  4ZHQ A;  2EIL C;  3APQ A;  4FMT A;  3ZMT A;  3TGU H;  2YS8 A;  1G4Y B;  4MVM A;  3H01 A;  5IT9 N;  3CJH A;  1H8E G;  3ZN0 A;  2IH1 C;  2YIB D;  1VQ6 V;  5BMV A;  1N33 B;  3T1C A;  3JAW A;  3ZMU A;  4LF5 B;  4DV3 B;  2ZNJ A;  1S5J A;  4LFA B;  3BA8 A;  4WBN B;  4K8Z A;  2EBO A;  3RYI A;  1S77 D;  1RM1 C;  1H38 A;  1N36 B;  4GKJ B;  3FAV B;  1P7B A;  3W7X A;  1RFY A;  1EM1 A;  3ABK B;  3HKB B;  3JSN A;  4RAI A;  3ZMZ A;  2VQE O;  1Q8I A;  4U3J B;  1NI8 A;  1XHZ A;  4DR3 O;  3JAL B;  1Q6H A;  3THO A;  1XHX A;  4MVR A;  1KEC A;  3AG3 C;  3ABU A;  5B3S C;  1AI5 A;  1QBZ A;  5KMG A;  5BR8 O;  2QM4 A;  1F7Y A;  4EFE A;  4OXS A;  3QO8 A;  4TV8 A;  3AG7 A;  3FYI B;  2DYR C;  2XAG A;  2AZ0 A;  1OCO B;  2BSK A;  3G67 A;  1JA8 A;  4I4T A;  3U11 A;  4F6R A;  4DV7 O;  3CRA A;  2XAJ A;  4JPR A;  3ZN1 A;  2FTK A;  2OCH A;  2VQF O;  3TXS A;  1P7G A;  1IBL B;  2DYS B;  3SPC A;  5BY1 A;  4JYA O;  4B3M B;  4UVC A;  1VQO V;  2P4V A;  1SZT A;  3I5D A;  2OTJ V;  1NH2 B;  3HR0 A;  3KG2 A;  4UCS A;  1N33 O;  1DF4 A;  1I0H A;  2K9P A;  4LF5 O;  4DV3 O;  4LFA O;  4DR2 O;  1Q82 W;  1CXZ B;  3ASN B;  1TVK B;  2GUZ A;  3FX7 A;  3BRC A;  1XNR B;  2WAM A;  3R65 A;  3ZHR A;  1N36 O;  3CP1 A;  5JCO C;  3LDC A;  4WFG A;  3ABL B;  3JD0 A;  2P5O A;  2IJK A;  3RYF A;  1R6N A;  2HVK C;  5KA6 A;  1QR9 A;  4LF4 B;  3EVK A;  4JI8 B;  4DR7 B;  1PD3 A;  4KHP O;  4TQD A;  1G1X B;  4LF6 B;  1JJ2 U;  1ROP A;  5A9G A;  4IYH A;  1NH2 D;  4GCZ A;  5EK0 A;  1JX9 A;  1XMQ B;  3ABK C;  1OCC B;  5DED A;  2PI5 A;  5KHH A;  2QKC A;  4C7U A;  1KC8 W;  4PI2 A;  3VBB A;  2Q0O C;  1NQT A;  1VQL V;  4O2B B;  4FM2 A;  5JH7 B;  4K0K O;  5H2F Z;  4O2A A;  3UT5 B;  4GX2 A;  5H6Q A;  1HR0 O;  1OCO C;  2FL4 A;  4YJ2 A;  2R9I A;  5CA3 A;  2UU9 B;  2LO1 A;  3TCU A;  4CC5 A;  4RQF A;  4ZOL A;  4FLY A;  2YIB A;  3JAR B;  1N34 O;  4TOI A;  2CTR A;  4MW3 A;  2KKW A;  4H44 B;  1U96 A;  4LF4 O;  3OTO O;  1NBM G;  2QWQ B;  1FXK A;  4P30 A;  3CC2 V;  3T1Y O;  4WFA V;  2QWP B;  3ASN C;  3OE7 G;  4LF6 O;  3JD4 A;  1FD9 A;  2UXX A;  1LR1 A;  1NZ6 A;  1ENV A;  1W0J G;  2WLL A;  2N74 A;  4KXR A;  1XMQ O;  3ABL C;  1ZTE A;  1E79 G;  4BAY A;  3W7U A;  2PTM A; 
#chains in the Genus database with same CATH homology
 1YSC A;  3DGE A;  5KA5 A;  4MS2 A;  2HJF C;  1P4R A;  2XAF A;  4XDK A;  4QJF B;  5EBW C;  2EJR A;  3W7W A;  1KKD A;  4WF9 V;  1NR7 A;  2DQ0 A;  5J9P C;  1PNL A;  2B1I A;  3CC7 V;  2ITC C;  3K08 A;  1ARO P;  1F4M A;  2Y69 C;  5LBQ A;  2QM8 A;  5B1A B;  1HWY A;  1IXM A;  2W6J G;  3JD1 A;  1CEZ A;  1V54 B;  3G6E V;  3ZRV A;  1K97 A;  1R3I C;  2IH3 C;  2ITD C;  2LFR A;  2ZXW C;  3RVY A;  1OCC C;  3B8M A;  2LP7 A;  1VQ7 V;  2H94 A;  4PA7 A;  2A9H A;  3D3I A;  4F4L A;  1VQN V;  1L1F A;  1J95 A;  2QM7 A;  2IU3 A;  3AG1 B;  4PDV A;  2QKS A;  3DTU B;  2WSS G;  4N21 A;  2EIM B;  3ZIA G;  5C93 A;  1NVP D;  1Q86 W;  5B1B C;  5EC2 C;  2ATK C;  2QEX V;  4WFE A;  4PA9 A;  3E2E A;  1SET A;  3A0R A;  4LP8 A;  4GX5 A;  3OGC C;  1OCZ B;  3ZMV A;  3SYP A;  2WLM A;  3CCJ V;  3ABM C;  3OMI B;  4TT3 G;  3ZRW A;  1GO3 F;  5IDJ A;  4RQE A;  2IJJ A;  3OR7 C;  1CPY A;  1R3K C;  1K8A W;  1CP9 A;  3CPW U;  3K04 A;  4J9Y B;  2V7Q G;  2WLI B;  2EIJ B;  2C2A A;  4TWK A;  1F51 A;  4WFB V;  1WLE A;  1KQS U;  2WLL B;  3ZRS A;  3G4S V;  4E2L A;  4G2K A;  3CCR V;  2Q68 A;  1QVF U;  1YIT V;  4BW5 A;  3CME V;  3GB7 C;  2EIK C;  3B77 A;  4MVO A;  3CXC U;  2JIZ G;  4H37 A;  1FS0 G;  3K0G A;  2HLD G;  2DWD C;  4KUM A;  1M56 B;  1H2G A;  4U7N A;  2JK5 C;  3IC7 A;  4WFF A;  2OCC B;  2HG5 C;  1QLN A;  2WLK A;  4YXW G;  3EHB B;  1UJW B;  1DF5 A;  2HKO A;  3QNE A;  1JCH A;  4BIZ A;  1Y66 A;  4QPJ A;  5DM6 V;  3STL C;  3F5W C;  4JTA B;  4N23 A;  2ZR2 A;  3FB7 C;  4RO2 A;  3SYQ A;  1YHQ V;  1VQ8 V;  2WLH A;  4MVZ A;  2X0L A;  4LC1 A;  3ZMS A;  2X6A A;  1DLB A;  1R73 A;  5E1A C;  5B1A C;  3OEE G;  5LGT A;  5LGN A;  3LSS A;  1AJN A;  4KFM A;  4FJC C;  2GHY A;  4JTD B;  1EZJ A;  3E35 A;  4PA4 A;  4MVU A;  1ORQ C;  3TK1 A;  4PDM A;  2YEV B;  5EC1 C;  1NJI W;  4UVB A;  5L3D A;  3I56 V;  3AG1 C;  1M9N A;  2DWE C;  3LUT B;  1F4N A;  3EFF K;  3OAA G;  1GKF A;  2ZDI C;  2EIM C;  1Y4M A;  3OMA B;  3ZRW B;  3BEH A;  1FXH A;  2ZQM A;  2BOB C;  1RM1 B;  2QTO A;  5L3E A;  3K79 A;  3FYE B;  3STZ C;  3E8G A;  4MTO A;  2M7W A;  3F7V C;  2LFS A;  1K73 W;  4MVS A;  1GTO A;  4CZZ A;  3I55 V;  1OCZ C;  5LHG A;  1Q81 W;  1YTF B;  2X7R B;  1G8M A;  2AHZ A;  4TSF G;  4ZKI A;  3K03 A;  3TET A;  3CMA V;  3AG3 B;  4DO2 A;  5B3S B;  3FB5 C;  3HPL C;  1FXK C;  2EIJ C;  2B1G A;  3ETD A;  3LNM B;  4UXN A;  5LHI A;  1M90 W;  3W7T A;  1TUE B;  3T4D A;  2WLN A;  5CBG A;  1COW G;  5BZB A;  1Q7Y W;  1N8R W;  5IYD O;  4XDJ A;  2B5U A;  1SER A;  3QO7 A;  5IYB O;  3OM3 B;  5EBM C;  3PJS K;  5HFM A;  1SES A;  4KP4 A;  4QIW F;  1YJW V;  3P30 A;  5L3B A;  5CBH A;  2JJ2 G;  1QR8 A;  3IGA C;  1GM8 A;  2QE7 G;  2Y48 A;  2A79 B;  1M57 B;  2A0L A;  4MTF A;  2P6J A;  1EBO A;  1WPX A;  1M56 C;  1S72 V;  2JEU A;  1OZ0 A;  5EBL C;  3RVZ A;  1RPO A;  4HZ3 A;  1QVG U;  3FKS G;  1GK9 A;  3BY6 A;  1XL4 A;  1K92 A;  1MG1 A;  2OCC C;  3E8F A;  3MD0 A;  3LSQ A;  1FXK B;  1GM9 A;  3VOU A;  1VQ4 V;  1YJN V;  5IY5 B;  1QLE B;  4Z1M G;  2JDI G;  2BOC C;  5L3C A;  3W7S A;  1OHH G;  1JPX A;  4HAM A;  1K34 A;  1K4D C;  1YTF D;  3E8B A;  4CBC A;  1VQP V;  5CMU A;  5GW7 A;  5DN6 G;  1H8H G;  2W0F C;  1K33 A;  3JCZ A;  5B1O A;  2CK3 G;  2WLJ A;  4UV8 A;  2W6I G;  1K5S A;  2EIN B;  3K9A A;  3SYC A;  2EIL C;  3OMN B;  4FMT A;  3SYA A;  1E1R G;  3P32 A;  3ZMT A;  4JAS A;  4WFH A;  4MT8 A;  4BIU A;  4JF3 A;  1R3L C;  3ZCC A;  4JAV A;  4X89 A;  3UKM A;  1G4Y B;  1XL6 A;  4MVM A;  3H01 A;  5LHH A;  1VQ9 V;  1H8E G;  3ZN0 A;  2IH1 C;  3RW0 A;  1BMF G;  3ML0 A;  1VQ6 V;  1OCR C;  2K1E A;  3HB3 B;  4Q20 A;  3T1C A;  3ZMU A;  3JYC A;  1PL0 A;  3D36 A;  2XOK G;  3AEI A;  2EBO A;  1K9M W;  1S77 D;  2ZDI A;  1RM1 C;  3CCU V;  1H38 A;  1P7B A;  3LDE A;  3W7X A;  3ABK B;  1W2B U;  1PNK A;  4ZBM A;  4RAI A;  3OUS A;  2HR3 A;  3ZMZ A;  2EIL B;  1ZWI C;  2EZP A;  2DYS C;  3ETE A;  2IU0 A;  4WCE V;  3AG4 B;  1FFT B;  4GX0 A;  4MVR A;  2IW5 A;  5H6R A;  1KEC A;  1YI2 V;  3AG3 C;  3ABU A;  5B1N A;  5B3S C;  1YIJ V;  1AI5 A;  1OCR B;  1QBZ A;  1F23 A;  2X6B A;  1AI4 A;  1THZ A;  3CCS V;  1B6Q A;  4OXS A;  4QNH B;  3WG7 B;  2WWW A;  3QO8 A;  2WLI A;  4X8A A;  1DTO A;  2DYR C;  2P7T C;  2Q69 A;  2XAG A;  2P67 A;  3FYI B;  1OCO B;  3ETG A;  4R50 A;  1QQH A;  1VQM V;  2Q67 A;  2EZO A;  2X6C A;  4JTC B;  3SPI A;  1FXV A;  4R6Z A;  3M99 B;  4J9Z B;  2DW4 A;  1PKX A;  4P9P A;  1M1K W;  2Z5U A;  2XAJ A;  4JPR A;  4MW8 A;  3ZN1 A;  2HFE C;  2FTK A;  3MHS C;  5KUK A;  2D3O W;  1M57 C;  5CN0 A;  5H9C A;  2DYS B;  3SPC A;  4L87 A;  2UXN A;  4UVC A;  1VQO V;  2MK3 A;  3OW2 U;  1SZT A;  1I5Y A;  2OTJ V;  1NH2 B;  1YJ9 V;  3KG2 A;  1MAB G;  2OT5 A;  3AG2 B;  4PDL A;  1DF4 A;  4FPP A;  1BL8 A;  5IY5 C;  1NKD A;  1QLE C;  2IJH A;  1AJP A;  1Q82 W;  2DYR B;  5L3G A;  3ASN B;  3SPJ A;  5HFL A;  1I5X A;  3E86 A;  1JQ0 A;  2DQ3 A;  1AI7 A;  3JD3 A;  4RUE A;  3MHH C;  2WAM A;  1R6K A;  3R65 A;  4G27 B;  2IJI A;  3CP1 A;  1GM7 A;  1SRY A;  3LDC A;  1S0V A;  5IYC O;  4WFG A;  3ABL B;  2EIN C;  3JD0 A;  2IJK A;  3SYO A;  4LBE C;  1V55 B;  1R6N A;  5L3F A;  3CCE V;  3ASO B;  3X2Q B;  3NXS A;  2XAH A;  3ZJZ A;  1R3J C;  1RPR A;  2HVK C;  3OR6 C;  5KA6 A;  1QR9 A;  2H8P C;  2NNU A;  4PEL A;  1MSW D;  4JAU A;  4UV9 A;  3OUF A;  4PA3 A;  1MOF A;  2V1D A;  2YEV A;  1PD3 A;  2PI4 A;  4I5S A;  1KP2 A;  1AI6 A;  2ZD9 A;  1KD1 W;  2Y69 B;  3K3W A;  2HVJ C;  1JJ2 U;  4HYO A;  1ROP A;  2JEX A;  3UM7 A;  3ZRX A;  4UUJ C;  1JOY A;  4UVA A;  4GCZ A;  1NH2 D;  3B8N A;  5EK0 A;  4ASU G;  3K0D A;  2ZXW B;  1JX9 A;  2P90 A;  4X88 A;  3ABK C;  1KP3 A;  1OCC B;  1K3E A;  2XAS A;  2YSU B;  4P9O A;  2PI5 A;  2GSM B;  4JYB A;  4PA6 A;  1AJQ A;  4QPK A;  2ZR3 A;  4MVQ A;  4PDR A;  5LGU A;  4R8C A;  3AG4 C;  2QA4 V;  4FK5 C;  2JJ1 G;  1KC8 W;  4JGS A;  3E83 A;  1EFR G;  4LCU C;  3VBB A;  1NQT A;  3E89 A;  1VQL V;  4GT1 A;  4XDL A;  5B1B B;  3OEH G;  3WFV A;  3WG7 C;  3RBZ A;  2XND G;  2NLJ C;  2Z3Y A;  3CCQ V;  4I9W A;  2WPD G;  4GX2 A;  5H6Q A;  4DXW A;  1K4C C;  1OCO C;  4G28 B;  4JYC A;  2R9I A;  5CA3 A;  3F7Y C;  4MTX A;  4R7C A;  3QO5 A;  3TCU A;  3ABM B;  4XBF A;  4RQF A;  5KUM A;  1S76 D;  3OFN G;  2F43 G;  1JVM A;  1AR1 B;  3CYO A;  4MTG A;  4MW3 A;  2R9R B;  4MSW C;  2AHY A;  4FIP C;  3K06 A;  3G71 V;  2Q6A A;  1QCE A;  3GWO A;  3CC4 V;  3AG2 C;  1E1Q G;  1NBM G;  3IFX A;  1NR1 A;  3LDD A;  4U7O A;  1S5H C;  3FB8 C;  1VQK V;  3SPG A;  1W0K G;  1FXK A;  2XAQ A;  4H33 A;  4P30 A;  3T4Z A;  1BHA A;  3CC2 V;  3E8H A;  4WFA V;  3ASN C;  3OE7 G;  3ABT A;  1VQ5 V;  2EIK B;  3JD4 A;  3CCM V;  3SJQ C;  2OTL V;  2UXX A;  4RUF A;  1S3J A;  1ENV A;  1K5Q A;  1W0J G;  1GMG A;  2WLL A;  1V54 C;  3SPH A;  2KB1 A;  4QE7 A;  4EKW A;  1K7D A;  5FL7 G;  3JD2 A;  1NVP B;  3CCL V;  4P2Z A;  3CCV V;  1LNQ A;  3ABL C;  1BHB A;  1E79 G;  1V55 C;  4BAY A;  5CBF A;  3ASO C;  3X2Q C;  3CD6 V;  3FB6 C;  4GX1 A;  3T2M A;  4QE9 A;  3W7U A;  1PNM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...