1DTOA

Crystal structure of the complete transactivation domain of e2 protein from the human papillomavirus type 16
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
202
structure length
200
Chain Sequence
HMETLCQRLNVCQDKILTHYENDSTDLRDHIDYWKHMRLECAIYYKAREMGFKHINHQVVPTLAVSKNKALQAIELQLTLETIYNSQYSNEKWTLQDVSLEVYLTAPTGCIKKHGYTVEVQFDGDNTMHYTNWTHIYICEEASVTVVEGQVDYYGLYYVHEGIRTYFVQFKDDAEKYSKNKVWEVHAGGQVILCPTSVFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the intact transactivation domain of the human papillomavirus E2 protein.
pubmed doi rcsb
source organism Human papillomavirus type 16
molecule tags Viral protein
molecule keywords REGULATORY PROTEIN E2
total genus 63
structure length 200
sequence length 202
ec nomenclature
pdb deposition date 2000-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00508 PPV_E2_N E2 (early) protein, N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.30 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1dtoA01
2.170.200.10 Mainly Beta Beta Complex Regulatory Protein E2; Chain: A; Domain 2 Regulatory Protein E2; Chain: A; Domain 2 1dtoA02
1R6KA 2JEXA 1TUEB 2NNUA 1R6NA 2JEUA 1DTOA 1QQHA
chains in the Genus database with same CATH superfamily
4EB6A 1FFXA 3TCUA 1KP3A 1IBLO 3BEHA 4LC1A 3S3WA 4JTAB 2DE0X 3I5DA 3SR2C 1JMKC 2Q69A 1NBMG 1EM1A 3AK2A 3OFNG 5FPOA 1HNXB 4IHJB 3WG7B 3W7WA 4JGSA 1SF9A 1BS3A 1FFTB 1P7GA 4B3TB 1PP9H 2ZDIA 1OHHG 1MZEA 3UO2A 2OIEA 3E8GA 4ZIBA 4GX1A 1RSOA 4QE7A 1VQ8V 4LF6B 1XL4A 4LP8A 1H2NA 1ROPA 4IIJB 3BCCH 3J81N 2P4KA 5BR8B 1SQQH 1YTFD 5L3FA 3L75H 4UUJC 4JAVA 2G38A 3E89A 1IBMO 1RM1B 2QKCA 2B1GA 1OCOC 2Q7HA 2HFEC 5DN6G 3Q4HA 2GV9A 1N0JA 4FFBA 3T2MA 4D7SA 2UXBO 4JASA 5IE9A 5KAIZ 3ZMVA 1GTOA 1NTZH 2PF4E 2W0FC 4OGQB 1K3EA 4TV8B 2OCCC 2WWWA 3TK1A 2Y4TA 2YXYA 4GX5A 3HKDA 3ZHUA 2ZE7A 4LF9O 5JQGA 1H2KA 5J2TA 4R50A 1OCRC 5IDJA 4CBCA 5L3BA 3RYCB 1XQ8A 4MVQA 2OTJV 4NB5A 4X62O 3VBBA 4IGGA 4FZ1A 3SYQA 3VQYA 2WLLB 4BIUA 5LXTB 1O9GA 1QR8A 4MT8A 1M5IA 4HNAB 4NVPA 5BMVB 1J5EO 1N32O 1Y76A 2F66C 3ZEDA 1XMOB 1VIBA 4X1KA 2DW4A 4H44B 1AJPA 1JFFA 1SESA 2CDYA 1OCZC 4GKKB 2UXDO 1H2MA 5C93A 5D5PA 5KLVH 4DUZO 4XDLA 2EIJB 2DQ3A 4DR2O 4JI2O 2NNUA 3CC4V 3C90A 1Q6HA 3IC9A 5BXZA 2JGDA 3FYEB 4YY3B 4KXRA 3ZHRA 2VWKA 1MA1A 2P06A 2EZPA 5IJ9A 1V55C 1IZ3A 5KHIA 4Q6GA 4D7TA 2P67A 2JGUA 2DYSC 4I0XA 4EEQA 4FLUA 3CRCA 4Z2WA 1Q5OA 3AG4C 4J9YB 3SPJA 2IH3C 3CCRV 3OGIB 2Z0AA 1NVPD 1GH6A 4IYHA 3NXSA 3B77A 2DYSB 4GKJO 1JCHA 1V55B 1XNQO 4BWAA 1SQGA 5IY5C 1N34B 1FAFA 3SPGA 3H1JH 2CH7B 2JS3A 2ADQB 1EBOA 3OM3B 4JI6O 2HHHO 3SPCA 2EINB 1Q43A 4ASUG 4TOIA 4FM1A 2AGAA 1MOFA 2Q67A 4DV0O 4DR3O 3K79A 2CGNA 1SERA 2N04A 3VOUA 2UUCB 1HDJA 2QWOB 2UXNA 4JI5B 2A0LA 1PD3A 3SYOA 1K34A 3ABLC 4KUMA 4O4JB 4RO2A 1VQ5V 1Y74B 1B6QA 2Z3YA 4QPJA 2GUZA 2HHHB 2ZQMA 5IYCO 4DR1O 2L35A 5KMGA 2QM7A 5EBWC 2LP7A 2CTWA 2OCCB 2AXTZ 1VQOV 1QCEA 4I4TA 3SYCA 1OZ0A 5BMVA 1Y6XA 4HNAA 2IU0A 1JPXA 3JATB 2PUSA 5KHJA 2N05A 2PYJA 5K1XA 2WLJA 1R1BA 3G4SV 1F51A 3G6BA 2VWJA 1J5EB 4DR5B 4BIZA 4UCSA 1K4DC 1ZSPA 3L9DA 5DECA 3OMNB 5HFMA 4WF9V 4B3MO 1X59A 3QG5A 3E2EA 3OE7G 5LA6A 2ZE5A 4MSWC 3CCVV 2UXXA 1WP8A 1VQNV 3J80N 4QIWF 3FB5C 2XAJA 2Y4UA 4R6ZA 3CJHB 1GN3A 2A06H 1VF7A 1UJWB 3BA9A 4JPRA 3CD6V 4JI5O 3WG7C 4MTFA 3OGCC 4RUFA 1WP7A 2X6AA 4J11A 4MVUA 4WFHA 5DEDA 5EK0A 1I94B 1NTKH 3FB7C 4FJCC 4J10A 1FPOA 1XL6A 1MZFA 2IW5A 2QM4A 3RYFA 1WB8A 1SETA 2KG7A 4DV4B 4BW5A 2BTQA 4G27B 1TVKA 3AG2C 2EIKC 4DV6B 3JALB 2YUAA 1N36B 3JD1A 1AB3A 2CGOA 1SQFA 4OXSA 3OTOO 1Y74A 4DR7O 4H33A 4O2AB 3AG4B 4WFFA 4X20A 3S3XA 2DJVA 5KX5A 2OYQA 3QO7A 1GN6A 3EHBB 2VRZA 1P84F 4GCZA 3WB2A 3EFFK 3CYOA 3B2EE 1AJQA 2YXHA 3GB7C 4JI8O 1NZ6A 3I55V 1Y4MA 3ASOB 1YHQV 4CH3A 1B04A 4QE9A 4Z1MG 3O9OA 5LGUA 1QR9A 1NI8A 1MABG 5JCOA 3BA8A 3LSSA 2CTPA 2ZR3A 2X7RB 3JSLA 1OCZB 3ZMUA 4E2LA 5J2UB 1PL0A 4XDJA 3CCLV 1QNMA 3JARA 3U0ZA 1L0NH 3ZRVA 2HLDG 1SQVH 4WBNA 1I08A 3E86A 1ZL8A 2ZINA 1VQKV 2JGDB 2LQTA 1SQPH 1BGYH 5E79Z 2QWRB 4HBNA 1IXMA 2ARHA 1JX9A 3W7XA 2E75B 3P30A 2YDEA 4G2KA 3JSNA 1WPXA 2DQ0A 4JI3O 2KQXA 1AI5A 4DR1B 4TQDA 2GHYA 1N4CA 2Q9LA 2C2AA 5JQGB 2W6JG 4DUZB 2BSKB 1TAEA 4XBFA 3CMEV 2GBOA 1OCCB 1Y67A 4DV0B 1KB9F 3SGIA 3HKDB 1XEQA 5KAFZ 1IX9A 1SS3A 4B08A 1T5EA 3CEIA 5TISZ 4QNHB 1NR1A 1FXKA 4WCEV 4FLTA 3WB0A 4JV5B 4CS3A 1S72V 2EIKB 1R6TA 1XNRO 4LWSA 2Q0OC 1Q90D 1J95A 4U7OA 2UU9O 3TETA 4MVRA 5J2TB 1KYOF 2LFRA 3OAAG 4NTYA 4GT1A 3F7VC 2JEUA 5IJ0B 1LNQA 3LUTB 3ABLB 5J9PC 1WPBA 4JI7B 1UFIA 2EZOA 3QO5A 4GX0A 2CUGA 3H1LH 1QU7A 3CXCU 4J7ZA 1Q7YW 1RFYA 5LGTA 3LNMB 1MG1A 3AK1A 5GW7A 4I9QA 4IL6Z 4FFKA 5DM6V 1N8RW 3KZIZ 4YJ2B 5E1AC 3JAKA 3APOA 2FYUH 3HKBA 1H2LA 4NYKA 3DC6A 1EN4A 5LMNB 1KKCA 2F4VO 4X1YA 5JH7A 2OCHA 1WN7A 4UXNA 3R65A 1H2SB 3A2FA 5IY5B 4PA9A 1IBMB 2F23A 2QGNA 1S5LZ 2X0LA 4B7EA 1I7FA 1YITV 3JD4A 2RN9A 5LHHA 2YSUB 3D36A 4FPPA 1S77D 4YIPA 2JRIA 1AP5A 4EFBA 1ORQC 4N21A 3MHSC 1W59A 2IH1C 3MDSA 3RYFB 1DK1A 2ITDC 4LBEC 5KX5B 3K5MA 4JF3A 1Q8IA 4CS4A 5IYDO 1IURA 1QHTA 1SC5B 3D3IA 2ZCEA 2VQFO 1SKVA 4B3MB 1NS1A 5EIBC 3JD0A 2BCCH 1AI4A 4MTOA 4J41A 4UVBA 3OMIB 4AQYO 1CP9A 5F2VO 4P9OA 1GN2A 2VQFB 1K5QA 2EJ7A 5EBLC 4U7NA 3ZN1A 3SDLA 2EIMC 4O4HB 5GTHZ 1ZX3A 1M56C 2P4VA 5EIBD 5B3SC 1ENVA 4JI4B 1JR9A 3OT7A 2QA4V 4DUYB 3J7AU 2Q0AA 5EBMC 1K73W 1FD9A 2YC0A 3IJ4A 3OW2U 1EN5A 1DF4A 1YF2A 1ZTEA 2ZT9B 2DWDC 3HB3B 1YZBA 3FFQA 4X1IB 3ZHVA 4FMTA 3HKEB 1HNWO 5CN0A 4RWUA 3AG7A 4B3SB 3UQ8A 2ZNIA 4G28B 1QLEB 2JS5A 2WA4A 3BPZA 4YJ3A 1VQ4V 3DXRA 5CA0B 1XHZA 2UUAB 1I0HA 1Z5VA 1K5SA 3ZHQA 4TV9B 1EZVH 2QSAA 3JYCA 3RYHB 4W4KA 2P6JA 4LFAB 4UCRA 1URFA 4NXMO 4DV2O 3AG2B 1DF5A 4I4TB 2EINC 2YI8A 4X9QA 2R9IA 3K57A 4DO2A 4X66B 1W0JG 2A9HA 2RNBA 5KMGB 3P3NA 2UXCO 5LP6C 1GN4A 1TUBB 2Q5ZA 4H0LB 3SPHA 4UVAA 2ODMA 3N2KA 3OEHG 3P32A 4X62B 2GTAA 2ZKOA 2N74A 2Q73A 1ZWIC 4JI0O 2EULA 1N33O 4CS2A 1IBKO 4TUYB 4F4LA 4CH4A 3L72H 4O4LA 4I9WA 4PD4F 2A7WA 1QQHA 3F5TA 1HNWB 3LDCA 3K59A 1YCIA 4MVZA 1F4NA 1VF5B 3JCUZ 4GYCB 5LYJB 4F6RA 1BT8A 2XAFA 3E8FA 3HR0A 5L3EA 4LF7B 3VQXA 2Y0IA 3ASNB 5A2QN 2JJ1G 2QKSA 3C3TA 4OX9O 1FJGO 3KCXA 1L1FA 3ZBHA 2R70A 4DR4O 3TGUH 5IYZA 4W4LA 5ITZB 1HNZB 1GM8A 1MMMA 3GWOA 3ZHTA 3TXQA 3G6EV 4J7KA 4C7UA 4IYIA 4DXWA 3G80A 4JYYA 1NKDA 2XHBA 5EC1C 1GO3F 5LBQA 4GX2A 1E79G 4LF6O 1HW7A 2PTMA 2WLLA 1XI1A 2QWNB 3X2QC 3T1HB 2XTAA 4YY3O 1K7DA 1XOUA 2Y48A 5JVDA 1VQ7V 2CTRA 2F93B 1VQLV 2QWQB 4DK0A 3CRQA 2DOSA 1QVFU 4NXMB 1TA8A 1AI6A 1LR1A 3FKSG 4LF8B 1N36O 2ZR2A 1MNGA 4QJFB 2DYRB 1BQ0A 1VF6C 2X6BA 3K0GA 4B3RB 1S5JA 3ZS8C 3FX7A 4DV6O 4I55A 3ZX6A 4LFBO 1PNMA 4GZRB 2DMXA 1Z5WA 3QNEA 1IDSA 1YSCA 1XBLA 4ICGA 1P7BA 3KG2A 2ILMA 1WNSA 3RYCA 2OWOA 3K9AA 2HJFC 4CC6A 5IYBO 3OUFA 2F43G 4O4HA 3BAAA 4JZGA 1YI2V 5LOVB 5FPRA 1KD1W 3ZIAG 3RWRD 3RYIB 4DV5B 5CMUA 3UCSC 1YIJV 4TQFA 4PA4A 3D36C 4GUNA 1L8DA 4LF4B 2UU9B 1V9PA 2QKAA 4I7ZB 3K58A 3X2QB 3UM7A 3ETDA 4AHCA 1D5AA 1ZL8B 4DV5O 2UUCO 1WA8B 1SRYA 4IHJA 3G71V 4H37A 1WB7A 2RCVA 3OD4A 4DR5O 5J2UA 4DR2B 1LUWA 1A32A 1E1QG 3B8NA 1WLEA 4FM0A 3UKMA 3TJTA 4JAAA 2JIZG 3ABMB 1IBLB 2UUBB 3CMAV 2YIBD 1AVMA 5LGNA 2LFSA 4KP4A 1XMOO 4U3JA 3LSQA 1MSDA 3CCSV 3FB8C 2E74B 4X64O 4YHHB 4MVOA 1KECA 3E83A 4R8CA 4JI3B 3CCJV 5LMUB 2EILB 1F7YA 3H01A 3RGBA 1CXZB 5H9CA 2VQEO 1JOYA 5KUKA 5BY1A 1E1RG 5LHGA 1Q81W 4MVSA 1D2DA 1BCCH 3CP1A 5IWAO 1HNXO 3BFRA 4FLVA 2Q7GA 4X66O 4L8JA 3H1KH 4JI7O 5KHHA 2QEXV 3A8TA 4DRXB 4NTWA 4K3AA 2WPDG 5IJ0A 1BSMA 2ZXWB 2RJZA 2ZE8A 4NTXA 4PELA 4P2ZA 4PJ0Z 5IJ9B 4F6EA 3K06A 3F5WC 4JZ2A 3JAKB 1YJ9V 4O4IB 3C3SA 4O2BA 2JEXA 4LF8O 2YIBA 4L87A 3ZRSA 5LMNO 3AEIA 2F4VB 2WLKA 3CJHA 3JAWB 3CRRA 4D6TH 4DR6O 4R7CA 1AP6A 3JAMN 2WLHA 2XUMA 3OEEG 4LF5B 4UVCA 2AW9A 2ZE6A 4CH6A 1IXBA 3ML0A 1H38A 1HP8A 5LOVA 2D3OW 3ABUA 3WFVA 3W7TA 2Q6AA 1QLEC 2BSKA 3B4SA 1K97A 4OPHA 2Y0PA 1XMQO 1I5XA 3CCUV 4I5SA 5CA3A 1Q82W 3B8MA 4FZ0A 2DN9A 4UCTA 3CRMA 5CB4A 4DR6B 4I50A 1G4YB 4DV1B 3DSQA 3IGAC 3ASNC 3LNNA 3CB2A 1M57B 1R6NA 2GUZB 4JI4O 1DTOA 5JVDB 5ITZA 5K1PA 3B40A 1P49A 4FFBB 2MW2B 2WSSG 5B3SB 5GONA 3U11A 4PI0A 2UXDB 3K3WA 2VQEB 3PN1A 4B3SO 2A3QA 3AG3B 1QBZA 4GLXA 3OR6C 2ZNJA 4ZI7A 5FLXN 2LGWA 4MTGA 3ZHSA 4FM2A 3ABKC 5LYJA 4X64B 1VMGA 3K5OA 1QLNA 4NXNB 4AQYB 2JVDA 3JASA 2ETNA 3IFXA 4UFZA 2HKOA 2E5LB 4PA3A 1GKFA 1IBKB 2KKWA 5HFLA 4TSFG 5BZBA 1QQCA 2FMLA 4MVMA 4U3FH 2XT9A 4LNUA 4O2AA 2HP8A 2OIGA 4UCOA 2L6LA 2HVJC 4K0KO 4DV2B 2HG5C 5IT9N 1RPRA 2WAMA 3JASB 2R72A 4LF7O 1OJHA 2P22C 4XDKA 1K33A 3RVYA 4U3JB 3IAYA 3AG1C 1JQ0A 2LW7A 2BTQB 2E5LO 1UPGA 3JCZA 2FKXA 3I56V 3FAVA 4TUYA 1TVKB 3SJBC 2KG7B 2QM8A 4X20B 5GONB 1JVMA 4YXWG 4J9ZB 2GSMB 3BHPA 1H8HG 4YJ3B 3A0HZ 1W2BU 2Z5UA 1S3JA 5FNVA 2AZ0A 3M8AA 1JFFB 4BW9A 2NLJC 5EC2C 1XILA 2EIJC 1G6UA 1YDXA 3JALA 4K35A 5KUMA 4OPAA 1S5HC 1R3IC 1R3JC 5D5QA 1VF6A 4X1IA 2YIDA 1KC8W 1M56B 4DR7B 2RMKB 5LP6B 3SJCC 3M99B 1BHBA 5KA5A 1R3KC 3DTUB 5CA1B 5EZYA 4JYCA 4BAYA 4B3TO 2YEVA 3DXRB 3BABA 3RVZA 4QPKA 2IBZH 4OX9B 3T1CA 1TGOA 5H6RA 5L3DA 1KUQA 1Q3EA 1VARA 3DC5A 4WFBV 2UUAO 3SPIA 3GWKC 3ETGA 3ZMSA 1ZUQA 4AI8A 4J42A 3SJAC 2CTQA 3D3QA 3GVMA 5H2FZ 1Y66A 2W0XA 1N0NA 2LGQA 1MSWD 4O2BB 2Q8VA 5KA6A 1KBHA 4PDRA 4RQEA 5FNVB 5B1BB 1BL8A 2NR5A 3H1HH 1NQTA 3SYPA 5B66Z 2JK5C 4BIOA 1ZAUA 3BY6A 1YEWA 2JJ2G 5KHGA 2GTSA 2OTLV 1GM9A 1CEZA 2XNDG 1K9MW 3LDDA 5EYPA 5AG2A 4NKGB 3CC7V 3FAVB 4DV3B 4IIJA 3RT3C 1XNRB 1YXBA 4K8ZA 4Q20A 2P90A 1US6A 1COWG 4PDLA 2B9ZA 2R9AA 4DR4B 5B5EZ 1AR5A 1R3LC 1NU1H 2OT5A 4JYBA 3LDEA 1F23A 1FYJA 4UV9A 2O57A 2FB5A 5JCOC 1KMIZ 4JI1O 2PI5A 2FL4A 3B09A 4RAIA 1PPJH 3AG3C 1I5YA 4EFEA 1RP3B 4F6RB 3ZRXA 2HR3A 3OTOB 4ZOLA 2H3OA 4UV8A 1S76D 2Q68A 1F4MA 1K92A 2F1MA 5GTIZ 3CHXA 1XUQA 3L73H 4J80A 2KSDA 3ETEA 4LNUB 1QVGU 1AROP 4X1YB 5JH7B 1HWYA 4YJ2A 2XAHA 4PDVA 3L71H 4JV5O 2YICA 3CWBH 3N2KB 3E22A 4JYAO 3L70H 1OCOB 2VS0A 3N2GA 4HAMA 2B1IA 1GMGA 1TUBA 4LH6A 4DV1O 5JJNB 2BOBC 3ZRWB 4DV3O 1PV0A 5B1BC 4FLYA 4NXNO 3ICXA 1PNKA 1Y76B 2WLIB 2IM9A 1VP7A 3QTCA 4I0XB 3EXAA 5L3GA 3T1YO 4PA6A 4ZI7B 1TUEB 2PYLA 2YIAA 2WA3A 2IJHA 3HPLC 4P30A 3PJSK 4MTXA 3CS5A 2F95B 2QDOA 4PV1B 1NH2D 3DGEA 2Q4PA 3K0DA 3QF7A 1PKXA 3D8CA 2EX3A 3ZN0A 4K0KB 2ADPA 2IU3A 3O65A 2GDSA 3OMAB 1W0KG 1PNLA 4FK5C 1M93A 2W6IG 1OV9A 1HNZO 3VQVA 2WLIA 5H6QA 4AILC 1VQMV 2ZXWC 4J7JA 4MW3A 3T4DA 3RBZA 2M7WA 3A0BZ 1N34O 1N32B 1JJOA 1WJZA 3E22B 4HZ3A 1XREA 3Q4HB 3WB1A 4JYAB 1FXVA 4CH5A 1M4UA 4O4IA 4DW0A 2PGGA 3UT5B 1S0VA 3LSUA 1B06A 1Q6UA 4MW8A 3JD3A 4DK1A 2B5UA 1H8EG 1PL4A 4BR6A 3W7SA 4FVMA 3MD0A 4X8AA 5CBGA 4WFGA 4LF9B 2RQ6A 4PA7A 2Y69C 1NT2B 2AHYA 3ZRWA 3VQWA 1KQSU 4WBNB 1RSOB 4DV7O 3N27A 3W7UA 2EJRA 3N2GB 4CZZA 1Q86W 2XAGA 3KKYA 3ZMZA 1K4CC 2AHZA 2UXBB 1AI7A 2XAQA 2UXCB 3G67A 4EKWA 2BOCC 3JARB 1RM1C 4B7KA 5LHIA 1EZJA 4JAUA 4GKJB 4KHPO 4FIPC 1VQ6V 5L3CA 3H1IH 1XDCA 5JJJB 1NJIW 3FYIB 1SQBH 1DLBA 4DV7B 2X6CA 2H94A 4LFCO 1BHAA 3E35A 2P5OA 3WU2Z 2XOKG 2QJ1A 2DWEC 1DGSA 3RN4A 3K5LA 1YTFB 3U10A 3CSXA 3HKBB 2QTSA 4YIOA 1YJNV 2LW1A 3MAQA 3JD2A 2AZ2A 2EBOA 4UB6Z 4KL1A 1GK9A 1RPOA 1FFXB 5C8YA 4KHPB 1JA8A 4EB6B 1BMFG 2V4DA 3L74H 2Q7EA 4JI2B 1M57C 2IJJA 2KB1A 2QR4A 2DYRC 4DYLA 5EYPB 1V54B 3RYIA 3AG1B 2YEVB 2WLNA 4CC5A 5B1AB 2ZM6B 3A0RA 1WA8A 4LCUC 1XNQB 2BE3A 1O9HA 2K9PA 4HYOA 4DV4O 1SA0B 3EVKA 3RW0A 1SZTA 5LP6A 1AR4A 3QO8A 1FXKB 3CX5F 3OR7C 2A79B 3CCEV 3JATA 1NR7A 2EIMB 3STLC 1EN6A 1R6KA 5CBFA 5IWAB 5LA6B 4H13B 1XMQB 1VQ9V 4KFMA 2LJ2A 4QGPA 2IJIA 1PM9A 3TXSA 3FB6C 3CC2V 3SJQC 4FLXA 1OCRB 3K04A 5LL6Y 4WFEA 5CA1A 3ABKB 5LMUO 1U97A 4GKKO 1GRJA 2QWPB 3CRAA 4I55B 3KCYA 3THOA 1N33B 4LH7A 1FKAO 2LO1A 4ABMA 2CK3G 4ZHQB 4UCUA 3CCMV 1V54C 4MS2A 3FD9A 1BE3H 1I94O 1D5NA 3E8BA 1THZA 3OUSA 2NN4A 1P4RA 3HKCA 4JI6B 3BVOA 5B1NA 2YS8A 1VEWA 1B3QA 4O4JA 2UUBO 1M9NA 1JJ2U 3RFRA 4PDMA 4DUYO 3E8HA 1NVPB 2E3CA 2ITCC 1KP2A 2ZD9A 2M6YA 2PZSA 4NR1A 3QVNA 4PHZA 4A5UB 4RUEA 1BZKA 1HR0O 3K5NA 2ATKC 1SQXH 3MHHC 1SZXA 1LUVA 1YJWV 3M7MX 3UO3A 4LF5O 1AJNA 4ZOLB 5IYZB 1M90W 2CH7A 4LF4O 3K9SA 1ZLZA 1HR0B 1R73A 4PI2A 4B3RO 1GM7A 4O4LB 3R66A 4ZKIA 4E4EA 3P3PA 1FXKC 3AK3A 1G1XB 3STZC 2ZM6O 2K1EA 1AILA 5BR8O 4WFAV 4FLWA 2PY5A 5FL7G 1Q6IA 3APQA 1VQPV 3H9VA 1FXHA 4LFAO 2E76B 4IT5A 2YXLA 3CXHF 1OCCC 5A9GA 1YVWA 1WAZA 3NR7A 1U96A 2P7TC 2PI4A 3UT5A 4ZHQA 4JI8B 4LWSB 3RYHA 1KKDA 1BQZA 5H5NA 3ZCCA 4TV9A 2QE7G 4DR3B 1Z2GA 1FS0G 4JI0B 1GAXA 4LFBB 2YI9A 3HKCB 1AR1B 3T1YB 2FTKA 2WLMA 3T1HO 5CA0A 2QTOA 5JJEB 2V1DA 4TWKA 3CPWU 4X65O 2ZIOA 5JWPA 4I50B 4RQFA 3ABTA 4X1KB 2V7QG 4TV8A 5LXTA 3K03A 3OTFA 4X88A 1NH2B 2XASA 3HKEA 4X65B 1XHXA 3F7YC 1L0LH 5CBHA 5CB4B 2CAZC 4LR3A 5EZYB 3ABMC 2ZIMA 1H2GA 1FJGB 4ZBMA 3BRCA 3IC7A 4JTCB 4X89A 4JI1B 2HEPA 2R9RB 4Z1VA 2HVKC 3K08A 4DW1A 2IJKA 1EFRG 3CE2A 3JAWA 4JTDB 2JDIG 2Y69B 4FLZA 3ASOC 4TT3G 2MK3A 5B1OA 4N23A 4P9PA 1M1KW 1X4TA 3T4ZA 4LFCB 5C8YB 1SA0A 2HJDA 4YHHO 4K8XA 2BTOA 2EILC 2H8PC 3CCQV 1KU9A 5B1AC 2RDCA 1G8MA 1CPYA 2D2CB 2CE4A 4DRXA 4UCVA 2ZDIC 1NTMH 4UB8Z 1K8AW 3ZMTA 3ZJZA 1IVSA 3ETQA 5KHKA 3SYAA
chains in the Genus database with same CATH topology
1NH2D 3DGEA 2GHYA 3K0DA 3LSQA 2C2AA 1PKXA 3TCUA 3CCSV 3FB8C 3ZN0A 2W6JG 1KP3A 2IU3A 3BEHA 4LC1A 3OMAB 4JTAB 4XBFA 3CMEV 4MVOA 1KECA 1W0KG 1PNLA 3E83A 4FK5C 4R8CA 2W6IG 3CCJV 1OCCB 2Q69A 2EILB 2WLIA 5H6QA 1NBMG 3OFNG 3H01A 1VQMV 2ZXWC 5H9CA 1JOYA 4MW3A 3WG7B 3W7WA 5KUKA 3T4DA 4JGSA 4QNHB 1FFTB 1E1RG 5LHGA 1Q81W 1NR1A 4MVSA 3RBZA 2ZDIA 1OHHG 2M7WA 1FXKA 3CP1A 4WCEV 3E8GA 4GX1A 4QE7A 1VQ8V 1XL4A 4LP8A 4HZ3A 1ROPA 1S72V 2EIKB 1J95A 1FXVA 4U7OA 1S0VA 3TETA 2QEXV 4MVRA 4MW8A 3JD3A 2B5UA 1H8EG 2LFRA 3OAAG 1YTFD 5L3FA 4UUJC 2WPDG 4JAVA 4GT1A 3F7VC 2ZXWB 3W7SA 3E89A 2JEUA 1LNQA 3LUTB 3ABLB 4PELA 5J9PC 1RM1B 3MD0A 4X8AA 4P2ZA 2EZOA 3K06A 3QO5A 4GX0A 2B1GA 3F5WC 5CBGA 1YJ9V 1OCOC 4WFGA 3CXCU 2HFEC 5DN6G 1Q7YW 4PA7A 2Y69C 2JEXA 5LGTA 3LNMB 2AHYA 1MG1A 4L87A 3ZRWA 3T2MA 5GW7A 3ZRSA 3AEIA 2WLKA 1KQSU 5DM6V 1N8RW 4JASA 3W7UA 2EJRA 4R7CA 4CZZA 3ZMVA 1Q86W 1GTOA 5E1AC 2W0FC 2XAGA 1K3EA 2WLHA 3ZMZA 1K4CC 2OCCC 2AHZA 2WWWA 3OEEG 3TK1A 4UVCA 1AI7A 2XAQA 4GX5A 4EKWA 3ML0A 2BOCC 1H38A 1RM1C 4UXNA 5LHIA 3R65A 2D3OW 3ABUA 4R50A 3WFVA 1EZJA 1OCRC 4PA9A 5IY5B 3W7TA 4JAUA 2Q6AA 5IDJA 4CBCA 1QLEC 2X0LA 5L3BA 1K97A 4MVQA 4FIPC 2OTJV 1VQ6V 5L3CA 1YITV 3VBBA 1I5XA 3JD4A 5LHHA 3CCUV 2YSUB 4I5SA 5CA3A 1Q82W 3D36A 4FPPA 3B8MA 3SYQA 1S77D 1NJIW 3FYIB 2WLLB 4BIUA 1DLBA 1QR8A 4MT8A 1ORQC 2H94A 2X6CA 4N21A 3MHSC 2IH1C 1BHAA 1G4YB 2ITDC 4LBEC 3E35A 3IGAC 2XOKG 4JF3A 2DWEC 2DW4A 3ASNC 1AJPA 5IYDO 3D3IA 1YTFB 1SESA 1OCZC 1M57B 1YJNV 1R6NA 5C93A 1DTOA 3JD0A 4XDLA 2EIJB 2DQ3A 3JD2A 2EBOA 1AI4A 4MTOA 1GK9A 1RPOA 2NNUA 4UVBA 3CC4V 3OMIB 2WSSG 5B3SB 3FYEB 1CP9A 4P9OA 1BMFG 1K5QA 5EBLC 4U7NA 3K3WA 3ZN1A 2EZPA 1V55C 2EIMC 1M57C 2IJJA 2P67A 2KB1A 2DYRC 3AG3B 1QBZA 1V54B 2DYSC 1M56C 3OR6C 4MTGA 1ENVA 5B3SC 3ABKC 3AG1B 2YEVB 2QA4V 2WLNA 1QLNA 5EBMC 5B1AB 1K73W 3AG4C 3A0RA 4J9YB 3SPJA 2IH3C 4LCUC 3OW2U 4HYOA 3IFXA 3CCRV 1DF4A 1NVPD 2HKOA 3RW0A 1SZTA 4PA3A 3QO8A 1FXKB 3B77A 2DWDC 3NXSA 1GKFA 2DYSB 3HB3B 3OR7C 2A79B 3CCEV 1JCHA 5HFLA 1NR7A 1V55B 2EIMB 4TSFG 4FMTA 5BZBA 3STLC 1R6KA 5CBFA 4MVMA 5IY5C 1VQ9V 5CN0A 4KFMA 3SPGA 2IJIA 1EBOA 3OM3B 4G28B 1QLEB 2HVJC 3FB6C 3CC2V 3SJQC 2HG5C 3SPCA 1VQ4V 1RPRA 1OCRB 2WAMA 3K04A 2EINB 4WFEA 4XDKA 1K33A 4ASUG 3RVYA 1MOFA 3AG1C 3ABKB 1K5SA 2Q67A 1JQ0A 3K79A 1SERA 3JCZA 3VOUA 3JYCA 3I56V 2CK3G 2UXNA 2P6JA 2A0LA 1PD3A 3SYOA 1K34A 3ABLC 3CCMV 3AG2B 1DF5A 4KUMA 1V54C 4RO2A 2EINC 2QM8A 4MS2A 2R9IA 1VQ5V 1JVMA 4YXWG 4J9ZB 4DO2A 1W0JG 2GSMB 3E8BA 1THZA 1H8HG 1B6QA 2A9HA 2Z3YA 4QPJA 1W2BU 3OUSA 2Z5UA 1P4RA 1S3JA 5B1NA 2ZQMA 5IYCO 1M9NA 1JJ2U 3SPHA 2QM7A 2NLJC 4PDMA 4UVAA 5EC2C 5EBWC 2LP7A 2EIJC 3E8HA 1NVPB 3OEHG 2OCCB 3P32A 5KUMA 1VQOV 1S5HC 2ITCC 1KP2A 1QCEA 2ZD9A 3SYCA 1OZ0A 1ZWIC 1R3IC 1R3JC 2IU0A 1JPXA 1KC8W 4F4LA 1M56B 4RUEA 2WLJA 2ATKC 4I9WA 3M99B 3G4SV 1F51A 1BHBA 3MHHC 5KA5A 1QQHA 3LDCA 4BIZA 1R3KC 1F4NA 4MVZA 1K4DC 3DTUB 1YJWV 4JYCA 1AJNA 4BAYA 1M90W 2YEVA 3OMNB 5HFMA 3RVZA 1R73A 4WF9V 4QPKA 1GM7A 3T1CA 5H6RA 5L3DA 2XAFA 3E8FA 3OE7G 3E2EA 5L3EA 4MSWC 4WFBV 4ZKIA 3SPIA 3CCVV 2UXXA 1VQNV 1FXKC 3ETGA 3ZMSA 4QIWF 3STZC 3FB5C 2K1EA 3ASNB 2JJ1G 2QKSA 4WFAV 2XAJA 5FL7G 4R6ZA 1Y66A 1UJWB 1L1FA 4JPRA 1VQPV 3CD6V 1MSWD 5KA6A 1FXHA 4PDRA 4RQEA 1GM8A 5B1BB 3GWOA 3WG7C 4MTFA 3OGCC 1BL8A 4RUFA 3G6EV 1NQTA 2X6AA 3SYPA 4WFHA 4MVUA 5EK0A 1OCCC 2JK5C 3FB7C 4FJCC 4DXWA 3BY6A 1XL6A 2JJ2G 1NKDA 2IW5A 2OTLV 5EC1C 1GM9A 1SETA 1GO3F 5LBQA 4BW5A 4GX2A 1E79G 2XNDG 2P7TC 1K9MW 3LDDA 4G27B 2PI4A 1CEZA 3AG2C 2EIKC 3CC7V 2WLLA 1KKDA 3X2QC 3ZCCA 1K7DA 2QE7G 4Q20A 3JD1A 2Y48A 1FS0G 2P90A 1VQ7V 1COWG 4PDLA 1AR1B 4OXSA 2FTKA 1R3LC 2WLMA 1VQLV 2OT5A 4JYBA 2QTOA 4H33A 3LDEA 1F23A 2V1DA 4TWKA 3CPWU 1QVFU 3AG4B 4WFFA 3QO7A 4RQFA 1AI6A 3ABTA 4UV9A 3EHBB 3FKSG 2V7QG 4GCZA 2PI5A 3EFFK 2ZR2A 3CYOA 3K03A 4RAIA 4X88A 1NH2B 4QJFB 2DYRB 1I5YA 1AJQA 3AG3C 2X6BA 2XASA 3K0GA 3F7YC 5CBHA 3GB7C 1PNMA 1Y4MA 3I55V 3ASOB 3ZRXA 2HR3A 1YHQV 3QNEA 3ABMC 4QE9A 4UV8A 1YSCA 4Z1MG 1S76D 5LGUA 1P7BA 1H2GA 2Q68A 3KG2A 1QR9A 1F4MA 1MABG 1K92A 3LSSA 4ZBMA 2ZR3A 3K9AA 3IC7A 2HJFC 4JTCB 4X89A 5IYBO 3OUFA 2F43G 2X7RB 1OCZB 3ZMUA 4E2LA 1YI2V 2R9RB 1PL0A 4XDJA 3CCLV 2HVKC 3K08A 1KD1W 3ETEA 3ZIAG 1QVGU 3ZRVA 1AROP 2HLDG 1HWYA 5CMUA 2IJKA 1EFRG 2XAHA 1YIJV 4PDVA 4PA4A 4JTDB 2JDIG 2Y69B 3ASOC 2MK3A 3E86A 4TT3G 4N23A 5B1OA 4P9PA 1VQKV 1OCOB 1M1KW 3X2QB 4HAMA 3T4ZA 2B1IA 1GMGA 3ETDA 3UM7A 2BOBC 3ZRWB 2EILC 5B1BC 1SRYA 2H8PC 1IXMA 3G71V 4H37A 1PNKA 3CCQV 2WLIB 1JX9A 3W7XA 5B1AC 5L3GA 3P30A 4PA6A 1G8MA 1TUEB 4G2KA 1WPXA 2DQ0A 1E1QG 3B8NA 2IJHA 3HPLC 1CPYA 1WLEA 4P30A 3UKMA 3PJSK 4MTXA 2ZDIC 1K8AW 2JIZG 3ABMB 3ZJZA 3ZMTA 1AI5A 3CMAV 5LGNA 2LFSA 4KP4A 3SYAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R6K A;  2JEX A;  1TUE B;  2NNU A;  1R6N A;  2JEU A;  1DTO A;  1QQH A; 
#chains in the Genus database with same CATH topology
 4EB6 A;  1FFX A;  3TCU A;  1KP3 A;  1IBL O;  3BEH A;  4LC1 A;  3S3W A;  4JTA B;  2DE0 X;  3I5D A;  3SR2 C;  1JMK C;  2Q69 A;  1NBM G;  1EM1 A;  3AK2 A;  3OFN G;  5FPO A;  1HNX B;  4IHJ B;  3WG7 B;  3W7W A;  4JGS A;  1SF9 A;  1BS3 A;  1FFT B;  1P7G A;  4B3T B;  1PP9 H;  2ZDI A;  1OHH G;  1MZE A;  3UO2 A;  2OIE A;  3E8G A;  4ZIB A;  4GX1 A;  1RSO A;  4QE7 A;  1VQ8 V;  4LF6 B;  1XL4 A;  4LP8 A;  1H2N A;  1ROP A;  4IIJ B;  3BCC H;  3J81 N;  2P4K A;  5BR8 B;  1SQQ H;  1YTF D;  5L3F A;  3L75 H;  4UUJ C;  4JAV A;  2G38 A;  3E89 A;  1IBM O;  1RM1 B;  2QKC A;  2B1G A;  1OCO C;  2Q7H A;  2HFE C;  5DN6 G;  3Q4H A;  2GV9 A;  1N0J A;  4FFB A;  3T2M A;  4D7S A;  2UXB O;  4JAS A;  5IE9 A;  5KAI Z;  3ZMV A;  1GTO A;  1NTZ H;  2PF4 E;  2W0F C;  4OGQ B;  1K3E A;  4TV8 B;  2OCC C;  2WWW A;  3TK1 A;  2Y4T A;  2YXY A;  4GX5 A;  3HKD A;  3ZHU A;  2ZE7 A;  4LF9 O;  5JQG A;  1H2K A;  5J2T A;  4R50 A;  1OCR C;  5IDJ A;  4CBC A;  5L3B A;  3RYC B;  1XQ8 A;  4MVQ A;  2OTJ V;  4NB5 A;  4X62 O;  3VBB A;  4IGG A;  4FZ1 A;  3SYQ A;  3VQY A;  2WLL B;  4BIU A;  5LXT B;  1O9G A;  1QR8 A;  4MT8 A;  1M5I A;  4HNA B;  4NVP A;  5BMV B;  1J5E O;  1N32 O;  1Y76 A;  2F66 C;  3ZED A;  1XMO B;  1VIB A;  4X1K A;  2DW4 A;  4H44 B;  1AJP A;  1JFF A;  1SES A;  2CDY A;  1OCZ C;  4GKK B;  2UXD O;  1H2M A;  5C93 A;  5D5P A;  5KLV H;  4DUZ O;  4XDL A;  2EIJ B;  2DQ3 A;  4DR2 O;  4JI2 O;  2NNU A;  3CC4 V;  3C90 A;  1Q6H A;  3IC9 A;  5BXZ A;  2JGD A;  3FYE B;  4YY3 B;  4KXR A;  3ZHR A;  2VWK A;  1MA1 A;  2P06 A;  2EZP A;  5IJ9 A;  1V55 C;  1IZ3 A;  5KHI A;  4Q6G A;  4D7T A;  2P67 A;  2JGU A;  2DYS C;  4I0X A;  4EEQ A;  4FLU A;  3CRC A;  4Z2W A;  1Q5O A;  3AG4 C;  4J9Y B;  3SPJ A;  2IH3 C;  3CCR V;  3OGI B;  2Z0A A;  1NVP D;  1GH6 A;  4IYH A;  3NXS A;  3B77 A;  2DYS B;  4GKJ O;  1JCH A;  1V55 B;  1XNQ O;  4BWA A;  1SQG A;  5IY5 C;  1N34 B;  1FAF A;  3SPG A;  3H1J H;  2CH7 B;  2JS3 A;  2ADQ B;  1EBO A;  3OM3 B;  4JI6 O;  2HHH O;  3SPC A;  2EIN B;  1Q43 A;  4ASU G;  4TOI A;  4FM1 A;  2AGA A;  1MOF A;  2Q67 A;  4DV0 O;  4DR3 O;  3K79 A;  2CGN A;  1SER A;  2N04 A;  3VOU A;  2UUC B;  1HDJ A;  2QWO B;  2UXN A;  4JI5 B;  2A0L A;  1PD3 A;  3SYO A;  1K34 A;  3ABL C;  4KUM A;  4O4J B;  4RO2 A;  1VQ5 V;  1Y74 B;  1B6Q A;  2Z3Y A;  4QPJ A;  2GUZ A;  2HHH B;  2ZQM A;  5IYC O;  4DR1 O;  2L35 A;  5KMG A;  2QM7 A;  5EBW C;  2LP7 A;  2CTW A;  2OCC B;  2AXT Z;  1VQO V;  1QCE A;  4I4T A;  3SYC A;  1OZ0 A;  5BMV A;  1Y6X A;  4HNA A;  2IU0 A;  1JPX A;  3JAT B;  2PUS A;  5KHJ A;  2N05 A;  2PYJ A;  5K1X A;  2WLJ A;  1R1B A;  3G4S V;  1F51 A;  3G6B A;  2VWJ A;  1J5E B;  4DR5 B;  4BIZ A;  4UCS A;  1K4D C;  1ZSP A;  3L9D A;  5DEC A;  3OMN B;  5HFM A;  4WF9 V;  4B3M O;  1X59 A;  3QG5 A;  3E2E A;  3OE7 G;  5LA6 A;  2ZE5 A;  4MSW C;  3CCV V;  2UXX A;  1WP8 A;  1VQN V;  3J80 N;  4QIW F;  3FB5 C;  2XAJ A;  2Y4U A;  4R6Z A;  3CJH B;  1GN3 A;  2A06 H;  1VF7 A;  1UJW B;  3BA9 A;  4JPR A;  3CD6 V;  4JI5 O;  3WG7 C;  4MTF A;  3OGC C;  4RUF A;  1WP7 A;  2X6A A;  4J11 A;  4MVU A;  4WFH A;  5DED A;  5EK0 A;  1I94 B;  1NTK H;  3FB7 C;  4FJC C;  4J10 A;  1FPO A;  1XL6 A;  1MZF A;  2IW5 A;  2QM4 A;  3RYF A;  1WB8 A;  1SET A;  2KG7 A;  4DV4 B;  4BW5 A;  2BTQ A;  4G27 B;  1TVK A;  3AG2 C;  2EIK C;  4DV6 B;  3JAL B;  2YUA A;  1N36 B;  3JD1 A;  1AB3 A;  2CGO A;  1SQF A;  4OXS A;  3OTO O;  1Y74 A;  4DR7 O;  4H33 A;  4O2A B;  3AG4 B;  4WFF A;  4X20 A;  3S3X A;  2DJV A;  5KX5 A;  2OYQ A;  3QO7 A;  1GN6 A;  3EHB B;  2VRZ A;  1P84 F;  4GCZ A;  3WB2 A;  3EFF K;  3CYO A;  3B2E E;  1AJQ A;  2YXH A;  3GB7 C;  4JI8 O;  1NZ6 A;  3I55 V;  1Y4M A;  3ASO B;  1YHQ V;  4CH3 A;  1B04 A;  4QE9 A;  4Z1M G;  3O9O A;  5LGU A;  1QR9 A;  1NI8 A;  1MAB G;  5JCO A;  3BA8 A;  3LSS A;  2CTP A;  2ZR3 A;  2X7R B;  3JSL A;  1OCZ B;  3ZMU A;  4E2L A;  5J2U B;  1PL0 A;  4XDJ A;  3CCL V;  1QNM A;  3JAR A;  3U0Z A;  1L0N H;  3ZRV A;  2HLD G;  1SQV H;  4WBN A;  1I08 A;  3E86 A;  1ZL8 A;  2ZIN A;  1VQK V;  2JGD B;  2LQT A;  1SQP H;  1BGY H;  5E79 Z;  2QWR B;  4HBN A;  1IXM A;  2ARH A;  1JX9 A;  3W7X A;  2E75 B;  3P30 A;  2YDE A;  4G2K A;  3JSN A;  1WPX A;  2DQ0 A;  4JI3 O;  2KQX A;  1AI5 A;  4DR1 B;  4TQD A;  2GHY A;  1N4C A;  2Q9L A;  2C2A A;  5JQG B;  2W6J G;  4DUZ B;  2BSK B;  1TAE A;  4XBF A;  3CME V;  2GBO A;  1OCC B;  1Y67 A;  4DV0 B;  1KB9 F;  3SGI A;  3HKD B;  1XEQ A;  5KAF Z;  1IX9 A;  1SS3 A;  4B08 A;  1T5E A;  3CEI A;  5TIS Z;  4QNH B;  1NR1 A;  1FXK A;  4WCE V;  4FLT A;  3WB0 A;  4JV5 B;  4CS3 A;  1S72 V;  2EIK B;  1R6T A;  1XNR O;  4LWS A;  2Q0O C;  1Q90 D;  1J95 A;  4U7O A;  2UU9 O;  3TET A;  4MVR A;  5J2T B;  1KYO F;  2LFR A;  3OAA G;  4NTY A;  4GT1 A;  3F7V C;  2JEU A;  5IJ0 B;  1LNQ A;  3LUT B;  3ABL B;  5J9P C;  1WPB A;  4JI7 B;  1UFI A;  2EZO A;  3QO5 A;  4GX0 A;  2CUG A;  3H1L H;  1QU7 A;  3CXC U;  4J7Z A;  1Q7Y W;  1RFY A;  5LGT A;  3LNM B;  1MG1 A;  3AK1 A;  5GW7 A;  4I9Q A;  4IL6 Z;  4FFK A;  5DM6 V;  1N8R W;  3KZI Z;  4YJ2 B;  5E1A C;  3JAK A;  3APO A;  2FYU H;  3HKB A;  1H2L A;  4NYK A;  3DC6 A;  1EN4 A;  5LMN B;  1KKC A;  2F4V O;  4X1Y A;  5JH7 A;  2OCH A;  1WN7 A;  4UXN A;  3R65 A;  1H2S B;  3A2F A;  5IY5 B;  4PA9 A;  1IBM B;  2F23 A;  2QGN A;  1S5L Z;  2X0L A;  4B7E A;  1I7F A;  1YIT V;  3JD4 A;  2RN9 A;  5LHH A;  2YSU B;  3D36 A;  4FPP A;  1S77 D;  4YIP A;  2JRI A;  1AP5 A;  4EFB A;  1ORQ C;  4N21 A;  3MHS C;  1W59 A;  2IH1 C;  3MDS A;  3RYF B;  1DK1 A;  2ITD C;  4LBE C;  5KX5 B;  3K5M A;  4JF3 A;  1Q8I A;  4CS4 A;  5IYD O;  1IUR A;  1QHT A;  1SC5 B;  3D3I A;  2ZCE A;  2VQF O;  1SKV A;  4B3M B;  1NS1 A;  5EIB C;  3JD0 A;  2BCC H;  1AI4 A;  4MTO A;  4J41 A;  4UVB A;  3OMI B;  4AQY O;  1CP9 A;  5F2V O;  4P9O A;  1GN2 A;  2VQF B;  1K5Q A;  2EJ7 A;  5EBL C;  4U7N A;  3ZN1 A;  3SDL A;  2EIM C;  4O4H B;  5GTH Z;  1ZX3 A;  1M56 C;  2P4V A;  5EIB D;  5B3S C;  1ENV A;  4JI4 B;  1JR9 A;  3OT7 A;  2QA4 V;  4DUY B;  3J7A U;  2Q0A A;  5EBM C;  1K73 W;  1FD9 A;  2YC0 A;  3IJ4 A;  3OW2 U;  1EN5 A;  1DF4 A;  1YF2 A;  1ZTE A;  2ZT9 B;  2DWD C;  3HB3 B;  1YZB A;  3FFQ A;  4X1I B;  3ZHV A;  4FMT A;  3HKE B;  1HNW O;  5CN0 A;  4RWU A;  3AG7 A;  4B3S B;  3UQ8 A;  2ZNI A;  4G28 B;  1QLE B;  2JS5 A;  2WA4 A;  3BPZ A;  4YJ3 A;  1VQ4 V;  3DXR A;  5CA0 B;  1XHZ A;  2UUA B;  1I0H A;  1Z5V A;  1K5S A;  3ZHQ A;  4TV9 B;  1EZV H;  2QSA A;  3JYC A;  3RYH B;  4W4K A;  2P6J A;  4LFA B;  4UCR A;  1URF A;  4NXM O;  4DV2 O;  3AG2 B;  1DF5 A;  4I4T B;  2EIN C;  2YI8 A;  4X9Q A;  2R9I A;  3K57 A;  4DO2 A;  4X66 B;  1W0J G;  2A9H A;  2RNB A;  5KMG B;  3P3N A;  2UXC O;  5LP6 C;  1GN4 A;  1TUB B;  2Q5Z A;  4H0L B;  3SPH A;  4UVA A;  2ODM A;  3N2K A;  3OEH G;  3P32 A;  4X62 B;  2GTA A;  2ZKO A;  2N74 A;  2Q73 A;  1ZWI C;  4JI0 O;  2EUL A;  1N33 O;  4CS2 A;  1IBK O;  4TUY B;  4F4L A;  4CH4 A;  3L72 H;  4O4L A;  4I9W A;  4PD4 F;  2A7W A;  1QQH A;  3F5T A;  1HNW B;  3LDC A;  3K59 A;  1YCI A;  4MVZ A;  1F4N A;  1VF5 B;  3JCU Z;  4GYC B;  5LYJ B;  4F6R A;  1BT8 A;  2XAF A;  3E8F A;  3HR0 A;  5L3E A;  4LF7 B;  3VQX A;  2Y0I A;  3ASN B;  5A2Q N;  2JJ1 G;  2QKS A;  3C3T A;  4OX9 O;  1FJG O;  3KCX A;  1L1F A;  3ZBH A;  2R70 A;  4DR4 O;  3TGU H;  5IYZ A;  4W4L A;  5ITZ B;  1HNZ B;  1GM8 A;  1MMM A;  3GWO A;  3ZHT A;  3TXQ A;  3G6E V;  4J7K A;  4C7U A;  4IYI A;  4DXW A;  3G80 A;  4JYY A;  1NKD A;  2XHB A;  5EC1 C;  1GO3 F;  5LBQ A;  4GX2 A;  1E79 G;  4LF6 O;  1HW7 A;  2PTM A;  2WLL A;  1XI1 A;  2QWN B;  3X2Q C;  3T1H B;  2XTA A;  4YY3 O;  1K7D A;  1XOU A;  2Y48 A;  5JVD A;  1VQ7 V;  2CTR A;  2F93 B;  1VQL V;  2QWQ B;  4DK0 A;  3CRQ A;  2DOS A;  1QVF U;  4NXM B;  1TA8 A;  1AI6 A;  1LR1 A;  3FKS G;  4LF8 B;  1N36 O;  2ZR2 A;  1MNG A;  4QJF B;  2DYR B;  1BQ0 A;  1VF6 C;  2X6B A;  3K0G A;  4B3R B;  1S5J A;  3ZS8 C;  3FX7 A;  4DV6 O;  4I55 A;  3ZX6 A;  4LFB O;  1PNM A;  4GZR B;  2DMX A;  1Z5W A;  3QNE A;  1IDS A;  1YSC A;  1XBL A;  4ICG A;  1P7B A;  3KG2 A;  2ILM A;  1WNS A;  3RYC A;  2OWO A;  3K9A A;  2HJF C;  4CC6 A;  5IYB O;  3OUF A;  2F43 G;  4O4H A;  3BAA A;  4JZG A;  1YI2 V;  5LOV B;  5FPR A;  1KD1 W;  3ZIA G;  3RWR D;  3RYI B;  4DV5 B;  5CMU A;  3UCS C;  1YIJ V;  4TQF A;  4PA4 A;  3D36 C;  4GUN A;  1L8D A;  4LF4 B;  2UU9 B;  1V9P A;  2QKA A;  4I7Z B;  3K58 A;  3X2Q B;  3UM7 A;  3ETD A;  4AHC A;  1D5A A;  1ZL8 B;  4DV5 O;  2UUC O;  1WA8 B;  1SRY A;  4IHJ A;  3G71 V;  4H37 A;  1WB7 A;  2RCV A;  3OD4 A;  4DR5 O;  5J2U A;  4DR2 B;  1LUW A;  1A32 A;  1E1Q G;  3B8N A;  1WLE A;  4FM0 A;  3UKM A;  3TJT A;  4JAA A;  2JIZ G;  3ABM B;  1IBL B;  2UUB B;  3CMA V;  2YIB D;  1AVM A;  5LGN A;  2LFS A;  4KP4 A;  1XMO O;  4U3J A;  3LSQ A;  1MSD A;  3CCS V;  3FB8 C;  2E74 B;  4X64 O;  4YHH B;  4MVO A;  1KEC A;  3E83 A;  4R8C A;  4JI3 B;  3CCJ V;  5LMU B;  2EIL B;  1F7Y A;  3H01 A;  3RGB A;  1CXZ B;  5H9C A;  2VQE O;  1JOY A;  5KUK A;  5BY1 A;  1E1R G;  5LHG A;  1Q81 W;  4MVS A;  1D2D A;  1BCC H;  3CP1 A;  5IWA O;  1HNX O;  3BFR A;  4FLV A;  2Q7G A;  4X66 O;  4L8J A;  3H1K H;  4JI7 O;  5KHH A;  2QEX V;  3A8T A;  4DRX B;  4NTW A;  4K3A A;  2WPD G;  5IJ0 A;  1BSM A;  2ZXW B;  2RJZ A;  2ZE8 A;  4NTX A;  4PEL A;  4P2Z A;  4PJ0 Z;  5IJ9 B;  4F6E A;  3K06 A;  3F5W C;  4JZ2 A;  3JAK B;  1YJ9 V;  4O4I B;  3C3S A;  4O2B A;  2JEX A;  4LF8 O;  2YIB A;  4L87 A;  3ZRS A;  5LMN O;  3AEI A;  2F4V B;  2WLK A;  3CJH A;  3JAW B;  3CRR A;  4D6T H;  4DR6 O;  4R7C A;  1AP6 A;  3JAM N;  2WLH A;  2XUM A;  3OEE G;  4LF5 B;  4UVC A;  2AW9 A;  2ZE6 A;  4CH6 A;  1IXB A;  3ML0 A;  1H38 A;  1HP8 A;  5LOV A;  2D3O W;  3ABU A;  3WFV A;  3W7T A;  2Q6A A;  1QLE C;  2BSK A;  3B4S A;  1K97 A;  4OPH A;  2Y0P A;  1XMQ O;  1I5X A;  3CCU V;  4I5S A;  5CA3 A;  1Q82 W;  3B8M A;  4FZ0 A;  2DN9 A;  4UCT A;  3CRM A;  5CB4 A;  4DR6 B;  4I50 A;  1G4Y B;  4DV1 B;  3DSQ A;  3IGA C;  3ASN C;  3LNN A;  3CB2 A;  1M57 B;  1R6N A;  2GUZ B;  4JI4 O;  1DTO A;  5JVD B;  5ITZ A;  5K1P A;  3B40 A;  1P49 A;  4FFB B;  2MW2 B;  2WSS G;  5B3S B;  5GON A;  3U11 A;  4PI0 A;  2UXD B;  3K3W A;  2VQE B;  3PN1 A;  4B3S O;  2A3Q A;  3AG3 B;  1QBZ A;  4GLX A;  3OR6 C;  2ZNJ A;  4ZI7 A;  5FLX N;  2LGW A;  4MTG A;  3ZHS A;  4FM2 A;  3ABK C;  5LYJ A;  4X64 B;  1VMG A;  3K5O A;  1QLN A;  4NXN B;  4AQY B;  2JVD A;  3JAS A;  2ETN A;  3IFX A;  4UFZ A;  2HKO A;  2E5L B;  4PA3 A;  1GKF A;  1IBK B;  2KKW A;  5HFL A;  4TSF G;  5BZB A;  1QQC A;  2FML A;  4MVM A;  4U3F H;  2XT9 A;  4LNU A;  4O2A A;  2HP8 A;  2OIG A;  4UCO A;  2L6L A;  2HVJ C;  4K0K O;  4DV2 B;  2HG5 C;  5IT9 N;  1RPR A;  2WAM A;  3JAS B;  2R72 A;  4LF7 O;  1OJH A;  2P22 C;  4XDK A;  1K33 A;  3RVY A;  4U3J B;  3IAY A;  3AG1 C;  1JQ0 A;  2LW7 A;  2BTQ B;  2E5L O;  1UPG A;  3JCZ A;  2FKX A;  3I56 V;  3FAV A;  4TUY A;  1TVK B;  3SJB C;  2KG7 B;  2QM8 A;  4X20 B;  5GON B;  1JVM A;  4YXW G;  4J9Z B;  2GSM B;  3BHP A;  1H8H G;  4YJ3 B;  3A0H Z;  1W2B U;  2Z5U A;  1S3J A;  5FNV A;  2AZ0 A;  3M8A A;  1JFF B;  4BW9 A;  2NLJ C;  5EC2 C;  1XIL A;  2EIJ C;  1G6U A;  1YDX A;  3JAL A;  4K35 A;  5KUM A;  4OPA A;  1S5H C;  1R3I C;  1R3J C;  5D5Q A;  1VF6 A;  4X1I A;  2YID A;  1KC8 W;  1M56 B;  4DR7 B;  2RMK B;  5LP6 B;  3SJC C;  3M99 B;  1BHB A;  5KA5 A;  1R3K C;  3DTU B;  5CA1 B;  5EZY A;  4JYC A;  4BAY A;  4B3T O;  2YEV A;  3DXR B;  3BAB A;  3RVZ A;  4QPK A;  2IBZ H;  4OX9 B;  3T1C A;  1TGO A;  5H6R A;  5L3D A;  1KUQ A;  1Q3E A;  1VAR A;  3DC5 A;  4WFB V;  2UUA O;  3SPI A;  3GWK C;  3ETG A;  3ZMS A;  1ZUQ A;  4AI8 A;  4J42 A;  3SJA C;  2CTQ A;  3D3Q A;  3GVM A;  5H2F Z;  1Y66 A;  2W0X A;  1N0N A;  2LGQ A;  1MSW D;  4O2B B;  2Q8V A;  5KA6 A;  1KBH A;  4PDR A;  4RQE A;  5FNV B;  5B1B B;  1BL8 A;  2NR5 A;  3H1H H;  1NQT A;  3SYP A;  5B66 Z;  2JK5 C;  4BIO A;  1ZAU A;  3BY6 A;  1YEW A;  2JJ2 G;  5KHG A;  2GTS A;  2OTL V;  1GM9 A;  1CEZ A;  2XND G;  1K9M W;  3LDD A;  5EYP A;  5AG2 A;  4NKG B;  3CC7 V;  3FAV B;  4DV3 B;  4IIJ A;  3RT3 C;  1XNR B;  1YXB A;  4K8Z A;  4Q20 A;  2P90 A;  1US6 A;  1COW G;  4PDL A;  2B9Z A;  2R9A A;  4DR4 B;  5B5E Z;  1AR5 A;  1R3L C;  1NU1 H;  2OT5 A;  4JYB A;  3LDE A;  1F23 A;  1FYJ A;  4UV9 A;  2O57 A;  2FB5 A;  5JCO C;  1KMI Z;  4JI1 O;  2PI5 A;  2FL4 A;  3B09 A;  4RAI A;  1PPJ H;  3AG3 C;  1I5Y A;  4EFE A;  1RP3 B;  4F6R B;  3ZRX A;  2HR3 A;  3OTO B;  4ZOL A;  2H3O A;  4UV8 A;  1S76 D;  2Q68 A;  1F4M A;  1K92 A;  2F1M A;  5GTI Z;  3CHX A;  1XUQ A;  3L73 H;  4J80 A;  2KSD A;  3ETE A;  4LNU B;  1QVG U;  1ARO P;  4X1Y B;  5JH7 B;  1HWY A;  4YJ2 A;  2XAH A;  4PDV A;  3L71 H;  4JV5 O;  2YIC A;  3CWB H;  3N2K B;  3E22 A;  4JYA O;  3L70 H;  1OCO B;  2VS0 A;  3N2G A;  4HAM A;  2B1I A;  1GMG A;  1TUB A;  4LH6 A;  4DV1 O;  5JJN B;  2BOB C;  3ZRW B;  4DV3 O;  1PV0 A;  5B1B C;  4FLY A;  4NXN O;  3ICX A;  1PNK A;  1Y76 B;  2WLI B;  2IM9 A;  1VP7 A;  3QTC A;  4I0X B;  3EXA A;  5L3G A;  3T1Y O;  4PA6 A;  4ZI7 B;  1TUE B;  2PYL A;  2YIA A;  2WA3 A;  2IJH A;  3HPL C;  4P30 A;  3PJS K;  4MTX A;  3CS5 A;  2F95 B;  2QDO A;  4PV1 B;  1NH2 D;  3DGE A;  2Q4P A;  3K0D A;  3QF7 A;  1PKX A;  3D8C A;  2EX3 A;  3ZN0 A;  4K0K B;  2ADP A;  2IU3 A;  3O65 A;  2GDS A;  3OMA B;  1W0K G;  1PNL A;  4FK5 C;  1M93 A;  2W6I G;  1OV9 A;  1HNZ O;  3VQV A;  2WLI A;  5H6Q A;  4AIL C;  1VQM V;  2ZXW C;  4J7J A;  4MW3 A;  3T4D A;  3RBZ A;  2M7W A;  3A0B Z;  1N34 O;  1N32 B;  1JJO A;  1WJZ A;  3E22 B;  4HZ3 A;  1XRE A;  3Q4H B;  3WB1 A;  4JYA B;  1FXV A;  4CH5 A;  1M4U A;  4O4I A;  4DW0 A;  2PGG A;  3UT5 B;  1S0V A;  3LSU A;  1B06 A;  1Q6U A;  4MW8 A;  3JD3 A;  4DK1 A;  2B5U A;  1H8E G;  1PL4 A;  4BR6 A;  3W7S A;  4FVM A;  3MD0 A;  4X8A A;  5CBG A;  4WFG A;  4LF9 B;  2RQ6 A;  4PA7 A;  2Y69 C;  1NT2 B;  2AHY A;  3ZRW A;  3VQW A;  1KQS U;  4WBN B;  1RSO B;  4DV7 O;  3N27 A;  3W7U A;  2EJR A;  3N2G B;  4CZZ A;  1Q86 W;  2XAG A;  3KKY A;  3ZMZ A;  1K4C C;  2AHZ A;  2UXB B;  1AI7 A;  2XAQ A;  2UXC B;  3G67 A;  4EKW A;  2BOC C;  3JAR B;  1RM1 C;  4B7K A;  5LHI A;  1EZJ A;  4JAU A;  4GKJ B;  4KHP O;  4FIP C;  1VQ6 V;  5L3C A;  3H1I H;  1XDC A;  5JJJ B;  1NJI W;  3FYI B;  1SQB H;  1DLB A;  4DV7 B;  2X6C A;  2H94 A;  4LFC O;  1BHA A;  3E35 A;  2P5O A;  3WU2 Z;  2XOK G;  2QJ1 A;  2DWE C;  1DGS A;  3RN4 A;  3K5L A;  1YTF B;  3U10 A;  3CSX A;  3HKB B;  2QTS A;  4YIO A;  1YJN V;  2LW1 A;  3MAQ A;  3JD2 A;  2AZ2 A;  2EBO A;  4UB6 Z;  4KL1 A;  1GK9 A;  1RPO A;  1FFX B;  5C8Y A;  4KHP B;  1JA8 A;  4EB6 B;  1BMF G;  2V4D A;  3L74 H;  2Q7E A;  4JI2 B;  1M57 C;  2IJJ A;  2KB1 A;  2QR4 A;  2DYR C;  4DYL A;  5EYP B;  1V54 B;  3RYI A;  3AG1 B;  2YEV B;  2WLN A;  4CC5 A;  5B1A B;  2ZM6 B;  3A0R A;  1WA8 A;  4LCU C;  1XNQ B;  2BE3 A;  1O9H A;  2K9P A;  4HYO A;  4DV4 O;  1SA0 B;  3EVK A;  3RW0 A;  1SZT A;  5LP6 A;  1AR4 A;  3QO8 A;  1FXK B;  3CX5 F;  3OR7 C;  2A79 B;  3CCE V;  3JAT A;  1NR7 A;  2EIM B;  3STL C;  1EN6 A;  1R6K A;  5CBF A;  5IWA B;  5LA6 B;  4H13 B;  1XMQ B;  1VQ9 V;  4KFM A;  2LJ2 A;  4QGP A;  2IJI A;  1PM9 A;  3TXS A;  3FB6 C;  3CC2 V;  3SJQ C;  4FLX A;  1OCR B;  3K04 A;  5LL6 Y;  4WFE A;  5CA1 A;  3ABK B;  5LMU O;  1U97 A;  4GKK O;  1GRJ A;  2QWP B;  3CRA A;  4I55 B;  3KCY A;  3THO A;  1N33 B;  4LH7 A;  1FKA O;  2LO1 A;  4ABM A;  2CK3 G;  4ZHQ B;  4UCU A;  3CCM V;  1V54 C;  4MS2 A;  3FD9 A;  1BE3 H;  1I94 O;  1D5N A;  3E8B A;  1THZ A;  3OUS A;  2NN4 A;  1P4R A;  3HKC A;  4JI6 B;  3BVO A;  5B1N A;  2YS8 A;  1VEW A;  1B3Q A;  4O4J A;  2UUB O;  1M9N A;  1JJ2 U;  3RFR A;  4PDM A;  4DUY O;  3E8H A;  1NVP B;  2E3C A;  2ITC C;  1KP2 A;  2ZD9 A;  2M6Y A;  2PZS A;  4NR1 A;  3QVN A;  4PHZ A;  4A5U B;  4RUE A;  1BZK A;  1HR0 O;  3K5N A;  2ATK C;  1SQX H;  3MHH C;  1SZX A;  1LUV A;  1YJW V;  3M7M X;  3UO3 A;  4LF5 O;  1AJN A;  4ZOL B;  5IYZ B;  1M90 W;  2CH7 A;  4LF4 O;  3K9S A;  1ZLZ A;  1HR0 B;  1R73 A;  4PI2 A;  4B3R O;  1GM7 A;  4O4L B;  3R66 A;  4ZKI A;  4E4E A;  3P3P A;  1FXK C;  3AK3 A;  1G1X B;  3STZ C;  2ZM6 O;  2K1E A;  1AIL A;  5BR8 O;  4WFA V;  4FLW A;  2PY5 A;  5FL7 G;  1Q6I A;  3APQ A;  1VQP V;  3H9V A;  1FXH A;  4LFA O;  2E76 B;  4IT5 A;  2YXL A;  3CXH F;  1OCC C;  5A9G A;  1YVW A;  1WAZ A;  3NR7 A;  1U96 A;  2P7T C;  2PI4 A;  3UT5 A;  4ZHQ A;  4JI8 B;  4LWS B;  3RYH A;  1KKD A;  1BQZ A;  5H5N A;  3ZCC A;  4TV9 A;  2QE7 G;  4DR3 B;  1Z2G A;  1FS0 G;  4JI0 B;  1GAX A;  4LFB B;  2YI9 A;  3HKC B;  1AR1 B;  3T1Y B;  2FTK A;  2WLM A;  3T1H O;  5CA0 A;  2QTO A;  5JJE B;  2V1D A;  4TWK A;  3CPW U;  4X65 O;  2ZIO A;  5JWP A;  4I50 B;  4RQF A;  3ABT A;  4X1K B;  2V7Q G;  4TV8 A;  5LXT A;  3K03 A;  3OTF A;  4X88 A;  1NH2 B;  2XAS A;  3HKE A;  4X65 B;  1XHX A;  3F7Y C;  1L0L H;  5CBH A;  5CB4 B;  2CAZ C;  4LR3 A;  5EZY B;  3ABM C;  2ZIM A;  1H2G A;  1FJG B;  4ZBM A;  3BRC A;  3IC7 A;  4JTC B;  4X89 A;  4JI1 B;  2HEP A;  2R9R B;  4Z1V A;  2HVK C;  3K08 A;  4DW1 A;  2IJK A;  1EFR G;  3CE2 A;  3JAW A;  4JTD B;  2JDI G;  2Y69 B;  4FLZ A;  3ASO C;  4TT3 G;  2MK3 A;  5B1O A;  4N23 A;  4P9P A;  1M1K W;  1X4T A;  3T4Z A;  4LFC B;  5C8Y B;  1SA0 A;  2HJD A;  4YHH O;  4K8X A;  2BTO A;  2EIL C;  2H8P C;  3CCQ V;  1KU9 A;  5B1A C;  2RDC A;  1G8M A;  1CPY A;  2D2C B;  2CE4 A;  4DRX A;  4UCV A;  2ZDI C;  1NTM H;  4UB8 Z;  1K8A W;  3ZMT A;  3ZJZ A;  1IVS A;  3ETQ A;  5KHK A;  3SYA A; 
#chains in the Genus database with same CATH homology
 1NH2 D;  3DGE A;  2GHY A;  3K0D A;  3LSQ A;  2C2A A;  1PKX A;  3TCU A;  3CCS V;  3FB8 C;  3ZN0 A;  2W6J G;  1KP3 A;  2IU3 A;  3BEH A;  4LC1 A;  3OMA B;  4JTA B;  4XBF A;  3CME V;  4MVO A;  1KEC A;  1W0K G;  1PNL A;  3E83 A;  4FK5 C;  4R8C A;  2W6I G;  3CCJ V;  1OCC B;  2Q69 A;  2EIL B;  2WLI A;  5H6Q A;  1NBM G;  3OFN G;  3H01 A;  1VQM V;  2ZXW C;  5H9C A;  1JOY A;  4MW3 A;  3WG7 B;  3W7W A;  5KUK A;  3T4D A;  4JGS A;  4QNH B;  1FFT B;  1E1R G;  5LHG A;  1Q81 W;  1NR1 A;  4MVS A;  3RBZ A;  2ZDI A;  1OHH G;  2M7W A;  1FXK A;  3CP1 A;  4WCE V;  3E8G A;  4GX1 A;  4QE7 A;  1VQ8 V;  1XL4 A;  4LP8 A;  4HZ3 A;  1ROP A;  1S72 V;  2EIK B;  1J95 A;  1FXV A;  4U7O A;  1S0V A;  3TET A;  2QEX V;  4MVR A;  4MW8 A;  3JD3 A;  2B5U A;  1H8E G;  2LFR A;  3OAA G;  1YTF D;  5L3F A;  4UUJ C;  2WPD G;  4JAV A;  4GT1 A;  3F7V C;  2ZXW B;  3W7S A;  3E89 A;  2JEU A;  1LNQ A;  3LUT B;  3ABL B;  4PEL A;  5J9P C;  1RM1 B;  3MD0 A;  4X8A A;  4P2Z A;  2EZO A;  3K06 A;  3QO5 A;  4GX0 A;  2B1G A;  3F5W C;  5CBG A;  1YJ9 V;  1OCO C;  4WFG A;  3CXC U;  2HFE C;  5DN6 G;  1Q7Y W;  4PA7 A;  2Y69 C;  2JEX A;  5LGT A;  3LNM B;  2AHY A;  1MG1 A;  4L87 A;  3ZRW A;  3T2M A;  5GW7 A;  3ZRS A;  3AEI A;  2WLK A;  1KQS U;  5DM6 V;  1N8R W;  4JAS A;  3W7U A;  2EJR A;  4R7C A;  4CZZ A;  3ZMV A;  1Q86 W;  1GTO A;  5E1A C;  2W0F C;  2XAG A;  1K3E A;  2WLH A;  3ZMZ A;  1K4C C;  2OCC C;  2AHZ A;  2WWW A;  3OEE G;  3TK1 A;  4UVC A;  1AI7 A;  2XAQ A;  4GX5 A;  4EKW A;  3ML0 A;  2BOC C;  1H38 A;  1RM1 C;  4UXN A;  5LHI A;  3R65 A;  2D3O W;  3ABU A;  4R50 A;  3WFV A;  1EZJ A;  1OCR C;  4PA9 A;  5IY5 B;  3W7T A;  4JAU A;  2Q6A A;  5IDJ A;  4CBC A;  1QLE C;  2X0L A;  5L3B A;  1K97 A;  4MVQ A;  4FIP C;  2OTJ V;  1VQ6 V;  5L3C A;  1YIT V;  3VBB A;  1I5X A;  3JD4 A;  5LHH A;  3CCU V;  2YSU B;  4I5S A;  5CA3 A;  1Q82 W;  3D36 A;  4FPP A;  3B8M A;  3SYQ A;  1S77 D;  1NJI W;  3FYI B;  2WLL B;  4BIU A;  1DLB A;  1QR8 A;  4MT8 A;  1ORQ C;  2H94 A;  2X6C A;  4N21 A;  3MHS C;  2IH1 C;  1BHA A;  1G4Y B;  2ITD C;  4LBE C;  3E35 A;  3IGA C;  2XOK G;  4JF3 A;  2DWE C;  2DW4 A;  3ASN C;  1AJP A;  5IYD O;  3D3I A;  1YTF B;  1SES A;  1OCZ C;  1M57 B;  1YJN V;  1R6N A;  5C93 A;  1DTO A;  3JD0 A;  4XDL A;  2EIJ B;  2DQ3 A;  3JD2 A;  2EBO A;  1AI4 A;  4MTO A;  1GK9 A;  1RPO A;  2NNU A;  4UVB A;  3CC4 V;  3OMI B;  2WSS G;  5B3S B;  3FYE B;  1CP9 A;  4P9O A;  1BMF G;  1K5Q A;  5EBL C;  4U7N A;  3K3W A;  3ZN1 A;  2EZP A;  1V55 C;  2EIM C;  1M57 C;  2IJJ A;  2P67 A;  2KB1 A;  2DYR C;  3AG3 B;  1QBZ A;  1V54 B;  2DYS C;  1M56 C;  3OR6 C;  4MTG A;  1ENV A;  5B3S C;  3ABK C;  3AG1 B;  2YEV B;  2QA4 V;  2WLN A;  1QLN A;  5EBM C;  5B1A B;  1K73 W;  3AG4 C;  3A0R A;  4J9Y B;  3SPJ A;  2IH3 C;  4LCU C;  3OW2 U;  4HYO A;  3IFX A;  3CCR V;  1DF4 A;  1NVP D;  2HKO A;  3RW0 A;  1SZT A;  4PA3 A;  3QO8 A;  1FXK B;  3B77 A;  2DWD C;  3NXS A;  1GKF A;  2DYS B;  3HB3 B;  3OR7 C;  2A79 B;  3CCE V;  1JCH A;  5HFL A;  1NR7 A;  1V55 B;  2EIM B;  4TSF G;  4FMT A;  5BZB A;  3STL C;  1R6K A;  5CBF A;  4MVM A;  5IY5 C;  1VQ9 V;  5CN0 A;  4KFM A;  3SPG A;  2IJI A;  1EBO A;  3OM3 B;  4G28 B;  1QLE B;  2HVJ C;  3FB6 C;  3CC2 V;  3SJQ C;  2HG5 C;  3SPC A;  1VQ4 V;  1RPR A;  1OCR B;  2WAM A;  3K04 A;  2EIN B;  4WFE A;  4XDK A;  1K33 A;  4ASU G;  3RVY A;  1MOF A;  3AG1 C;  3ABK B;  1K5S A;  2Q67 A;  1JQ0 A;  3K79 A;  1SER A;  3JCZ A;  3VOU A;  3JYC A;  3I56 V;  2CK3 G;  2UXN A;  2P6J A;  2A0L A;  1PD3 A;  3SYO A;  1K34 A;  3ABL C;  3CCM V;  3AG2 B;  1DF5 A;  4KUM A;  1V54 C;  4RO2 A;  2EIN C;  2QM8 A;  4MS2 A;  2R9I A;  1VQ5 V;  1JVM A;  4YXW G;  4J9Z B;  4DO2 A;  1W0J G;  2GSM B;  3E8B A;  1THZ A;  1H8H G;  1B6Q A;  2A9H A;  2Z3Y A;  4QPJ A;  1W2B U;  3OUS A;  2Z5U A;  1P4R A;  1S3J A;  5B1N A;  2ZQM A;  5IYC O;  1M9N A;  1JJ2 U;  3SPH A;  2QM7 A;  2NLJ C;  4PDM A;  4UVA A;  5EC2 C;  5EBW C;  2LP7 A;  2EIJ C;  3E8H A;  1NVP B;  3OEH G;  2OCC B;  3P32 A;  5KUM A;  1VQO V;  1S5H C;  2ITC C;  1KP2 A;  1QCE A;  2ZD9 A;  3SYC A;  1OZ0 A;  1ZWI C;  1R3I C;  1R3J C;  2IU0 A;  1JPX A;  1KC8 W;  4F4L A;  1M56 B;  4RUE A;  2WLJ A;  2ATK C;  4I9W A;  3M99 B;  3G4S V;  1F51 A;  1BHB A;  3MHH C;  5KA5 A;  1QQH A;  3LDC A;  4BIZ A;  1R3K C;  1F4N A;  4MVZ A;  1K4D C;  3DTU B;  1YJW V;  4JYC A;  1AJN A;  4BAY A;  1M90 W;  2YEV A;  3OMN B;  5HFM A;  3RVZ A;  1R73 A;  4WF9 V;  4QPK A;  1GM7 A;  3T1C A;  5H6R A;  5L3D A;  2XAF A;  3E8F A;  3OE7 G;  3E2E A;  5L3E A;  4MSW C;  4WFB V;  4ZKI A;  3SPI A;  3CCV V;  2UXX A;  1VQN V;  1FXK C;  3ETG A;  3ZMS A;  4QIW F;  3STZ C;  3FB5 C;  2K1E A;  3ASN B;  2JJ1 G;  2QKS A;  4WFA V;  2XAJ A;  5FL7 G;  4R6Z A;  1Y66 A;  1UJW B;  1L1F A;  4JPR A;  1VQP V;  3CD6 V;  1MSW D;  5KA6 A;  1FXH A;  4PDR A;  4RQE A;  1GM8 A;  5B1B B;  3GWO A;  3WG7 C;  4MTF A;  3OGC C;  1BL8 A;  4RUF A;  3G6E V;  1NQT A;  2X6A A;  3SYP A;  4WFH A;  4MVU A;  5EK0 A;  1OCC C;  2JK5 C;  3FB7 C;  4FJC C;  4DXW A;  3BY6 A;  1XL6 A;  2JJ2 G;  1NKD A;  2IW5 A;  2OTL V;  5EC1 C;  1GM9 A;  1SET A;  1GO3 F;  5LBQ A;  4BW5 A;  4GX2 A;  1E79 G;  2XND G;  2P7T C;  1K9M W;  3LDD A;  4G27 B;  2PI4 A;  1CEZ A;  3AG2 C;  2EIK C;  3CC7 V;  2WLL A;  1KKD A;  3X2Q C;  3ZCC A;  1K7D A;  2QE7 G;  4Q20 A;  3JD1 A;  2Y48 A;  1FS0 G;  2P90 A;  1VQ7 V;  1COW G;  4PDL A;  1AR1 B;  4OXS A;  2FTK A;  1R3L C;  2WLM A;  1VQL V;  2OT5 A;  4JYB A;  2QTO A;  4H33 A;  3LDE A;  1F23 A;  2V1D A;  4TWK A;  3CPW U;  1QVF U;  3AG4 B;  4WFF A;  3QO7 A;  4RQF A;  1AI6 A;  3ABT A;  4UV9 A;  3EHB B;  3FKS G;  2V7Q G;  4GCZ A;  2PI5 A;  3EFF K;  2ZR2 A;  3CYO A;  3K03 A;  4RAI A;  4X88 A;  1NH2 B;  4QJF B;  2DYR B;  1I5Y A;  1AJQ A;  3AG3 C;  2X6B A;  2XAS A;  3K0G A;  3F7Y C;  5CBH A;  3GB7 C;  1PNM A;  1Y4M A;  3I55 V;  3ASO B;  3ZRX A;  2HR3 A;  1YHQ V;  3QNE A;  3ABM C;  4QE9 A;  4UV8 A;  1YSC A;  4Z1M G;  1S76 D;  5LGU A;  1P7B A;  1H2G A;  2Q68 A;  3KG2 A;  1QR9 A;  1F4M A;  1MAB G;  1K92 A;  3LSS A;  4ZBM A;  2ZR3 A;  3K9A A;  3IC7 A;  2HJF C;  4JTC B;  4X89 A;  5IYB O;  3OUF A;  2F43 G;  2X7R B;  1OCZ B;  3ZMU A;  4E2L A;  1YI2 V;  2R9R B;  1PL0 A;  4XDJ A;  3CCL V;  2HVK C;  3K08 A;  1KD1 W;  3ETE A;  3ZIA G;  1QVG U;  3ZRV A;  1ARO P;  2HLD G;  1HWY A;  5CMU A;  2IJK A;  1EFR G;  2XAH A;  1YIJ V;  4PDV A;  4PA4 A;  4JTD B;  2JDI G;  2Y69 B;  3ASO C;  2MK3 A;  3E86 A;  4TT3 G;  4N23 A;  5B1O A;  4P9P A;  1VQK V;  1OCO B;  1M1K W;  3X2Q B;  4HAM A;  3T4Z A;  2B1I A;  1GMG A;  3ETD A;  3UM7 A;  2BOB C;  3ZRW B;  2EIL C;  5B1B C;  1SRY A;  2H8P C;  1IXM A;  3G71 V;  4H37 A;  1PNK A;  3CCQ V;  2WLI B;  1JX9 A;  3W7X A;  5B1A C;  5L3G A;  3P30 A;  4PA6 A;  1G8M A;  1TUE B;  4G2K A;  1WPX A;  2DQ0 A;  1E1Q G;  3B8N A;  2IJH A;  3HPL C;  1CPY A;  1WLE A;  4P30 A;  3UKM A;  3PJS K;  4MTX A;  2ZDI C;  1K8A W;  2JIZ G;  3ABM B;  3ZJZ A;  3ZMT A;  1AI5 A;  3CMA V;  5LGN A;  2LFS A;  4KP4 A;  3SYA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...