1DTOA

Crystal structure of the complete transactivation domain of e2 protein from the human papillomavirus type 16
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
202
structure length
200
Chain Sequence
HMETLCQRLNVCQDKILTHYENDSTDLRDHIDYWKHMRLECAIYYKAREMGFKHINHQVVPTLAVSKNKALQAIELQLTLETIYNSQYSNEKWTLQDVSLEVYLTAPTGCIKKHGYTVEVQFDGDNTMHYTNWTHIYICEEASVTVVEGQVDYYGLYYVHEGIRTYFVQFKDDAEKYSKNKVWEVHAGGQVILCPTSVFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REGULATORY PROTEIN E2
publication title Structure of the intact transactivation domain of the human papillomavirus E2 protein.
pubmed doi rcsb
source organism Human papillomavirus type 16
molecule tags Viral protein
total genus 63
structure length 200
sequence length 202
ec nomenclature
pdb deposition date 2000-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00508 PPV_E2_N E2 (early) protein, N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.30 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1dtoA01
2.170.200.10 Mainly Beta Beta Complex Regulatory Protein E2; Chain: A; Domain 2 Regulatory Protein E2; Chain: A; Domain 2 1dtoA02
2JEUA 1QQHA 1R6KA 2JEXA 1DTOA 1R6NA 2NNUA 1TUEB
chains in the Genus database with same CATH superfamily
1XHXA 2A0LA 1VQ7V 5EZYA 1FFTB 5CBHA 3ABMB 1Y76A 4DRXB 1SQGA 2QJ1A 3OMAB 4JI5B 5ITZB 4DR2B 2W6JG 1K4DC 3ICXA 5L3FA 2XTAA 1WNSA 4I7ZB 3RYHB 2MK3A 3JCUZ 4O4LB 4TT3G 2UXBO 5CA3A 3IAYA 1KECA 1NKDA 4ASUG 4YIPA 1Y4MA 1QR9A 4B3TB 1K9MW 2V1DA 4I50B 3CCVV 1SA0B 5LBQA 5JQGB 4J80A 4IGGA 5CBFA 3OMIB 3DC5A 1B6QA 3T1YB 4XBFA 1BGYH 1H38A 3ZEDA 1FJGB 2CGOA 1M4UA 4G28B 4JYBA 1HW7A 3LDEA 3MDSA 3CCEV 4QNHB 3LSUA 4JAVA 2LJ2A 5CB4A 4FZ1A 5JH7A 4LH6A 1H8HG 3W7WA 3K58A 1I0HA 3E22B 4WFHA 3SYQA 2A3QA 5JVDB 2UU9B 4PJ0Z 3AG4C 2ZXWC 3AG7A 3E8GA 1JFFA 4WBNA 1I94O 2PYLA 3OTOO 2Q6AA 2BOBC 4IHJB 1JQ0A 4W4KA 1YZBA 1V54C 1FXKB 3FYIB 1XEQA 5KX5A 5IYDO 3B40A 2YXYA 2HVJC 2AHYA 2GSMB 3JD0A 2F4VO 1EN5A 1OCZC 2R70A 5B3SC 2RQ6A 1Q6UA 4LF4O 2Y0PA 4N21A 1ROPA 5E1AC 1WN7A 4DR6O 3B77A 2QEXV 4GX5A 2B5UA 4EB6A 1KP3A 4WFFA 3CCLV 4JI6O 3BPZA 4PA3A 4JI2B 1M93A 3HB3B 2L6LA 2EULA 2EILB 1Z2GA 4PDRA 2E5LB 1N0JA 3T2MA 4B3RB 1KU9A 3OUFA 1U97A 4PI2A 5IWAO 1QQHA 1K97A 4JYAB 3VBBA 4FPPA 4JV5B 2A9HA 1RPOA 4WCEV 5JJNB 2PZSA 4X20B 1FFXB 3LDDA 3CCJV 5KHJA 4GYCB 5J2UB 3GWOA 3JD1A 4KL1A 3B2EE 2NNUA 3MAQA 1ZAUA 1WJZA 2ITDC 4BW5A 4DUZO 1VF6A 3D3QA 3LSQA 2N05A 3CRCA 4PDVA 4JZGA 3SPCA 2VWJA 4FLYA 4KFMA 1FAFA 1M56B 3RYCB 3OUSA 4UCVA 1R3JC 4LFCO 1GRJA 1FS0G 1S72V 3KKYA 2PI4A 4CC5A 1DLBA 2CK3G 1OCOC 2CAZC 1K33A 4DV4B 1N4CA 1GTOA 1HP8A 5IYZB 3K04A 1QBZA 4O2BA 1XOUA 5FPRA 2L35A 3ZHVA 1J95A 1SC5B 4CS2A 4Z1MG 3SJQC 4MTXA 3B4SA 2F93B 3T4DA 1EZVH 3T1HO 1O9HA 2AHZA 4DK1A 3E8HA 4X66B 1VQ4V 4X1IB 4RO2A 4DR3O 2E75B 1MSWD 1YHQV 2GUZB 2PUSA 5HFMA 5FL7G 2IU0A 1YJ9V 5KHIA 1S3JA 2HVKC 3CJHA 3KCXA 3KZIZ 5CA1A 4LFBO 1I5YA 2IBZH 4UCRA 3UO2A 1PM9A 3CEIA 4CH6A 3JAWB 5IJ0B 1VQOV 2OIEA 4J10A 3K57A 1NVPD 4I9QA 2UXDB 5EIBC 2EIKB 1MZEA 2GBOA 3L71H 1G8MA 3CWBH 2V7QG 2Q8VA 4PHZA 1HNXB 4JI5O 2HJDA 4IIJB 4DR2O 1N32O 4LF8B 1H2MA 3CX5F 3CSXA 1EM1A 4NKGB 3P3NA 1GK9A 5CA0B 5IY5B 3ZCCA 4NVPA 4D7TA 4DR5B 4O4JA 2OCCB 5BXZA 4YIOA 1S5JA 2CH7A 1UFIA 2JRIA 2YIAA 1L1FA 1V54B 3S3XA 3T1YO 5H6RA 4MSWC 5B1AC 1NT2B 2KKWA 3HKEB 3N2KA 3SPGA 1LUVA 1PD3A 1VQLV 1IDSA 1TAEA 4L8JA 3G67A 3JASA 2D3OW 5KA5A 4HBNA 2K1EA 2CTWA 2QE7G 3MD0A 2K9PA 1KMIZ 1D5NA 4JPRA 3EHBB 4UV8A 1R73A 3K0GA 4X64B 3N2GA 2FB5A 2P6JA 2X6AA 2ZIMA 4OXSA 1XREA 2EZOA 3K5LA 4ABMA 2ZE6A 1V9PA 1TVKB 3D36C 2OTLV 3BRCA 5LP6C 4YJ3A 4JI3B 4LF9B 4UCOA 2XNDG 1Q81W 1GH6A 3W7SA 3J81N 3RN4A 2Q68A 3DXRA 1YDXA 2QM4A 5EC1C 3ABLC 1B3QA 1M1KW 4ZI7B 4JI2O 4J9YB 1PKXA 3CRRA 1FYJA 3BAAA 1OCCB 4X1YA 1F4NA 2ADQB 3HPLC 1GN6A 2ILMA 2Q7EA 3O9OA 4PDMA 4JTDB 5LYJA 4YY3B 1KBHA 5KMGB 1WAZA 1Q8IA 4CZZA 1AR4A 1J5EB 2ZM6B 3I55V 1KKCA 3ASOC 4BIUA 3FAVA 4AILC 1D2DA 4DV7B 1OHHG 2UUCO 3NR7A 4X1KB 2JEXA 1VQ8V 3D3IA 2EZPA 4MTOA 5C8YA 1N8RW 2XUMA 4QIWF 4DV0O 1XMQO 2QWOB 1HDJA 2Q5ZA 4JI4O 3THOA 3ABUA 1PNMA 4CH4A 2FMLA 4YHHB 1L0NH 5B1OA 1H2SB 1WLEA 1PP9H 4CH3A 1S5HC 3UO3A 1NI8A 1WPBA 2Q7GA 1TA8A 3CC2V 2CGNA 2HKOA 2YS8A 4TSFG 4B7EA 1QVFU 4JZ2A 4LWSA 3GB7C 5JWPA 1VQNV 1XUQA 3OGIB 5KHHA 1SQVH 4IT5A 2W6IG 1FKAO 3BA9A 3CE2A 3STLC 4H33A 5IDJA 2UUAB 4F6RA 4JI7B 3ZHTA 3P30A 1S77D 1QR8A 4OGQB 3K03A 4UCTA 2ZNIA 1LR1A 1ZSPA 4G2KA 4QPKA 2F43G 3OR7C 4X9QA 5BY1A 4ZBMA 2QGNA 4X66O 3X2QC 5LGNA 5KAFZ 1SQPH 3OFNG 2RMKB 1NTZH 4WFEA 1M57C 5KA6A 4XDJA 1IBLB 1M9NA 1NS1A 4LF6B 3JALB 2QKCA 2IJJA 1E1RG 1S0VA 4CS4A 3RWRD 5EYPB 5DECA 5LXTA 3FB5C 3JARA 5GTHZ 2NLJC 2DN9A 3LSSA 4ZOLA 4GUNA 5LL6Y 1DGSA 2WWWA 2DQ0A 2P4VA 5LA6B 5BR8B 2Q0AA 4JI0O 1IX9A 3ZN1A 1QHTA 1N33O 2VQFB 2ZE8A 3ASNC 1VQ5V 3UQ8A 3RYFB 2W0FC 1P7BA 3Q4HA 3D36A 3F5WC 5IYCO 2GTAA 2IJHA 3JAKB 1GKFA 4NTXA 4UVCA 2EINB 4FIPC 2EIJC 1EBOA 4FZ0A 2KSDA 4TUYB 3E89A 2ZNJA 3FYEB 2ZDIA 4DUYB 2QWRB 5LMUB 2XAGA 1HNZB 3OEHG 1IURA 1R6NA 1K3EA 5LP6B 2IW5A 2CDYA 1MA1A 2A06H 3VQXA 1VARA 4MTGA 4NTWA 1FXHA 4U3JA 4FFBA 1NQTA 1YI2V 1GAXA 1XL6A 2A79B 2XASA 2FTKA 1G1XB 1R3KC 1YSCA 4HZ3A 3HKCA 2DYSC 4GKJB 4I55A 4LCUC 1Q43A 2RN9A 4JI8B 1QCEA 1QU7A 4NXNB 3A8TA 3OGCC 3ZBHA 4DV2B 3JATA 1NZ6A 5EIBD 1WB7A 1AI7A 2WLJA 2XAQA 2QM7A 2Q67A 4MVQA 2X0LA 1R6KA 1IBMO 4QE7A 1OJHA 5LOVB 4KHPO 2WLIB 2XHBA 4DV1O 3FKSG 3HR0A 4OX9B 5LMNO 5EZYB 4FM2A 5LHIA 4X65O 4YJ2A 1Y76B 2XAFA 5EC2C 3JSLA 3JD3A 1NH2D 1AR1B 5A2QN 2DYRC 3E86A 2Q69A 4MVOA 2ZINA 4CC6A 4TOIA 3CPWU 3F7VC 3ZIAG 1J5EO 1W0KG 4DV6B 4DV7O 2WLMA 3BABA 4GX2A 2GTSA 1RM1B 1V55C 4BIZA 4DR4O 1Z5WA 3MHSC 3UKMA 4D7SA 4DR1O 1TUBA 4C7UA 3IC9A 1IVSA 4WFAV 5CB4B 2RJZA 4FLXA 5JH7B 3OAAG 1K5SA 1VMGA 1HNWB 2EX3A 3SPHA 1K5QA 1HR0O 1WB8A 3SPIA 2MW2B 5GONA 2OT5A 5F2VO 3D8CA 1CXZB 3X2QB 3SDLA 5EBLC 1IBKB 1JFFB 1QQCA 2EIMC 2W0XA 4WBNB 3ZRVA 2UXCB 4NR1A 4JASA 2BTQA 4NXMB 1O9GA 3OT7A 3G6BA 1H2GA 3H1JH 2ZIOA 4JGSA 3SYAA 3APOA 4N23A 3CP1A 3C90A 2DQ3A 5KX5B 4DV3B 1NVPB 1JJ2U 4JTAB 4LFAO 4JI1O 1QNMA 1SZTA 5IJ9A 1AJNA 4D6TH 5IT9N 2UUBO 4FK5C 2BCCH 3SPJA 4UFZA 1ZX3A 4B3MO 4K0KO 2ZT9B 3WG7B 4KUMA 4EB6B 1RSOA 2ZQMA 4AQYO 3ZRWA 1NJIW 1NU1H 4GT1A 1B04A 1ZL8A 1IBLO 3JYCA 3RVYA 4LF6O 3CCQV 4Q20A 1SRYA 1XNQO 5B1BC 5LHHA 3BVOA 3PJSK 4WFGA 2Y4TA 3ABTA 4FLTA 4PI0A 1BE3H 4I5SA 5BR8O 3N27A 1BHBA 3H1HH 4MW8A 3UT5A 2YI9A 3CCMV 2Z0AA 5LHGA 2M7WA 2JS5A 2Q9LA 3C3SA 3AG1C 1THZA 3W7TA 2WSSG 2VQEB 2Y69B 1XQ8A 3TK1A 1Q6IA 1JJOA 4RQEA 2YUAA 2DYSB 4P9PA 4DR7O 2BTOA 1WPXA 3AG2B 4I0XA 3SYPA 1G4YB 1PL0A 3GWKC 4O2AA 4X89A 4DUYO 3T4ZA 4X62B 1LUWA 2AW9A 4R7CA 1HNZO 2N04A 5J2TA 2OIGA 1GMGA 4A5UB 4DV5O 5IE9A 1YJWV 3HKBA 3A0BZ 3QG5A 4O2BB 3AG3C 3K79A 5KHKA 3ZRXA 4FJCC 2P7TC 4F6EA 3W7UA 4FLVA 2YSUB 3T1CA 2R9AA 4MTFA 4HNAA 2CTPA 3QO8A 2HHHB 5DEDA 4LF7O 2RDCA 3LNMB 3U11A 1JR9A 3RYIA 1K34A 2LFRA 3H9VA 3E83A 4FLZA 1AB3A 5KHGA 2X7RB 3CJHB 3VOUA 1NR7A 2OCHA 5CA1B 1WA8A 4GZRB 3IJ4A 1YIJV 3ZHUA 2OTJV 4FFKA 5H6QA 1EN6A 3R66A 2QWQB 2JGDA 2QTSA 3AG4B 4B3TO 2ZXWB 1BMFG 2WLLA 4TQDA 4ZHQA 5GW7A 4TV9A 1K92A 4J7KA 2JDIG 2ATKC 4DK0A 2P06A 2JJ2G 3NXSA 4JTCB 2DW4A 1FJGO 4NB5A 1SZXA 4B08A 1OCZB 3WB2A 5B3SB 1L8DA 3L75H 4I9WA 1Y67A 1PNLA 2KG7A 1QLEC 4O4JB 2UU9O 1Z5VA 2ARHA 4TWKA 2CH7B 3E35A 3K5NA 1RFYA 1ZTEA 1Q82W 4TV8A 3K5MA 1R6TA 2LQTA 3N2KB 1K73W 1N34B 2YDEA 3JASB 1CEZA 2P22C 4H13B 5J9PC 3CHXA 3ZHQA 4CH5A 2YICA 5E79Z 3OE7G 1SQFA 2UXCO 2QSAA 2QWPB 3CMEV 3N2GB 2LFSA 4NXMO 4I4TA 3UM7A 2ZDIC 3R65A 5JJEB 2HR3A 2Q7HA 4KXRA 1DF5A 4LBEC 1W0JG 3L73H 4MVZA 1K7DA 1P7GA 2UXBB 2E5LO 3H1LH 3ABKC 3KCYA 1Q86W 4YJ3B 4B3RO 1PV0A 2P4KA 2CTRA 3EVKA 4MW3A 3ETGA 4PA4A 3CD6V 1VF7A 4R50A 2DOSA 5LGUA 3APQA 4XDKA 2QKSA 1LNQA 3DXRB 3CYOA 4PA6A 4JYAO 2ZD9A 2PTMA 4JV5O 1YF2A 3RVZA 3G4SV 3ABMC 3SJAC 1OCOB 4PD4F 1I7FA 1FPOA 1Y6XA 4K8ZA 3DGEA 4X1YB 5KUMA 3CMAV 4QE9A 1AP5A 5CMUA 1AI5A 5LYJB 1XL4A 1MNGA 4NYKA 4PELA 1BSMA 5FNVA 4X8AA 2HLDG 2AZ2A 3FAVB 4GLXA 3M7MX 1I94B 1JPXA 4CS3A 3A0HZ 1Y74A 5C8YB 1AJPA 1Y66A 1YJNV 2ZKOA 4DW0A 1VP7A 4J7JA 4XDLA 2P5OA 1QVGU 4P30A 4DV4O 1BCCH 4UV9A 3J7AU 3JD2A 5JCOC 4LF4B 3BEHA 4RWUA 2IJIA 5GTIZ 3CCSV 1GN3A 2RCVA 3ZMUA 4JI6B 1EFRG 2A7WA 2B1IA 4LWSB 3P3PA 2F23A 2VS0A 3UCSC 1NBMG 4O4HA 3SJBC 3ML0A 1XI1A 1FXKC 4UXNA 2ETNA 5KAIZ 4F6RB 4FVMA 5IWAB 3QNEA 1COWG 1H8EG 1TGOA 4FM0A 1NH2B 2BSKA 1KQSU 2HHHO 2PF4E 3PN1A 5BMVA 3TGUH 4ZIBA 2UXDO 4JYYA 2Y4UA 2EILC 2OWOA 1JA8A 3K3WA 2H8PC 1KD1W 3RFRA 1HNXO 1JCHA 5B1AB 2EBOA 2PY5A 4PDLA 1L0LH 1DK1A 4LF8O 2GV9A 2C2AA 2CUGA 5CN0A 4MT8A 5LXTB 3JARB 2YEVA 3RT3C 1W59A 1CPYA 4F4LA 2QWNB 4O4IA 4ZOLB 3I5DA 2IH3C 3CCUV 3HKDA 4DR5O 3FFQA 5EK0A 1NTMH 3FX7A 1PL4A 3WU2Z 2F66C 1AROP 4G27B 4W4LA 4DXWA 1JOYA 3Q4HB 4LNUA 4K3AA 2AZ0A 1H2KA 2DWDC 1ZLZA 3T1HB 2UXNA 4B3MB 3JSNA 4H44B 1TUEB 1M56C 1P4RA 1E79G 3EXAA 4DR3B 1P84F 2VWKA 3CB2A 3ABLB 2JS3A 1SERA 4QPJA 1JX9A 3JD4A 4DRXA 4OPHA 1A32A 5ITZA 1BL8A 4IL6Z 2B1GA 4X64O 4ICGA 4LFBB 2LW7A 3FB7C 1MG1A 4GX1A 1K4CC 3ZHRA 3RYHA 1Q90D 4O4LA 4DW1A 1VQ9V 2YXLA 2WA4A 4RQFA 4U3JB 4FFBB 3RBZA 4JI3O 4LF9O 1Q5OA 4I50A 1BQ0A 3ASOB 2CE4A 1SA0A 5JQGA 3HKCB 1VEWA 3BCCH 4U3FH 3TCUA 5L3EA 4I55B 2FKXA 3AEIA 1OV9A 2JIZG 1W2BU 2WAMA 2QM8A 1N32B 4RUFA 1Q7YW 2HG5C 3G6EV 4BAYA 3JATB 1MMMA 3H1IH 2HEPA 3K06A 5JCOA 3E22A 3OEEG 4YY3O 1FD9A 5JVDA 3A0RA 2FYUH 1IZ3A 2ZM6O 2Y0IA 4KP4A 2EIKC 1X59A 4JAUA 1T5EA 4YJ2B 3K5OA 1AI6A 1H2NA 4IHJA 2IM9A 1FXKA 4LF5B 1N36B 3CC4V 1JVMA 3QTCA 3E8FA 2M6YA 4YHHO 2ODMA 3CRMA 1KYOF 3FB8C 1GN4A 5IY5C 1N0NA 2JEUA 3GVMA 2XAHA 3A2FA 2QDOA 2YI8A 3VQVA 2OCCC 4B3SB 2Z5UA 1XNRB 1GM9A 3B09A 4QJFB 1URFA 3CRQA 3SGIA 3ZRSA 1K8AW 3OMNB 2DWEC 1M57B 4IYIA 4UVAA 3BHPA 4EKWA 3VQYA 5B5EZ 2JVDA 5EBMC 1ZUQA 1TUBB 4PV1B 1SKVA 2UUAO 1OCRC 2ZE5A 1SQBH 2BE3A 4JI7O 4PA7A 4BW9A 3QF7A 1KC8W 5LGTA 1MSDA 3FD9A 1S5LZ 5GONB 1YCIA 4Z2WA 4X20A 1FFXA 4WF9V 1HWYA 4FM1A 3LDCA 5J2UA 2BTQB 3K9SA 3OM3B 3E2EA 5FLXN 1G6UA 3ASNB 4DYLA 3CCRV 5H2FZ 1UPGA 1BHAA 1SS3A 1YVWA 2F95B 3U10A 5IJ9B 1F23A 3TETA 2EIJB 4BR6A 2UUCB 2WLNA 3RYCA 3B8NA 1MOFA 3I56V 2LW1A 3FB6C 4HYOA 4WFBV 1VQKV 4DV0B 1XMQB 1RSOB 3ZMSA 2NN4A 3ZRWB 1AVMA 1VQPV 3L74H 4JI4B 3DC6A 1ZL8B 3LNNA 2VQFO 1OCCC 4EFEA 5IYZA 4PA9A 3ETDA 1IXBA 2IH1C 3CXHF 3ZX6A 3TXSA 1E1QG 5D5PA 1US6A 2X6BA 2WA3A 1F4MA 4IYHA 4MVMA 1KP2A 4OPAA 1QLNA 1XHZA 4GKKB 2QKAA 4X1IA 5L3GA 5A9GA 1MZFA 4LR3A 2FL4A 3VQWA 2ZR3A 1BQZA 3IFXA 3OTFA 2YIDA 5K1PA 4R8CA 2GUZA 3UT5B 2IU3A 4NTYA 2AGAA 4LC1A 3ZMZA 1FXVA 3STZC 4CBCA 5LMUO 4QGPA 3MHHC 4LP8A 1EN4A 2E3CA 2QR4A 2ADPA 3JAWA 4MS2A 1YEWA 5IJ0A 2N74A 4BWAA 4TQFA 1R3IC 4I0XB 5DN6G 3LUTB 2PYJA 3M8AA 4YXWG 2YC0A 2R9RB 2H3OA 5FPOA 3DSQA 3SR2C 4GKJO 4O2AB 2F1MA 2D2CB 4JI8O 4IIJA 4E4EA 4EFBA 5J2TB 4NXNO 2Q4PA 3ZN0A 1JMKC 3HKBB 3OW2U 2DYRB 4DV2O 2GHYA 3AK3A 4MVRA 5CA0A 3IC7A 1XMOB 2GDSA 4HNAB 1YITV 4JI0B 2LGQA 2KQXA 3RYIB 1N33B 1KB9F 4OX9O 1AP6A 3WFVA 1V55B 4AI8A 2WPDG 5KUKA 1XBLA 1F51A 3CXCU 5L3BA 4JF3A 1WA8B 2EJRA 2YIBA 3SYOA 4P2ZA 3HKEA 2Z3YA 4LH7A 1Q6HA 2DJVA 2HP8A 5L3DA 2ITCC 3QO5A 2JGDB 4H37A 4R6ZA 4K8XA 3BA8A 4DV6O 2P67A 3SJCC 2EIMB 3AK1A 2WLLB 1VIBA 3ETQA 1PNKA 1XILA 4ZHQB 4TV9B 5C93A 3E8BA 3H01A 3ETEA 4J7ZA 2QTOA 2E76B 2EJ7A 2X6CA 2ZE7A 4LF5O 1N36O 1GM7A 1OCRB 4JAAA 1TVKA 2WLKA 4U7OA 2E74B 2Q0OC 4BIOA 3CRAA 2EINC 5AG2A 3ZMTA 1P49A 3G80A 3CC7V 4K35A 2KG7B 5DM6V 3W7XA 1HNWO 2DE0X 2Q73A 1B06A 2ZCEA 3EFFK 4GCZA 5HFLA 4B3SO 1XNRO 1OZ0A 5B66Z 4ZI7A 2R9IA 2YXHA 1IBKO 5B1NA 1H2LA 3L72H 4TV8B 1AILA 3L9DA 5BZBA 5B1BB 4DV3O 4E2LA 1IBMB 4KHPB 2HJFC 4J9ZB 5KMGA 5JJJB 4DV1B 1ORQC 2JK5C 5H9CA 5H5NA 5LMNB 4X1KA 2R72A 2P90A 2NR5A 4X65B 3U0ZA 3C3TA 4FLUA 3CS5A 5TISZ 1DTOA 1X4TA 1ZWIC 3J80N 4I4TB 4FLWA 1Q3EA 1NTKH 1KUQA 3AG1B 2XAJA 3BFRA 4Z1VA 3H1KH 3SYCA 4DO2A 3L70H 3M99B 2UXXA 1S76D 2JGUA 3ZHSA 4L87A 1D5AA 4UB8Z 1I08A 2Y48A 3B8MA 3OTOB 3K9AA 4DR4B 3RW0A 3QO7A 1MABG 5L3CA 1R3LC 2JJ1G 4DR1B 5IYBO 1UJWB 1GM8A 5D5QA 1WP7A 3AG3B 2ZR2A 2F4VB 1I5XA 4GX0A 3BY6A 4JYCA 1HR0B 1SF9A 3KG2A 2VQEO 5FNVB 1KKDA 2B9ZA 1SQXH 4GKKO 4DR6B 5CBGA 1EZJA 3K59A 2YIBD 3K08A 1Y74B 2AXTZ 1YTFB 1RM1C 4AHCA 1DF4A 5KLVH 3K0DA 4X62O 2IJKA 2BOCC 2XT9A 4LFAB 3JALA 4JI1B 4MVUA 1GN2A 1R1BA 5EBWC 2UUBB 5EYPA 3ZS8C 4MVSA 4HAMA 2V4DA 1GO3F 4K0KB 4AQYB 1M5IA 1IXMA 4UCUA 5LA6A 4B7KA 4J41A 4O4HB 3WB1A 4UB6Z 3RYFA 1XNQB 4DUZB 3TJTA 5K1XA 2HFEC 3JAKA 2XOKG 3ZMVA 1AJQA 2CTQA 4P9OA 4UCSA 3OD4A 2VRZA 3F5TA 3DTUB 2BSKB 1XMOO 4TUYA 3ZJZA 1QLEB 1YXBA 3QVNA 4LFCB 2H94A 3WB0A 3WG7C 3F7YC 1SESA 5BMVB 1PPJH 2LP7A 1VQMV 4ZKIA 1WP8A 1F7YA 4UVBA 2G38A 2WLHA 5LP6A 1RP3B 1U96A 1BT8A 2KB1A 1ENVA 3O65A 1SQQH 4U7NA 1BZKA 2LGWA 4J42A 2YEVB 4DR7B 1AI4A 3OR6C 3G71V 4O4IB 3IGAC 1VQ6V 3RGBA 3HKDB 4RAIA 2LO1A 1XDCA 1SETA 4H0LB 4FMTA 2OYQA 3JCZA 4DV5B 3AK2A 1BS3A 4Q6GA 1NR1A 2DMXA 3TXQA 3S3WA 1CP9A 3P32A 1VF6C 3ABKB 2PGGA 4LNUB 1VF5B 1M90W 4RUEA 1RPRA 2QA4V 2PI5A 4X88A 2Y69C 3JAMN 4EEQA 5LOVA 2WLIA 4UUJC 1YTFD 4LF7B 4J11A 1AR5A 2RNBA 3AG2C 2O57A 1N34O
chains in the Genus database with same CATH topology
1F23A 2JJ2G 2EIJB 3TETA 2A0LA 3NXSA 2W6IG 4JTCB 2DW4A 1VQ7V 1FFTB 3STLC 4H33A 2WLNA 5IDJA 3B8NA 1MOFA 1OCZB 5CBHA 3I56V 3ABMB 5B3SB 3FB6C 4HYOA 4I9WA 4WFBV 1VQKV 1PNLA 3OMAB 2W6JG 3ZMSA 3ZRWB 1VQPV 1K4DC 1QLEC 5L3FA 3P30A 1S77D 4TWKA 1QR8A 2MK3A 3K03A 4TT3G 5CA3A 3E35A 1OCCC 4G2KA 1KECA 4QPKA 2F43G 1NKDA 3OR7C 4ASUG 4ZBMA 4PA9A 3ETDA 1Y4MA 1QR9A 2IH1C 1K9MW 2V1DA 3X2QC 5LGNA 3CCVV 1E1QG 1Q82W 3OFNG 5LBQA 2X6BA 4WFEA 1M57C 1F4MA 5CBFA 4XDJA 5KA6A 4MVMA 1KP2A 1QLNA 3OMIB 1M9NA 1K73W 5L3GA 1B6QA 2IJJA 1E1RG 4XBFA 2ZR3A 1H38A 3IFXA 1CEZA 1S0VA 4G28B 4R8CA 4JYBA 5J9PC 3FB5C 2IU3A 3LDEA 3CCEV 4QNHB 4LC1A 2NLJC 4JAVA 3OE7G 3ZMZA 1FXVA 3STZC 3LSSA 4CBCA 3CMEV 1H8HG 3W7WA 2LFSA 4WFHA 3MHHC 3UM7A 2WWWA 2DQ0A 3SYQA 2ZDIC 3R65A 2HR3A 4LP8A 1DF5A 3AG4C 4LBEC 2ZXWC 1W0JG 3ZN1A 4MVZA 1K7DA 4MS2A 3E8GA 3ABKC 1VQ5V 3ASNC 1Q86W 1R3IC 4MW3A 3ETGA 4PA4A 3CD6V 5DN6G 3LUTB 4R50A 2Q6AA 2BOBC 2W0FC 1P7BA 4XDKA 4YXWG 5LGUA 2QKSA 3D36A 1JQ0A 1LNQA 3F5WC 2R9RB 5IYCO 3CYOA 1V54C 2IJHA 1FXKB 1GKFA 3FYIB 4PA6A 4UVCA 5IYDO 2EINB 2HVJC 2EIJC 4FIPC 2ZD9A 1EBOA 2AHYA 2GSMB 3JD0A 1OCZC 3RVZA 3G4SV 3ABMC 3E89A 5B3SC 3ZN0A 3OW2U 2DYRB 2GHYA 1OCOB 3FYEB 4N21A 1ROPA 5E1AC 2ZDIA 3DGEA 5KUMA 3B77A 4MVRA 4QE9A 3CMAV 2QEXV 4GX5A 2XAGA 5CMUA 2B5UA 1KP3A 3IC7A 4WFFA 1AI5A 3CCLV 3OEHG 1R6NA 1XL4A 4PA3A 1YITV 1K3EA 4PELA 2IW5A 3HB3B 2EILB 4X8AA 4PDRA 2HLDG 4MTGA 1FXHA 3T2MA 1NQTA 3WFVA 1V55B 1YI2V 3OUFA 1XL6A 2A79B 1JPXA 2WPDG 2XASA 5KUKA 2FTKA 1F51A 1R3KC 1YSCA 5L3BA 3CXCU 1AJPA 4HZ3A 4JF3A 1QQHA 1Y66A 1K97A 1YJNV 2DYSC 2EJRA 3SYOA 4P2ZA 4LCUC 3VBBA 4XDLA 4FPPA 1QCEA 2A9HA 1RPOA 2Z3YA 4WCEV 1QVGU 4P30A 5L3DA 3LDDA 3OGCC 2ITCC 3CCJV 3QO5A 4UV9A 3JD2A 4H37A 3GWOA 3JD1A 4R6ZA 3BEHA 2P67A 2NNUA 2WLJA 1AI7A 2EIMB 2WLLB 2IJIA 2XAQA 2QM7A 2Q67A 4MVQA 1PNKA 3CCSV 2X0LA 1R6KA 3ZMUA 2ITDC 4BW5A 5C93A 3E8BA 3H01A 4QE7A 3ETEA 1EFRG 2WLIB 2B1IA 2QTOA 3LSQA 2X6CA 4PDVA 1NBMG 3FKSG 1GM7A 1OCRB 3SPCA 2WLKA 3ML0A 4U7OA 4KFMA 1FXKC 1M56B 5LHIA 3OUSA 4UXNA 2EINC 3ZMTA 1R3JC 2XAFA 5EC2C 1FS0G 1S72V 3CC7V 3JD3A 1NH2D 1AR1B 3QNEA 5DM6V 3W7XA 2PI4A 1COWG 1DLBA 1H8EG 2CK3G 2DYRC 3E86A 3EFFK 4GCZA 5HFLA 1OCOC 1NH2B 2Q69A 4MVOA 1OZ0A 1KQSU 1K33A 2R9IA 1GTOA 3K04A 3CPWU 1QBZA 3F7VC 3ZIAG 1W0KG 5B1NA 1J95A 2WLMA 4Z1MG 3SJQC 4MTXA 2EILC 3T4DA 5BZBA 5B1BB 3K3WA 4E2LA 2H8PC 1KD1W 4GX2A 2AHZA 1JCHA 2HJFC 3E8HA 4J9ZB 1V55C 5B1AB 1RM1B 1VQ4V 2EBOA 4BIZA 4RO2A 2JK5C 1ORQC 3MHSC 3UKMA 1MSWD 5H9CA 4PDLA 2C2AA 5CN0A 1YHQV 4MT8A 2P90A 5HFMA 2YEVA 5FL7G 2IU0A 4WFAV 1YJ9V 1S3JA 2HVKC 1CPYA 4F4LA 1DTOA 3OAAG 1K5SA 1ZWIC 2IH3C 3CCUV 1I5YA 3SPHA 1K5QA 5EK0A 3SPIA 2OT5A 3X2QB 3AG1B 2XAJA 1VQOV 5EBLC 3SYCA 2EIMC 4DO2A 3ZRVA 1AROP 4JASA 1NVPD 4G27B 4DXWA 1JOYA 1H2GA 2EIKB 4JGSA 3M99B 2UXXA 3SYAA 1S76D 4N23A 3CP1A 2DWDC 4L87A 2DQ3A 1G8MA 2UXNA 2V7QG 1NVPB 1JJ2U 4JTAB 2Y48A 1TUEB 3B8MA 1M56C 1SZTA 1P4RA 1E79G 3K9AA 1AJNA 3RW0A 3QO7A 1MABG 5L3CA 1R3LC 3ABLB 2JJ1G 4FK5C 3SPJA 5IYBO 1SERA 4QPJA 1UJWB 1GM8A 1JX9A 3JD4A 3WG7B 1GK9A 4KUMA 5IY5B 1BL8A 3ZCCA 2B1GA 3AG3B 2ZQMA 2ZR2A 3ZRWA 1NJIW 3FB7C 1MG1A 4GX1A 1I5XA 4GX0A 3BY6A 1K4CC 4JYCA 4GT1A 2OCCB 3KG2A 1VQ9V 3JYCA 1KKDA 4RQFA 3RBZA 1L1FA 3RVYA 5CBGA 1V54B 4Q20A 1SRYA 3CCQV 1EZJA 3K08A 5B1BC 5LHHA 5H6RA 3ASOB 4MSWC 1YTFB 5B1AC 1RM1C 3PJSK 4WFGA 1DF4A 3TCUA 5L3EA 3K0DA 3AEIA 2JIZG 3ABTA 3SPGA 1W2BU 2WAMA 2IJKA 2QM8A 2BOCC 4RUFA 1PD3A 4MVUA 1VQLV 1Q7YW 4I5SA 2D3OW 5KA5A 5EBWC 2K1EA 2HG5C 3G6EV 4BAYA 2QE7G 3MD0A 1BHBA 4MW8A 4JPRA 3CCMV 3EHBB 4HAMA 4MVSA 5LHGA 2M7WA 1GO3F 4UV8A 3K06A 1R73A 3K0GA 3OEEG 2P6JA 1IXMA 3AG1C 2X6AA 4OXSA 1THZA 2EZOA 3W7TA 2WSSG 3A0RA 2Y69B 4KP4A 2EIKC 3TK1A 2OTLV 4JAUA 4RQEA 2DYSB 4P9PA 1WPXA 3AG2B 2XNDG 1Q81W 3SYPA 1AI6A 1G4YB 3W7SA 1PL0A 2HFEC 2Q68A 2XOKG 3ZMVA 1FXKA 1AJQA 4X89A 3CC4V 3T4ZA 1JVMA 5EC1C 3E8FA 4P9OA 3ABLC 4R7CA 3DTUB 1GMGA 3ZJZA 1QLEB 1M1KW 3FB8C 1YJWV 2H94A 3WG7C 1PKXA 1SESA 3F7YC 4J9YB 5IY5C 3AG3C 3K79A 2JEUA 2LP7A 2XAHA 1VQMV 4ZKIA 3ZRXA 1OCCB 1F4NA 4UVBA 2OCCC 4FJCC 2P7TC 3W7UA 3HPLC 2YSUB 2Z5UA 3T1CA 4MTFA 1GM9A 4PDMA 4JTDB 3QO8A 2WLHA 4QJFB 3ZRSA 1K8AW 3OMNB 3LNMB 4CZZA 2DWEC 1M57B 2KB1A 4UVAA 3I55V 3ASOC 4BIUA 1ENVA 1K34A 2LFRA 4EKWA 1OHHG 3E83A 4U7NA 5EBMC 2JEXA 2YEVB 1VQ8V 3D3IA 1AI4A 2EZPA 1OCRC 3OR6C 4MTOA 2X7RB 3G71V 1N8RW 3VOUA 3IGAC 1NR7A 4QIWF 1VQ6V 4PA7A 4RAIA 1YIJV 1KC8W 5LGTA 1SETA 4FMTA 3ABUA 1PNMA 3JCZA 2OTJV 5H6QA 1NR1A 5B1OA 4WF9V 1WLEA 1HWYA 3LDCA 1CP9A 3AG4B 2ZXWB 1S5HC 3OM3B 3P32A 3E2EA 1BMFG 3ABKB 3ASNB 1M90W 4RUEA 1RPRA 2WLLA 3CCRV 3CC2V 2HKOA 2QA4V 4TSFG 5GW7A 2PI5A 4X88A 2Y69C 1BHAA 2WLIA 1QVFU 1K92A 4UUJC 1YTFD 3GB7C 1VQNV 2JDIG 2ATKC 3AG2C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JEU A;  1QQH A;  1R6K A;  2JEX A;  1DTO A;  1R6N A;  2NNU A;  1TUE B; 
#chains in the Genus database with same CATH topology
 1XHX A;  2A0L A;  1VQ7 V;  5EZY A;  1FFT B;  5CBH A;  3ABM B;  1Y76 A;  4DRX B;  1SQG A;  2QJ1 A;  3OMA B;  4JI5 B;  5ITZ B;  4DR2 B;  2W6J G;  1K4D C;  3ICX A;  5L3F A;  2XTA A;  1WNS A;  4I7Z B;  3RYH B;  2MK3 A;  3JCU Z;  4O4L B;  4TT3 G;  2UXB O;  5CA3 A;  3IAY A;  1KEC A;  1NKD A;  4ASU G;  4YIP A;  1Y4M A;  1QR9 A;  4B3T B;  1K9M W;  2V1D A;  4I50 B;  3CCV V;  1SA0 B;  5LBQ A;  5JQG B;  4J80 A;  4IGG A;  5CBF A;  3OMI B;  3DC5 A;  1B6Q A;  3T1Y B;  4XBF A;  1BGY H;  1H38 A;  3ZED A;  1FJG B;  2CGO A;  1M4U A;  4G28 B;  4JYB A;  1HW7 A;  3LDE A;  3MDS A;  3CCE V;  4QNH B;  3LSU A;  4JAV A;  2LJ2 A;  5CB4 A;  4FZ1 A;  5JH7 A;  4LH6 A;  1H8H G;  3W7W A;  3K58 A;  1I0H A;  3E22 B;  4WFH A;  3SYQ A;  2A3Q A;  5JVD B;  2UU9 B;  4PJ0 Z;  3AG4 C;  2ZXW C;  3AG7 A;  3E8G A;  1JFF A;  4WBN A;  1I94 O;  2PYL A;  3OTO O;  2Q6A A;  2BOB C;  4IHJ B;  1JQ0 A;  4W4K A;  1YZB A;  1V54 C;  1FXK B;  3FYI B;  1XEQ A;  5KX5 A;  5IYD O;  3B40 A;  2YXY A;  2HVJ C;  2AHY A;  2GSM B;  3JD0 A;  2F4V O;  1EN5 A;  1OCZ C;  2R70 A;  5B3S C;  2RQ6 A;  1Q6U A;  4LF4 O;  2Y0P A;  4N21 A;  1ROP A;  5E1A C;  1WN7 A;  4DR6 O;  3B77 A;  2QEX V;  4GX5 A;  2B5U A;  4EB6 A;  1KP3 A;  4WFF A;  3CCL V;  4JI6 O;  3BPZ A;  4PA3 A;  4JI2 B;  1M93 A;  3HB3 B;  2L6L A;  2EUL A;  2EIL B;  1Z2G A;  4PDR A;  2E5L B;  1N0J A;  3T2M A;  4B3R B;  1KU9 A;  3OUF A;  1U97 A;  4PI2 A;  5IWA O;  1QQH A;  1K97 A;  4JYA B;  3VBB A;  4FPP A;  4JV5 B;  2A9H A;  1RPO A;  4WCE V;  5JJN B;  2PZS A;  4X20 B;  1FFX B;  3LDD A;  3CCJ V;  5KHJ A;  4GYC B;  5J2U B;  3GWO A;  3JD1 A;  4KL1 A;  3B2E E;  2NNU A;  3MAQ A;  1ZAU A;  1WJZ A;  2ITD C;  4BW5 A;  4DUZ O;  1VF6 A;  3D3Q A;  3LSQ A;  2N05 A;  3CRC A;  4PDV A;  4JZG A;  3SPC A;  2VWJ A;  4FLY A;  4KFM A;  1FAF A;  1M56 B;  3RYC B;  3OUS A;  4UCV A;  1R3J C;  4LFC O;  1GRJ A;  1FS0 G;  1S72 V;  3KKY A;  2PI4 A;  4CC5 A;  1DLB A;  2CK3 G;  1OCO C;  2CAZ C;  1K33 A;  4DV4 B;  1N4C A;  1GTO A;  1HP8 A;  5IYZ B;  3K04 A;  1QBZ A;  4O2B A;  1XOU A;  5FPR A;  2L35 A;  3ZHV A;  1J95 A;  1SC5 B;  4CS2 A;  4Z1M G;  3SJQ C;  4MTX A;  3B4S A;  2F93 B;  3T4D A;  1EZV H;  3T1H O;  1O9H A;  2AHZ A;  4DK1 A;  3E8H A;  4X66 B;  1VQ4 V;  4X1I B;  4RO2 A;  4DR3 O;  2E75 B;  1MSW D;  1YHQ V;  2GUZ B;  2PUS A;  5HFM A;  5FL7 G;  2IU0 A;  1YJ9 V;  5KHI A;  1S3J A;  2HVK C;  3CJH A;  3KCX A;  3KZI Z;  5CA1 A;  4LFB O;  1I5Y A;  2IBZ H;  4UCR A;  3UO2 A;  1PM9 A;  3CEI A;  4CH6 A;  3JAW B;  5IJ0 B;  1VQO V;  2OIE A;  4J10 A;  3K57 A;  1NVP D;  4I9Q A;  2UXD B;  5EIB C;  2EIK B;  1MZE A;  2GBO A;  3L71 H;  1G8M A;  3CWB H;  2V7Q G;  2Q8V A;  4PHZ A;  1HNX B;  4JI5 O;  2HJD A;  4IIJ B;  4DR2 O;  1N32 O;  4LF8 B;  1H2M A;  3CX5 F;  3CSX A;  1EM1 A;  4NKG B;  3P3N A;  1GK9 A;  5CA0 B;  5IY5 B;  3ZCC A;  4NVP A;  4D7T A;  4DR5 B;  4O4J A;  2OCC B;  5BXZ A;  4YIO A;  1S5J A;  2CH7 A;  1UFI A;  2JRI A;  2YIA A;  1L1F A;  1V54 B;  3S3X A;  3T1Y O;  5H6R A;  4MSW C;  5B1A C;  1NT2 B;  2KKW A;  3HKE B;  3N2K A;  3SPG A;  1LUV A;  1PD3 A;  1VQL V;  1IDS A;  1TAE A;  4L8J A;  3G67 A;  3JAS A;  2D3O W;  5KA5 A;  4HBN A;  2K1E A;  2CTW A;  2QE7 G;  3MD0 A;  2K9P A;  1KMI Z;  1D5N A;  4JPR A;  3EHB B;  4UV8 A;  1R73 A;  3K0G A;  4X64 B;  3N2G A;  2FB5 A;  2P6J A;  2X6A A;  2ZIM A;  4OXS A;  1XRE A;  2EZO A;  3K5L A;  4ABM A;  2ZE6 A;  1V9P A;  1TVK B;  3D36 C;  2OTL V;  3BRC A;  5LP6 C;  4YJ3 A;  4JI3 B;  4LF9 B;  4UCO A;  2XND G;  1Q81 W;  1GH6 A;  3W7S A;  3J81 N;  3RN4 A;  2Q68 A;  3DXR A;  1YDX A;  2QM4 A;  5EC1 C;  3ABL C;  1B3Q A;  1M1K W;  4ZI7 B;  4JI2 O;  4J9Y B;  1PKX A;  3CRR A;  1FYJ A;  3BAA A;  1OCC B;  4X1Y A;  1F4N A;  2ADQ B;  3HPL C;  1GN6 A;  2ILM A;  2Q7E A;  3O9O A;  4PDM A;  4JTD B;  5LYJ A;  4YY3 B;  1KBH A;  5KMG B;  1WAZ A;  1Q8I A;  4CZZ A;  1AR4 A;  1J5E B;  2ZM6 B;  3I55 V;  1KKC A;  3ASO C;  4BIU A;  3FAV A;  4AIL C;  1D2D A;  4DV7 B;  1OHH G;  2UUC O;  3NR7 A;  4X1K B;  2JEX A;  1VQ8 V;  3D3I A;  2EZP A;  4MTO A;  5C8Y A;  1N8R W;  2XUM A;  4QIW F;  4DV0 O;  1XMQ O;  2QWO B;  1HDJ A;  2Q5Z A;  4JI4 O;  3THO A;  3ABU A;  1PNM A;  4CH4 A;  2FML A;  4YHH B;  1L0N H;  5B1O A;  1H2S B;  1WLE A;  1PP9 H;  4CH3 A;  1S5H C;  3UO3 A;  1NI8 A;  1WPB A;  2Q7G A;  1TA8 A;  3CC2 V;  2CGN A;  2HKO A;  2YS8 A;  4TSF G;  4B7E A;  1QVF U;  4JZ2 A;  4LWS A;  3GB7 C;  5JWP A;  1VQN V;  1XUQ A;  3OGI B;  5KHH A;  1SQV H;  4IT5 A;  2W6I G;  1FKA O;  3BA9 A;  3CE2 A;  3STL C;  4H33 A;  5IDJ A;  2UUA B;  4F6R A;  4JI7 B;  3ZHT A;  3P30 A;  1S77 D;  1QR8 A;  4OGQ B;  3K03 A;  4UCT A;  2ZNI A;  1LR1 A;  1ZSP A;  4G2K A;  4QPK A;  2F43 G;  3OR7 C;  4X9Q A;  5BY1 A;  4ZBM A;  2QGN A;  4X66 O;  3X2Q C;  5LGN A;  5KAF Z;  1SQP H;  3OFN G;  2RMK B;  1NTZ H;  4WFE A;  1M57 C;  5KA6 A;  4XDJ A;  1IBL B;  1M9N A;  1NS1 A;  4LF6 B;  3JAL B;  2QKC A;  2IJJ A;  1E1R G;  1S0V A;  4CS4 A;  3RWR D;  5EYP B;  5DEC A;  5LXT A;  3FB5 C;  3JAR A;  5GTH Z;  2NLJ C;  2DN9 A;  3LSS A;  4ZOL A;  4GUN A;  5LL6 Y;  1DGS A;  2WWW A;  2DQ0 A;  2P4V A;  5LA6 B;  5BR8 B;  2Q0A A;  4JI0 O;  1IX9 A;  3ZN1 A;  1QHT A;  1N33 O;  2VQF B;  2ZE8 A;  3ASN C;  1VQ5 V;  3UQ8 A;  3RYF B;  2W0F C;  1P7B A;  3Q4H A;  3D36 A;  3F5W C;  5IYC O;  2GTA A;  2IJH A;  3JAK B;  1GKF A;  4NTX A;  4UVC A;  2EIN B;  4FIP C;  2EIJ C;  1EBO A;  4FZ0 A;  2KSD A;  4TUY B;  3E89 A;  2ZNJ A;  3FYE B;  2ZDI A;  4DUY B;  2QWR B;  5LMU B;  2XAG A;  1HNZ B;  3OEH G;  1IUR A;  1R6N A;  1K3E A;  5LP6 B;  2IW5 A;  2CDY A;  1MA1 A;  2A06 H;  3VQX A;  1VAR A;  4MTG A;  4NTW A;  1FXH A;  4U3J A;  4FFB A;  1NQT A;  1YI2 V;  1GAX A;  1XL6 A;  2A79 B;  2XAS A;  2FTK A;  1G1X B;  1R3K C;  1YSC A;  4HZ3 A;  3HKC A;  2DYS C;  4GKJ B;  4I55 A;  4LCU C;  1Q43 A;  2RN9 A;  4JI8 B;  1QCE A;  1QU7 A;  4NXN B;  3A8T A;  3OGC C;  3ZBH A;  4DV2 B;  3JAT A;  1NZ6 A;  5EIB D;  1WB7 A;  1AI7 A;  2WLJ A;  2XAQ A;  2QM7 A;  2Q67 A;  4MVQ A;  2X0L A;  1R6K A;  1IBM O;  4QE7 A;  1OJH A;  5LOV B;  4KHP O;  2WLI B;  2XHB A;  4DV1 O;  3FKS G;  3HR0 A;  4OX9 B;  5LMN O;  5EZY B;  4FM2 A;  5LHI A;  4X65 O;  4YJ2 A;  1Y76 B;  2XAF A;  5EC2 C;  3JSL A;  3JD3 A;  1NH2 D;  1AR1 B;  5A2Q N;  2DYR C;  3E86 A;  2Q69 A;  4MVO A;  2ZIN A;  4CC6 A;  4TOI A;  3CPW U;  3F7V C;  3ZIA G;  1J5E O;  1W0K G;  4DV6 B;  4DV7 O;  2WLM A;  3BAB A;  4GX2 A;  2GTS A;  1RM1 B;  1V55 C;  4BIZ A;  4DR4 O;  1Z5W A;  3MHS C;  3UKM A;  4D7S A;  4DR1 O;  1TUB A;  4C7U A;  3IC9 A;  1IVS A;  4WFA V;  5CB4 B;  2RJZ A;  4FLX A;  5JH7 B;  3OAA G;  1K5S A;  1VMG A;  1HNW B;  2EX3 A;  3SPH A;  1K5Q A;  1HR0 O;  1WB8 A;  3SPI A;  2MW2 B;  5GON A;  2OT5 A;  5F2V O;  3D8C A;  1CXZ B;  3X2Q B;  3SDL A;  5EBL C;  1IBK B;  1JFF B;  1QQC A;  2EIM C;  2W0X A;  4WBN B;  3ZRV A;  2UXC B;  4NR1 A;  4JAS A;  2BTQ A;  4NXM B;  1O9G A;  3OT7 A;  3G6B A;  1H2G A;  3H1J H;  2ZIO A;  4JGS A;  3SYA A;  3APO A;  4N23 A;  3CP1 A;  3C90 A;  2DQ3 A;  5KX5 B;  4DV3 B;  1NVP B;  1JJ2 U;  4JTA B;  4LFA O;  4JI1 O;  1QNM A;  1SZT A;  5IJ9 A;  1AJN A;  4D6T H;  5IT9 N;  2UUB O;  4FK5 C;  2BCC H;  3SPJ A;  4UFZ A;  1ZX3 A;  4B3M O;  4K0K O;  2ZT9 B;  3WG7 B;  4KUM A;  4EB6 B;  1RSO A;  2ZQM A;  4AQY O;  3ZRW A;  1NJI W;  1NU1 H;  4GT1 A;  1B04 A;  1ZL8 A;  1IBL O;  3JYC A;  3RVY A;  4LF6 O;  3CCQ V;  4Q20 A;  1SRY A;  1XNQ O;  5B1B C;  5LHH A;  3BVO A;  3PJS K;  4WFG A;  2Y4T A;  3ABT A;  4FLT A;  4PI0 A;  1BE3 H;  4I5S A;  5BR8 O;  3N27 A;  1BHB A;  3H1H H;  4MW8 A;  3UT5 A;  2YI9 A;  3CCM V;  2Z0A A;  5LHG A;  2M7W A;  2JS5 A;  2Q9L A;  3C3S A;  3AG1 C;  1THZ A;  3W7T A;  2WSS G;  2VQE B;  2Y69 B;  1XQ8 A;  3TK1 A;  1Q6I A;  1JJO A;  4RQE A;  2YUA A;  2DYS B;  4P9P A;  4DR7 O;  2BTO A;  1WPX A;  3AG2 B;  4I0X A;  3SYP A;  1G4Y B;  1PL0 A;  3GWK C;  4O2A A;  4X89 A;  4DUY O;  3T4Z A;  4X62 B;  1LUW A;  2AW9 A;  4R7C A;  1HNZ O;  2N04 A;  5J2T A;  2OIG A;  1GMG A;  4A5U B;  4DV5 O;  5IE9 A;  1YJW V;  3HKB A;  3A0B Z;  3QG5 A;  4O2B B;  3AG3 C;  3K79 A;  5KHK A;  3ZRX A;  4FJC C;  2P7T C;  4F6E A;  3W7U A;  4FLV A;  2YSU B;  3T1C A;  2R9A A;  4MTF A;  4HNA A;  2CTP A;  3QO8 A;  2HHH B;  5DED A;  4LF7 O;  2RDC A;  3LNM B;  3U11 A;  1JR9 A;  3RYI A;  1K34 A;  2LFR A;  3H9V A;  3E83 A;  4FLZ A;  1AB3 A;  5KHG A;  2X7R B;  3CJH B;  3VOU A;  1NR7 A;  2OCH A;  5CA1 B;  1WA8 A;  4GZR B;  3IJ4 A;  1YIJ V;  3ZHU A;  2OTJ V;  4FFK A;  5H6Q A;  1EN6 A;  3R66 A;  2QWQ B;  2JGD A;  2QTS A;  3AG4 B;  4B3T O;  2ZXW B;  1BMF G;  2WLL A;  4TQD A;  4ZHQ A;  5GW7 A;  4TV9 A;  1K92 A;  4J7K A;  2JDI G;  2ATK C;  4DK0 A;  2P06 A;  2JJ2 G;  3NXS A;  4JTC B;  2DW4 A;  1FJG O;  4NB5 A;  1SZX A;  4B08 A;  1OCZ B;  3WB2 A;  5B3S B;  1L8D A;  3L75 H;  4I9W A;  1Y67 A;  1PNL A;  2KG7 A;  1QLE C;  4O4J B;  2UU9 O;  1Z5V A;  2ARH A;  4TWK A;  2CH7 B;  3E35 A;  3K5N A;  1RFY A;  1ZTE A;  1Q82 W;  4TV8 A;  3K5M A;  1R6T A;  2LQT A;  3N2K B;  1K73 W;  1N34 B;  2YDE A;  3JAS B;  1CEZ A;  2P22 C;  4H13 B;  5J9P C;  3CHX A;  3ZHQ A;  4CH5 A;  2YIC A;  5E79 Z;  3OE7 G;  1SQF A;  2UXC O;  2QSA A;  2QWP B;  3CME V;  3N2G B;  2LFS A;  4NXM O;  4I4T A;  3UM7 A;  2ZDI C;  3R65 A;  5JJE B;  2HR3 A;  2Q7H A;  4KXR A;  1DF5 A;  4LBE C;  1W0J G;  3L73 H;  4MVZ A;  1K7D A;  1P7G A;  2UXB B;  2E5L O;  3H1L H;  3ABK C;  3KCY A;  1Q86 W;  4YJ3 B;  4B3R O;  1PV0 A;  2P4K A;  2CTR A;  3EVK A;  4MW3 A;  3ETG A;  4PA4 A;  3CD6 V;  1VF7 A;  4R50 A;  2DOS A;  5LGU A;  3APQ A;  4XDK A;  2QKS A;  1LNQ A;  3DXR B;  3CYO A;  4PA6 A;  4JYA O;  2ZD9 A;  2PTM A;  4JV5 O;  1YF2 A;  3RVZ A;  3G4S V;  3ABM C;  3SJA C;  1OCO B;  4PD4 F;  1I7F A;  1FPO A;  1Y6X A;  4K8Z A;  3DGE A;  4X1Y B;  5KUM A;  3CMA V;  4QE9 A;  1AP5 A;  5CMU A;  1AI5 A;  5LYJ B;  1XL4 A;  1MNG A;  4NYK A;  4PEL A;  1BSM A;  5FNV A;  4X8A A;  2HLD G;  2AZ2 A;  3FAV B;  4GLX A;  3M7M X;  1I94 B;  1JPX A;  4CS3 A;  3A0H Z;  1Y74 A;  5C8Y B;  1AJP A;  1Y66 A;  1YJN V;  2ZKO A;  4DW0 A;  1VP7 A;  4J7J A;  4XDL A;  2P5O A;  1QVG U;  4P30 A;  4DV4 O;  1BCC H;  4UV9 A;  3J7A U;  3JD2 A;  5JCO C;  4LF4 B;  3BEH A;  4RWU A;  2IJI A;  5GTI Z;  3CCS V;  1GN3 A;  2RCV A;  3ZMU A;  4JI6 B;  1EFR G;  2A7W A;  2B1I A;  4LWS B;  3P3P A;  2F23 A;  2VS0 A;  3UCS C;  1NBM G;  4O4H A;  3SJB C;  3ML0 A;  1XI1 A;  1FXK C;  4UXN A;  2ETN A;  5KAI Z;  4F6R B;  4FVM A;  5IWA B;  3QNE A;  1COW G;  1H8E G;  1TGO A;  4FM0 A;  1NH2 B;  2BSK A;  1KQS U;  2HHH O;  2PF4 E;  3PN1 A;  5BMV A;  3TGU H;  4ZIB A;  2UXD O;  4JYY A;  2Y4U A;  2EIL C;  2OWO A;  1JA8 A;  3K3W A;  2H8P C;  1KD1 W;  3RFR A;  1HNX O;  1JCH A;  5B1A B;  2EBO A;  2PY5 A;  4PDL A;  1L0L H;  1DK1 A;  4LF8 O;  2GV9 A;  2C2A A;  2CUG A;  5CN0 A;  4MT8 A;  5LXT B;  3JAR B;  2YEV A;  3RT3 C;  1W59 A;  1CPY A;  4F4L A;  2QWN B;  4O4I A;  4ZOL B;  3I5D A;  2IH3 C;  3CCU V;  3HKD A;  4DR5 O;  3FFQ A;  5EK0 A;  1NTM H;  3FX7 A;  1PL4 A;  3WU2 Z;  2F66 C;  1ARO P;  4G27 B;  4W4L A;  4DXW A;  1JOY A;  3Q4H B;  4LNU A;  4K3A A;  2AZ0 A;  1H2K A;  2DWD C;  1ZLZ A;  3T1H B;  2UXN A;  4B3M B;  3JSN A;  4H44 B;  1TUE B;  1M56 C;  1P4R A;  1E79 G;  3EXA A;  4DR3 B;  1P84 F;  2VWK A;  3CB2 A;  3ABL B;  2JS3 A;  1SER A;  4QPJ A;  1JX9 A;  3JD4 A;  4DRX A;  4OPH A;  1A32 A;  5ITZ A;  1BL8 A;  4IL6 Z;  2B1G A;  4X64 O;  4ICG A;  4LFB B;  2LW7 A;  3FB7 C;  1MG1 A;  4GX1 A;  1K4C C;  3ZHR A;  3RYH A;  1Q90 D;  4O4L A;  4DW1 A;  1VQ9 V;  2YXL A;  2WA4 A;  4RQF A;  4U3J B;  4FFB B;  3RBZ A;  4JI3 O;  4LF9 O;  1Q5O A;  4I50 A;  1BQ0 A;  3ASO B;  2CE4 A;  1SA0 A;  5JQG A;  3HKC B;  1VEW A;  3BCC H;  4U3F H;  3TCU A;  5L3E A;  4I55 B;  2FKX A;  3AEI A;  1OV9 A;  2JIZ G;  1W2B U;  2WAM A;  2QM8 A;  1N32 B;  4RUF A;  1Q7Y W;  2HG5 C;  3G6E V;  4BAY A;  3JAT B;  1MMM A;  3H1I H;  2HEP A;  3K06 A;  5JCO A;  3E22 A;  3OEE G;  4YY3 O;  1FD9 A;  5JVD A;  3A0R A;  2FYU H;  1IZ3 A;  2ZM6 O;  2Y0I A;  4KP4 A;  2EIK C;  1X59 A;  4JAU A;  1T5E A;  4YJ2 B;  3K5O A;  1AI6 A;  1H2N A;  4IHJ A;  2IM9 A;  1FXK A;  4LF5 B;  1N36 B;  3CC4 V;  1JVM A;  3QTC A;  3E8F A;  2M6Y A;  4YHH O;  2ODM A;  3CRM A;  1KYO F;  3FB8 C;  1GN4 A;  5IY5 C;  1N0N A;  2JEU A;  3GVM A;  2XAH A;  3A2F A;  2QDO A;  2YI8 A;  3VQV A;  2OCC C;  4B3S B;  2Z5U A;  1XNR B;  1GM9 A;  3B09 A;  4QJF B;  1URF A;  3CRQ A;  3SGI A;  3ZRS A;  1K8A W;  3OMN B;  2DWE C;  1M57 B;  4IYI A;  4UVA A;  3BHP A;  4EKW A;  3VQY A;  5B5E Z;  2JVD A;  5EBM C;  1ZUQ A;  1TUB B;  4PV1 B;  1SKV A;  2UUA O;  1OCR C;  2ZE5 A;  1SQB H;  2BE3 A;  4JI7 O;  4PA7 A;  4BW9 A;  3QF7 A;  1KC8 W;  5LGT A;  1MSD A;  3FD9 A;  1S5L Z;  5GON B;  1YCI A;  4Z2W A;  4X20 A;  1FFX A;  4WF9 V;  1HWY A;  4FM1 A;  3LDC A;  5J2U A;  2BTQ B;  3K9S A;  3OM3 B;  3E2E A;  5FLX N;  1G6U A;  3ASN B;  4DYL A;  3CCR V;  5H2F Z;  1UPG A;  1BHA A;  1SS3 A;  1YVW A;  2F95 B;  3U10 A;  5IJ9 B;  1F23 A;  3TET A;  2EIJ B;  4BR6 A;  2UUC B;  2WLN A;  3RYC A;  3B8N A;  1MOF A;  3I56 V;  2LW1 A;  3FB6 C;  4HYO A;  4WFB V;  1VQK V;  4DV0 B;  1XMQ B;  1RSO B;  3ZMS A;  2NN4 A;  3ZRW B;  1AVM A;  1VQP V;  3L74 H;  4JI4 B;  3DC6 A;  1ZL8 B;  3LNN A;  2VQF O;  1OCC C;  4EFE A;  5IYZ A;  4PA9 A;  3ETD A;  1IXB A;  2IH1 C;  3CXH F;  3ZX6 A;  3TXS A;  1E1Q G;  5D5P A;  1US6 A;  2X6B A;  2WA3 A;  1F4M A;  4IYH A;  4MVM A;  1KP2 A;  4OPA A;  1QLN A;  1XHZ A;  4GKK B;  2QKA A;  4X1I A;  5L3G A;  5A9G A;  1MZF A;  4LR3 A;  2FL4 A;  3VQW A;  2ZR3 A;  1BQZ A;  3IFX A;  3OTF A;  2YID A;  5K1P A;  4R8C A;  2GUZ A;  3UT5 B;  2IU3 A;  4NTY A;  2AGA A;  4LC1 A;  3ZMZ A;  1FXV A;  3STZ C;  4CBC A;  5LMU O;  4QGP A;  3MHH C;  4LP8 A;  1EN4 A;  2E3C A;  2QR4 A;  2ADP A;  3JAW A;  4MS2 A;  1YEW A;  5IJ0 A;  2N74 A;  4BWA A;  4TQF A;  1R3I C;  4I0X B;  5DN6 G;  3LUT B;  2PYJ A;  3M8A A;  4YXW G;  2YC0 A;  2R9R B;  2H3O A;  5FPO A;  3DSQ A;  3SR2 C;  4GKJ O;  4O2A B;  2F1M A;  2D2C B;  4JI8 O;  4IIJ A;  4E4E A;  4EFB A;  5J2T B;  4NXN O;  2Q4P A;  3ZN0 A;  1JMK C;  3HKB B;  3OW2 U;  2DYR B;  4DV2 O;  2GHY A;  3AK3 A;  4MVR A;  5CA0 A;  3IC7 A;  1XMO B;  2GDS A;  4HNA B;  1YIT V;  4JI0 B;  2LGQ A;  2KQX A;  3RYI B;  1N33 B;  1KB9 F;  4OX9 O;  1AP6 A;  3WFV A;  1V55 B;  4AI8 A;  2WPD G;  5KUK A;  1XBL A;  1F51 A;  3CXC U;  5L3B A;  4JF3 A;  1WA8 B;  2EJR A;  2YIB A;  3SYO A;  4P2Z A;  3HKE A;  2Z3Y A;  4LH7 A;  1Q6H A;  2DJV A;  2HP8 A;  5L3D A;  2ITC C;  3QO5 A;  2JGD B;  4H37 A;  4R6Z A;  4K8X A;  3BA8 A;  4DV6 O;  2P67 A;  3SJC C;  2EIM B;  3AK1 A;  2WLL B;  1VIB A;  3ETQ A;  1PNK A;  1XIL A;  4ZHQ B;  4TV9 B;  5C93 A;  3E8B A;  3H01 A;  3ETE A;  4J7Z A;  2QTO A;  2E76 B;  2EJ7 A;  2X6C A;  2ZE7 A;  4LF5 O;  1N36 O;  1GM7 A;  1OCR B;  4JAA A;  1TVK A;  2WLK A;  4U7O A;  2E74 B;  2Q0O C;  4BIO A;  3CRA A;  2EIN C;  5AG2 A;  3ZMT A;  1P49 A;  3G80 A;  3CC7 V;  4K35 A;  2KG7 B;  5DM6 V;  3W7X A;  1HNW O;  2DE0 X;  2Q73 A;  1B06 A;  2ZCE A;  3EFF K;  4GCZ A;  5HFL A;  4B3S O;  1XNR O;  1OZ0 A;  5B66 Z;  4ZI7 A;  2R9I A;  2YXH A;  1IBK O;  5B1N A;  1H2L A;  3L72 H;  4TV8 B;  1AIL A;  3L9D A;  5BZB A;  5B1B B;  4DV3 O;  4E2L A;  1IBM B;  4KHP B;  2HJF C;  4J9Z B;  5KMG A;  5JJJ B;  4DV1 B;  1ORQ C;  2JK5 C;  5H9C A;  5H5N A;  5LMN B;  4X1K A;  2R72 A;  2P90 A;  2NR5 A;  4X65 B;  3U0Z A;  3C3T A;  4FLU A;  3CS5 A;  5TIS Z;  1DTO A;  1X4T A;  1ZWI C;  3J80 N;  4I4T B;  4FLW A;  1Q3E A;  1NTK H;  1KUQ A;  3AG1 B;  2XAJ A;  3BFR A;  4Z1V A;  3H1K H;  3SYC A;  4DO2 A;  3L70 H;  3M99 B;  2UXX A;  1S76 D;  2JGU A;  3ZHS A;  4L87 A;  1D5A A;  4UB8 Z;  1I08 A;  2Y48 A;  3B8M A;  3OTO B;  3K9A A;  4DR4 B;  3RW0 A;  3QO7 A;  1MAB G;  5L3C A;  1R3L C;  2JJ1 G;  4DR1 B;  5IYB O;  1UJW B;  1GM8 A;  5D5Q A;  1WP7 A;  3AG3 B;  2ZR2 A;  2F4V B;  1I5X A;  4GX0 A;  3BY6 A;  4JYC A;  1HR0 B;  1SF9 A;  3KG2 A;  2VQE O;  5FNV B;  1KKD A;  2B9Z A;  1SQX H;  4GKK O;  4DR6 B;  5CBG A;  1EZJ A;  3K59 A;  2YIB D;  3K08 A;  1Y74 B;  2AXT Z;  1YTF B;  1RM1 C;  4AHC A;  1DF4 A;  5KLV H;  3K0D A;  4X62 O;  2IJK A;  2BOC C;  2XT9 A;  4LFA B;  3JAL A;  4JI1 B;  4MVU A;  1GN2 A;  1R1B A;  5EBW C;  2UUB B;  5EYP A;  3ZS8 C;  4MVS A;  4HAM A;  2V4D A;  1GO3 F;  4K0K B;  4AQY B;  1M5I A;  1IXM A;  4UCU A;  5LA6 A;  4B7K A;  4J41 A;  4O4H B;  3WB1 A;  4UB6 Z;  3RYF A;  1XNQ B;  4DUZ B;  3TJT A;  5K1X A;  2HFE C;  3JAK A;  2XOK G;  3ZMV A;  1AJQ A;  2CTQ A;  4P9O A;  4UCS A;  3OD4 A;  2VRZ A;  3F5T A;  3DTU B;  2BSK B;  1XMO O;  4TUY A;  3ZJZ A;  1QLE B;  1YXB A;  3QVN A;  4LFC B;  2H94 A;  3WB0 A;  3WG7 C;  3F7Y C;  1SES A;  5BMV B;  1PPJ H;  2LP7 A;  1VQM V;  4ZKI A;  1WP8 A;  1F7Y A;  4UVB A;  2G38 A;  2WLH A;  5LP6 A;  1RP3 B;  1U96 A;  1BT8 A;  2KB1 A;  1ENV A;  3O65 A;  1SQQ H;  4U7N A;  1BZK A;  2LGW A;  4J42 A;  2YEV B;  4DR7 B;  1AI4 A;  3OR6 C;  3G71 V;  4O4I B;  3IGA C;  1VQ6 V;  3RGB A;  3HKD B;  4RAI A;  2LO1 A;  1XDC A;  1SET A;  4H0L B;  4FMT A;  2OYQ A;  3JCZ A;  4DV5 B;  3AK2 A;  1BS3 A;  4Q6G A;  1NR1 A;  2DMX A;  3TXQ A;  3S3W A;  1CP9 A;  3P32 A;  1VF6 C;  3ABK B;  2PGG A;  4LNU B;  1VF5 B;  1M90 W;  4RUE A;  1RPR A;  2QA4 V;  2PI5 A;  4X88 A;  2Y69 C;  3JAM N;  4EEQ A;  5LOV A;  2WLI A;  4UUJ C;  1YTF D;  4LF7 B;  4J11 A;  1AR5 A;  2RNB A;  3AG2 C;  2O57 A;  1N34 O; 
#chains in the Genus database with same CATH homology
 1F23 A;  2JJ2 G;  2EIJ B;  3TET A;  2A0L A;  3NXS A;  2W6I G;  4JTC B;  2DW4 A;  1VQ7 V;  1FFT B;  3STL C;  4H33 A;  2WLN A;  5IDJ A;  3B8N A;  1MOF A;  1OCZ B;  5CBH A;  3I56 V;  3ABM B;  5B3S B;  3FB6 C;  4HYO A;  4I9W A;  4WFB V;  1VQK V;  1PNL A;  3OMA B;  2W6J G;  3ZMS A;  3ZRW B;  1VQP V;  1K4D C;  1QLE C;  5L3F A;  3P30 A;  1S77 D;  4TWK A;  1QR8 A;  2MK3 A;  3K03 A;  4TT3 G;  5CA3 A;  3E35 A;  1OCC C;  4G2K A;  1KEC A;  4QPK A;  2F43 G;  1NKD A;  3OR7 C;  4ASU G;  4ZBM A;  4PA9 A;  3ETD A;  1Y4M A;  1QR9 A;  2IH1 C;  1K9M W;  2V1D A;  3X2Q C;  5LGN A;  3CCV V;  1E1Q G;  1Q82 W;  3OFN G;  5LBQ A;  2X6B A;  4WFE A;  1M57 C;  1F4M A;  5CBF A;  4XDJ A;  5KA6 A;  4MVM A;  1KP2 A;  1QLN A;  3OMI B;  1M9N A;  1K73 W;  5L3G A;  1B6Q A;  2IJJ A;  1E1R G;  4XBF A;  2ZR3 A;  1H38 A;  3IFX A;  1CEZ A;  1S0V A;  4G28 B;  4R8C A;  4JYB A;  5J9P C;  3FB5 C;  2IU3 A;  3LDE A;  3CCE V;  4QNH B;  4LC1 A;  2NLJ C;  4JAV A;  3OE7 G;  3ZMZ A;  1FXV A;  3STZ C;  3LSS A;  4CBC A;  3CME V;  1H8H G;  3W7W A;  2LFS A;  4WFH A;  3MHH C;  3UM7 A;  2WWW A;  2DQ0 A;  3SYQ A;  2ZDI C;  3R65 A;  2HR3 A;  4LP8 A;  1DF5 A;  3AG4 C;  4LBE C;  2ZXW C;  1W0J G;  3ZN1 A;  4MVZ A;  1K7D A;  4MS2 A;  3E8G A;  3ABK C;  1VQ5 V;  3ASN C;  1Q86 W;  1R3I C;  4MW3 A;  3ETG A;  4PA4 A;  3CD6 V;  5DN6 G;  3LUT B;  4R50 A;  2Q6A A;  2BOB C;  2W0F C;  1P7B A;  4XDK A;  4YXW G;  5LGU A;  2QKS A;  3D36 A;  1JQ0 A;  1LNQ A;  3F5W C;  2R9R B;  5IYC O;  3CYO A;  1V54 C;  2IJH A;  1FXK B;  1GKF A;  3FYI B;  4PA6 A;  4UVC A;  5IYD O;  2EIN B;  2HVJ C;  2EIJ C;  4FIP C;  2ZD9 A;  1EBO A;  2AHY A;  2GSM B;  3JD0 A;  1OCZ C;  3RVZ A;  3G4S V;  3ABM C;  3E89 A;  5B3S C;  3ZN0 A;  3OW2 U;  2DYR B;  2GHY A;  1OCO B;  3FYE B;  4N21 A;  1ROP A;  5E1A C;  2ZDI A;  3DGE A;  5KUM A;  3B77 A;  4MVR A;  4QE9 A;  3CMA V;  2QEX V;  4GX5 A;  2XAG A;  5CMU A;  2B5U A;  1KP3 A;  3IC7 A;  4WFF A;  1AI5 A;  3CCL V;  3OEH G;  1R6N A;  1XL4 A;  4PA3 A;  1YIT V;  1K3E A;  4PEL A;  2IW5 A;  3HB3 B;  2EIL B;  4X8A A;  4PDR A;  2HLD G;  4MTG A;  1FXH A;  3T2M A;  1NQT A;  3WFV A;  1V55 B;  1YI2 V;  3OUF A;  1XL6 A;  2A79 B;  1JPX A;  2WPD G;  2XAS A;  5KUK A;  2FTK A;  1F51 A;  1R3K C;  1YSC A;  5L3B A;  3CXC U;  1AJP A;  4HZ3 A;  4JF3 A;  1QQH A;  1Y66 A;  1K97 A;  1YJN V;  2DYS C;  2EJR A;  3SYO A;  4P2Z A;  4LCU C;  3VBB A;  4XDL A;  4FPP A;  1QCE A;  2A9H A;  1RPO A;  2Z3Y A;  4WCE V;  1QVG U;  4P30 A;  5L3D A;  3LDD A;  3OGC C;  2ITC C;  3CCJ V;  3QO5 A;  4UV9 A;  3JD2 A;  4H37 A;  3GWO A;  3JD1 A;  4R6Z A;  3BEH A;  2P67 A;  2NNU A;  2WLJ A;  1AI7 A;  2EIM B;  2WLL B;  2IJI A;  2XAQ A;  2QM7 A;  2Q67 A;  4MVQ A;  1PNK A;  3CCS V;  2X0L A;  1R6K A;  3ZMU A;  2ITD C;  4BW5 A;  5C93 A;  3E8B A;  3H01 A;  4QE7 A;  3ETE A;  1EFR G;  2WLI B;  2B1I A;  2QTO A;  3LSQ A;  2X6C A;  4PDV A;  1NBM G;  3FKS G;  1GM7 A;  1OCR B;  3SPC A;  2WLK A;  3ML0 A;  4U7O A;  4KFM A;  1FXK C;  1M56 B;  5LHI A;  3OUS A;  4UXN A;  2EIN C;  3ZMT A;  1R3J C;  2XAF A;  5EC2 C;  1FS0 G;  1S72 V;  3CC7 V;  3JD3 A;  1NH2 D;  1AR1 B;  3QNE A;  5DM6 V;  3W7X A;  2PI4 A;  1COW G;  1DLB A;  1H8E G;  2CK3 G;  2DYR C;  3E86 A;  3EFF K;  4GCZ A;  5HFL A;  1OCO C;  1NH2 B;  2Q69 A;  4MVO A;  1OZ0 A;  1KQS U;  1K33 A;  2R9I A;  1GTO A;  3K04 A;  3CPW U;  1QBZ A;  3F7V C;  3ZIA G;  1W0K G;  5B1N A;  1J95 A;  2WLM A;  4Z1M G;  3SJQ C;  4MTX A;  2EIL C;  3T4D A;  5BZB A;  5B1B B;  3K3W A;  4E2L A;  2H8P C;  1KD1 W;  4GX2 A;  2AHZ A;  1JCH A;  2HJF C;  3E8H A;  4J9Z B;  1V55 C;  5B1A B;  1RM1 B;  1VQ4 V;  2EBO A;  4BIZ A;  4RO2 A;  2JK5 C;  1ORQ C;  3MHS C;  3UKM A;  1MSW D;  5H9C A;  4PDL A;  2C2A A;  5CN0 A;  1YHQ V;  4MT8 A;  2P90 A;  5HFM A;  2YEV A;  5FL7 G;  2IU0 A;  4WFA V;  1YJ9 V;  1S3J A;  2HVK C;  1CPY A;  4F4L A;  1DTO A;  3OAA G;  1K5S A;  1ZWI C;  2IH3 C;  3CCU V;  1I5Y A;  3SPH A;  1K5Q A;  5EK0 A;  3SPI A;  2OT5 A;  3X2Q B;  3AG1 B;  2XAJ A;  1VQO V;  5EBL C;  3SYC A;  2EIM C;  4DO2 A;  3ZRV A;  1ARO P;  4JAS A;  1NVP D;  4G27 B;  4DXW A;  1JOY A;  1H2G A;  2EIK B;  4JGS A;  3M99 B;  2UXX A;  3SYA A;  1S76 D;  4N23 A;  3CP1 A;  2DWD C;  4L87 A;  2DQ3 A;  1G8M A;  2UXN A;  2V7Q G;  1NVP B;  1JJ2 U;  4JTA B;  2Y48 A;  1TUE B;  3B8M A;  1M56 C;  1SZT A;  1P4R A;  1E79 G;  3K9A A;  1AJN A;  3RW0 A;  3QO7 A;  1MAB G;  5L3C A;  1R3L C;  3ABL B;  2JJ1 G;  4FK5 C;  3SPJ A;  5IYB O;  1SER A;  4QPJ A;  1UJW B;  1GM8 A;  1JX9 A;  3JD4 A;  3WG7 B;  1GK9 A;  4KUM A;  5IY5 B;  1BL8 A;  3ZCC A;  2B1G A;  3AG3 B;  2ZQM A;  2ZR2 A;  3ZRW A;  1NJI W;  3FB7 C;  1MG1 A;  4GX1 A;  1I5X A;  4GX0 A;  3BY6 A;  1K4C C;  4JYC A;  4GT1 A;  2OCC B;  3KG2 A;  1VQ9 V;  3JYC A;  1KKD A;  4RQF A;  3RBZ A;  1L1F A;  3RVY A;  5CBG A;  1V54 B;  4Q20 A;  1SRY A;  3CCQ V;  1EZJ A;  3K08 A;  5B1B C;  5LHH A;  5H6R A;  3ASO B;  4MSW C;  1YTF B;  5B1A C;  1RM1 C;  3PJS K;  4WFG A;  1DF4 A;  3TCU A;  5L3E A;  3K0D A;  3AEI A;  2JIZ G;  3ABT A;  3SPG A;  1W2B U;  2WAM A;  2IJK A;  2QM8 A;  2BOC C;  4RUF A;  1PD3 A;  4MVU A;  1VQL V;  1Q7Y W;  4I5S A;  2D3O W;  5KA5 A;  5EBW C;  2K1E A;  2HG5 C;  3G6E V;  4BAY A;  2QE7 G;  3MD0 A;  1BHB A;  4MW8 A;  4JPR A;  3CCM V;  3EHB B;  4HAM A;  4MVS A;  5LHG A;  2M7W A;  1GO3 F;  4UV8 A;  3K06 A;  1R73 A;  3K0G A;  3OEE G;  2P6J A;  1IXM A;  3AG1 C;  2X6A A;  4OXS A;  1THZ A;  2EZO A;  3W7T A;  2WSS G;  3A0R A;  2Y69 B;  4KP4 A;  2EIK C;  3TK1 A;  2OTL V;  4JAU A;  4RQE A;  2DYS B;  4P9P A;  1WPX A;  3AG2 B;  2XND G;  1Q81 W;  3SYP A;  1AI6 A;  1G4Y B;  3W7S A;  1PL0 A;  2HFE C;  2Q68 A;  2XOK G;  3ZMV A;  1FXK A;  1AJQ A;  4X89 A;  3CC4 V;  3T4Z A;  1JVM A;  5EC1 C;  3E8F A;  4P9O A;  3ABL C;  4R7C A;  3DTU B;  1GMG A;  3ZJZ A;  1QLE B;  1M1K W;  3FB8 C;  1YJW V;  2H94 A;  3WG7 C;  1PKX A;  1SES A;  3F7Y C;  4J9Y B;  5IY5 C;  3AG3 C;  3K79 A;  2JEU A;  2LP7 A;  2XAH A;  1VQM V;  4ZKI A;  3ZRX A;  1OCC B;  1F4N A;  4UVB A;  2OCC C;  4FJC C;  2P7T C;  3W7U A;  3HPL C;  2YSU B;  2Z5U A;  3T1C A;  4MTF A;  1GM9 A;  4PDM A;  4JTD B;  3QO8 A;  2WLH A;  4QJF B;  3ZRS A;  1K8A W;  3OMN B;  3LNM B;  4CZZ A;  2DWE C;  1M57 B;  2KB1 A;  4UVA A;  3I55 V;  3ASO C;  4BIU A;  1ENV A;  1K34 A;  2LFR A;  4EKW A;  1OHH G;  3E83 A;  4U7N A;  5EBM C;  2JEX A;  2YEV B;  1VQ8 V;  3D3I A;  1AI4 A;  2EZP A;  1OCR C;  3OR6 C;  4MTO A;  2X7R B;  3G71 V;  1N8R W;  3VOU A;  3IGA C;  1NR7 A;  4QIW F;  1VQ6 V;  4PA7 A;  4RAI A;  1YIJ V;  1KC8 W;  5LGT A;  1SET A;  4FMT A;  3ABU A;  1PNM A;  3JCZ A;  2OTJ V;  5H6Q A;  1NR1 A;  5B1O A;  4WF9 V;  1WLE A;  1HWY A;  3LDC A;  1CP9 A;  3AG4 B;  2ZXW B;  1S5H C;  3OM3 B;  3P32 A;  3E2E A;  1BMF G;  3ABK B;  3ASN B;  1M90 W;  4RUE A;  1RPR A;  2WLL A;  3CCR V;  3CC2 V;  2HKO A;  2QA4 V;  4TSF G;  5GW7 A;  2PI5 A;  4X88 A;  2Y69 C;  1BHA A;  2WLI A;  1QVF U;  1K92 A;  4UUJ C;  1YTF D;  3GB7 C;  1VQN V;  2JDI G;  2ATK C;  3AG2 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...