1DTOA

Crystal structure of the complete transactivation domain of e2 protein from the human papillomavirus type 16
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
202
structure length
200
Chain Sequence
b'HMETLCQRLNVCQDKILTHYENDSTDLRDHIDYWKHMRLECAIYYKAREMGFKHINHQVVPTLAVSKNKALQAIELQLTLETIYNSQYSNEKWTLQDVSLEVYLTAPTGCIKKHGYTVEVQFDGDNTMHYTNWTHIYICEEASVTVVEGQVDYYGLYYVHEGIRTYFVQFKDDAEKYSKNKVWEVHAGGQVILCPTSVFS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REGULATORY PROTEIN E2
molecule tags Viral protein
source organism Human papillomavirus type 16
publication title Structure of the intact transactivation domain of the human papillomavirus E2 protein.
pubmed doi rcsb
total genus 63
structure length 200
sequence length 202
ec nomenclature
pdb deposition date 2000-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00508 PPV_E2_N E2 (early) protein, N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.30 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1dtoA01
2.170.200.10 Mainly Beta Beta Complex Regulatory Protein E2; Chain: A; Domain 2 Regulatory Protein E2; Chain: A; Domain 2 1dtoA02
1DTOA 2JEUA 1QQHA 2JEXA 2NNUA 1TUEB 1R6KA 1R6NA
chains in the Genus database with same CATH superfamily
2XASA 1FS0G 2PZSA 2N74A 2YIBD 3CYOA 4G27B 5KHIA 4YY3O 3CB2A 4U3JA 3KG2A 2HP8A 1AI4A 2WLJA 5CMUA 4JI5B 1FD9A 3QO7A 3J80N 3ASNB 1QR8A 1NU1H 3ABKC 3K0GA 4H37A 1SS3A 4HAMA 1N4CA 1F23A 3Q4HA 4JI2O 2CUGA 1W0KG 4O4HA 4G2KA 1MA1A 3CC2V 2RMKB 5KUMA 2ITCC 2QTOA 4U3FH 3CJHB 2VQFB 4L8JA 3K5OA 2F4VO 4PI2A 3AG4B 1W59A 4MSWC 4NTWA 3CWBH 5ITZB 2XAGA 1K9MW 3TXQA 3B77A 1YTFD 1QCEA 4DV5B 1JPXA 4ICGA 3CX5F 1G6UA 3QO5A 1XMOB 1F4MA 4GX1A 5IE9A 1S72V 2QTSA 2PI5A 1FAFA 5J9PC 4Z1MG 4DV7B 4B3MO 1NT2B 3VBBA 4NXMB 2VWJA 2HG5C 3JSLA 1X4TA 4MVOA 4UCTA 2O57A 2ZXWC 1UFIA 3RVZA 5B1OA 1K5QA 3OE7G 3VQXA 3UO3A 2H94A 2DYSB 4FIPC 2UXDB 3LNNA 5EIBC 2YIDA 1YVWA 1FXKC 3AG4C 3WG7B 5HFLA 4B3SO 1X59A 4IYIA 3TJTA 2ZE6A 4OXSA 2Q9LA 2OWOA 1QLEC 1GO3F 2QGNA 2FB5A 3OGCC 2R9IA 2JS3A 4DV3O 4J7ZA 3HKEA 1I5XA 4O4LA 2F66C 2XOKG 3UQ8A 2BTQA 1BQZA 2EJRA 5LBQA 4GUNA 4LBEC 4FFBA 2A3QA 1JMKC 2EIKC 4TUYB 3K08A 1GK9A 1MSWD 1LUWA 1OV9A 1ZLZA 4RUFA 2RN9A 3W7TA 5LP6B 2UUBB 3CXHF 4AQYB 2ZNIA 4Z2WA 1P49A 1N0NA 4U7NA 1ZWIC 1WB7A 3ZN1A 4IT5A 3TK1A 1MNGA 4AQYO 2ZT9B 4DK1A 4FLTA 4PDVA 1VIBA 1ZSPA 1OZ0A 3O65A 3ABLC 2GTAA 3E8FA 2JVDA 4NTYA 4DR4B 2UXDO 1AR4A 4JI3B 2Q0AA 1KC8W 4DK0A 3OR6C 2UUCO 2Q5ZA 4ZI7B 3ZMVA 3OMIB 1KP2A 5CN0A 3WG7C 4D6TH 3AG3C 1J95A 2ILMA 4QGPA 4QPKA 5B66Z 1VQ5V 4O4LB 1MOFA 4BR6A 1VF7A 2IU3A 1HR0O 2ZDIA 3OEEG 2JIZG 3JALA 2JEUA 2F23A 2XT9A 2Q0OC 4KXRA 2M7WA 2YXHA 4UCVA 2QM4A 1L1FA 4LF4B 3CC7V 3ABUA 1SF9A 2PYLA 4FLUA 4PDLA 4LFAB 3ZX6A 5EBMC 2JGDA 2DW4A 3X2QB 1RPOA 3ZHSA 1DK1A 3QG5A 1K3EA 2RNBA 1BE3H 5KHHA 5D5PA 1HNWB 1Y4MA 4X1IB 4JZ2A 4DV2O 4QJFB 5JVDA 3CCEV 5IWAO 5BMVA 4H0LB 2CTPA 5JJNB 1VQ9V 4I55B 3W7XA 3H9VA 4WFHA 3MAQA 2WA3A 4DV2B 2EILC 3LDDA 2QWNB 1VQLV 1QU7A 1Y74B 4PA7A 1AP6A 5JWPA 2IW5A 5LGUA 1CEZA 2PI4A 3LSUA 1IURA 4UVBA 1WA8B 4LF7B 2Q67A 3ZEDA 3UO2A 1K5SA 4MVZA 4JI8B 1H2LA 5KLVH 4AHCA 1N32O 2YDEA 1N36O 1S77D 1H2SB 3JASB 4X1KA 2CAZC 3T4DA 1KU9A 1I0HA 4R8CA 1SZXA 2PUSA 4JV5O 4NYKA 1WP7A 3P32A 3J7AU 2RCVA 5J2TA 4CS4A 4X64O 1N32B 4BIZA 4H13B 4DXWA 1YJWV 4JF3A 2DOSA 3M99B 1TUBB 4J80A 4DV6B 3VOUA 3AEIA 1GN3A 2GTSA 4LR3A 3D36A 4J7JA 4X1IA 4JTAB 4CZZA 3JATA 4O4IA 4WFEA 1N0JA 3RYCA 3QNEA 2OCCB 1YEWA 2E75B 4QPJA 4NXMO 1YCIA 4L87A 4YHHO 4FLZA 1N34O 1LUVA 2Q4PA 4QE9A 2P06A 4B3TO 3O9OA 4LWSB 1VQ8V 5LHIA 4DYLA 4QNHB 1FYJA 2ODMA 2AGAA 3A2FA 1EN5A 1IBKB 1QHTA 1AB3A 1WN7A 1EBOA 1Q43A 4B7EA 1K73W 1BMFG 3HKBB 2X0LA 4TV8B 5KAFZ 4WBNA 3TETA 5BXZA 3APQA 1PM9A 1L0LH 4PA4A 2F95B 2QKSA 1G8MA 5FPRA 2CDYA 4DV3B 3A0HZ 4H33A 1R6KA 2H8PC 4RO2A 2Q7EA 3JAWA 4JASA 4LFBB 3E8GA 4R7CA 1ZUQA 3SYAA 4MVSA 2QKCA 4F6RA 1XNRB 4P30A 3U11A 5CA1A 5IYZA 4OX9O 1NBMG 2QM7A 4X65O 2PF4E 4FLWA 2ZE8A 3AK3A 1ZX3A 1AJPA 3IFXA 2PYJA 1GN6A 1FFXB 1R1BA 3RYFB 5FLXN 1QVGU 5LMNO 2V1DA 2HR3A 1SQBH 1H2GA 2WSSG 1DLBA 5LYJB 3SPHA 2CTQA 3C3SA 3JAKA 4X88A 5AG2A 4B3TB 2L35A 1LR1A 1VMGA 2ADPA 1SA0B 2CGOA 4H44B 1JFFB 1SQGA 5IJ0B 2HVKC 4BW5A 4MVUA 4X20B 5CA1B 1XL6A 5LXTB 4XDLA 3WU2Z 5EK0A 2IH3C 1BHBA 4X62B 1YJ9V 3RYFA 3CRMA 3M7MX 4JI4B 2PGGA 4DV0B 1ENVA 4YIPA 2K9PA 3IAYA 2VQEB 3N2GB 1OHHG 3FB5C 2L6LA 3JAWB 1K8AW 3K9AA 4LH7A 1SA0A 4DR3B 4TQFA 1TUEB 1E79G 2KG7A 4MVMA 2RJZA 5B3SB 4HNAB 2EINB 1VQPV 3N27A 2XHBA 3RGBA 3GVMA 1XMQB 1VQ4V 4P9OA 1Q6IA 2DJVA 1TAEA 4O2AB 3K58A 4RAIA 2YEVB 3L74H 4DR3O 3G67A 2WLMA 4K8XA 5JJEB 4K0KB 2QEXV 4R6ZA 2EIJB 3SGIA 3RYCB 1K97A 4DR2O 3RYHA 1KYOF 2QWRB 1XNQO 5BR8O 4J11A 1WP8A 3ABKB 4FVMA 2BOBC 3UCSC 4JYAO 5B1AB 3ZRXA 2WA4A 1W2BU 2OT5A 3W7SA 1VEWA 5H9CA 3SJAC 4EEQA 2HHHO 5BR8B 4K8ZA 4GLXA 2D3OW 1S0VA 2JRIA 2LW7A 2CH7A 4FM2A 5EYPA 1GTOA 3JAMN 3CCUV 5FNVA 2UXCO 1YTFB 2FL4A 3FX7A 5KHJA 1XMOO 3SPGA 5LL6Y 1BCCH 3QVNA 4N21A 3RFRA 3LSSA 1XUQA 2EJ7A 3HKCA 1UJWB 1M90W 1WJZA 1S5HC 3A0BZ 3SR2C 2F4VB 3DSQA 2Z5UA 3APOA 5H2FZ 4NR1A 4CH3A 3BEHA 1ZAUA 3KCYA 3NR7A 2BOCC 4OPHA 5BMVB 1EN4A 4GZRB 3CRQA 1XNQB 5J2UB 4GX2A 4JI1O 5EIBD 4DV1B 4LP8A 4GCZA 3WB1A 3RN4A 2W6JG 1Y74A 3CRAA 3ZCCA 1AI5A 2IU0A 1TVKA 1SQPH 4PDRA 5F2VO 2PY5A 3OTOO 4NXNO 3CCRV 1OCRB 3BFRA 4LF7O 2Z0AA 3OTOB 5L3DA 1R3LC 4JAUA 3J81N 3E83A 1VQMV 5LYJA 4P2ZA 1SKVA 2W6IG 5FNVB 3ASOB 4O4IB 3JD2A 3AG3B 1JX9A 1M4UA 5GTHZ 2QR4A 1VQOV 3BPZA 3VQYA 5LA6A 4DV0O 5CBFA 4NVPA 5KAIZ 5FL7G 2OIEA 4CS2A 1VF5B 3LDEA 4TWKA 2ZIMA 2EBOA 1OCZB 4IHJA 4KP4A 3G80A 3UT5B 4X1YB 1F7YA 3G71V 1YF2A 1B04A 3VQWA 3CPWU 3SJCC 2BCCH 1DGSA 3OUFA 2NR5A 1SQXH 1MZEA 2H3OA 4MS2A 4LF6B 3C3TA 4J9ZB 2F1MA 4B7KA 4ZIBA 3PJSK 4JI8O 2VRZA 2YI9A 3F5TA 4PJ0Z 1AI7A 4FZ1A 1IBKO 2VQFO 3GB7C 4XBFA 1Y6XA 3KCXA 2IJHA 3VQVA 3BRCA 2KB1A 3JCZA 4UVCA 1AR5A 1IDSA 4ZI7A 3JSNA 2E5LO 2XAHA 2IH1C 3K59A 4DV4B 1A32A 4W4KA 4JTDB 5LA6B 3K3WA 2CK3G 1F51A 3CCMV 2CE4A 4JI5O 3I5DA 1V54B 2UXCB 3RVYA 3ZRWB 1LNQA 1CP9A 1H8HG 2GUZB 2PTMA 4ABMA 3MDSA 1GMGA 4X62O 1AJQA 4RQEA 1VF6A 4GT1A 2A79B 1COWG 1ORQC 1IXMA 4ZHQA 5DN6G 2UXBO 1V54C 1FXVA 5KHGA 4CH6A 5EBLC 2IJKA 2G38A 4DRXB 2Q7GA 3AK1A 1AR1B 1M5IA 2Y48A 3FD9A 3LDCA 3T1HB 3EXAA 1PNLA 4XDJA 2FYUH 1VARA 1I94B 5IJ0A 5BY1A 1QR9A 4RQFA 1N8RW 1XHXA 3FAVA 4JI7O 2DQ0A 2DWEC 1Q81W 2DE0X 4W4LA 2QDOA 5CA3A 3IGAC 5L3BA 2WLLA 1U97A 4UFZA 4YJ2B 3B2EE 5L3FA 4DV6O 2BSKA 3H01A 3SYCA 5JVDB 3L73H 4BW9A 1Q5OA 3OTFA 2GHYA 1BS3A 3FYEB 2R9RB 5LMUB 2CGNA 3OW2U 2EZPA 3BHPA 2ZE5A 4U3JB 3ETEA 3ZJZA 2AW9A 1I7FA 4LCUC 4I0XB 4LWSA 1KD1W 4HZ3A 3B40A 3K79A 5DM6V 4CBCA 3ASNC 2AZ2A 3FKSG 3B8NA 2OTJV 5A2QN 2YIAA 4OGQB 2WLKA 4DR1B 3CJHA 3UKMA 5CBGA 1Q6HA 2WAMA 4X89A 1BSMA 3K57A 1VF6C 1K7DA 5IY5C 3QO8A 2HKOA 1OCZC 3E8HA 1GM9A 4I9WA 1Q90D 4ASUG 2WLNA 4I5SA 4DR2B 1KKCA 1S5LZ 3ZN0A 1N34B 1RFYA 5EZYB 2QM8A 5JCOA 2DMXA 2NNUA 1JVMA 5IYBO 4LF8B 1R3IC 4IGGA 1FPOA 4WFAV 4JYCA 1SESA 2XNDG 1V55B 3QF7A 4FJCC 1OJHA 4PD4F 3H1HH 1B6QA 3SYOA 2QWQB 1SETA 4X64B 2LJ2A 1RM1C 4RWUA 4K3AA 3OD4A 3D3QA 1YZBA 4FLYA 3U0ZA 5C93A 4LFBO 3H1JH 1GH6A 1NZ6A 5KA5A 3SJBC 5IYDO 1V55C 1YHQV 5LOVA 1XI1A 4I4TB 3E22A 1OCCB 1Q7YW 5J2UA 1KUQA 4X66B 5IJ9B 4ZKIA 1S5JA 3JD4A 4FFBB 2Y4UA 3A8TA 1WB8A 3AG7A 4TV8A 1RSOA 1NTKH 5B1NA 1BT8A 1H2NA 4ZOLA 5LXTA 4PI0A 2DWDC 2ZR2A 3BCCH 4TUYA 2EX3A 2ZINA 2E76B 4O4JB 4LF5O 5KX5A 1I94O 1O9GA 3JCUZ 4X66O 4FZ0A 3ABTA 2VS0A 2EIMC 1JOYA 1SC5B 1US6A 3H1LH 2WLIA 3MHSC 1IBMO 3ZHVA 2BE3A 3CHXA 4Q20A 1YXBA 3ZMSA 2GBOA 4J7KA 1NKDA 1EZJA 4MTOA 4PELA 4KFMA 2B1IA 1H2KA 3E22B 5TISZ 3SPIA 4BIUA 2Y69B 3SJQC 5JCOC 3FAVB 1FFTB 5A9GA 3T1CA 4FLXA 2N04A 2UU9O 3LNMB 1SQQH 3RW0A 1E1QG 4TOIA 4YJ3B 4DR7B 1P7BA 2Q69A 1XNRO 1BGYH 5GONA 2VQEO 1HR0B 2V4DA 1NTMH 4DUZB 3UT5A 1G4YB 2HFEC 4GX5A 1Y76A 1OCCC 1J5EO 2N05A 1SERA 2B5UA 1H38A 4A5UB 2EINC 3CE2A 2QKAA 3K0DA 2Q7HA 3ASOC 1CXZB 3G6BA 1HNZB 5JQGB 2ZDIC 2ZQMA 3X2QC 3B8MA 4IIJA 2JJ1G 3HKDA 4BWAA 1NQTA 1OCRC 4JTCB 2A06H 1HP8A 1QQCA 4LF9O 3DC6A 3JD0A 4HNAA 5K1XA 1M57C 4FLVA 1CPYA 2W0XA 4J41A 4D7SA 1H2MA 1MSDA 1Y76B 3AG2B 5H5NA 2MK3A 3BA9A 2OIGA 2HHHB 2XUMA 3DTUB 1KP3A 3SYQA 2UU9B 1V9PA 3P3PA 2E74B 3JYCA 2Q68A 5D5QA 4AILC 1MABG 1NH2B 3RYIA 1DF4A 1Q6UA 3THOA 5JH7A 2Q8VA 4LFCO 1FFXA 2EZOA 1NVPD 2B1GA 2B9ZA 3STZC 3K5LA 3OUSA 3L75H 1BHAA 2YUAA 2QWOB 2Y69C 5LGTA 3FFQA 3WB0A 4IL6Z 2QE7G 4JI0B 1SQVH 4MW3A 5J2TB 3R66A 3EHBB 1PP9H 1URFA 4CC5A 2UXBB 3T1YO 1S76D 1OCOB 2IM9A 4I7ZB 3HR0A 3K9SA 2CH7B 4WCEV 4GYCB 2HVJC 4LH6A 1FJGB 4GKKB 2OCHA 1AI6A 2GV9A 4PA6A 5CBHA 1UPGA 2ZE7A 5KX5B 1DF5A 2NN4A 3WB2A 2IJJA 4DV5O 2EIKB 4MT8A 2LFRA 3BVOA 3K04A 3L9DA 1JQ0A 4UV9A 4B08A 2E5LB 1GAXA 2XAQA 3I56V 2IBZH 3ML0A 1I08A 1IXBA 1XREA 1DTOA 2NLJC 2UXXA 5GTIZ 2XAJA 5IDJA 1R6NA 3LUTB 4TT3G 3ZMUA 3OGIB 2DYSC 3IC9A 3D8CA 3K03A 3SPJA 3C90A 3HB3B 1T5EA 4FK5C 1IX9A 5IT9N 4EFBA 5B3SC 4E4EA 2KG7B 1XBLA 2XTAA 4PV1B 1M1KW 3TXSA 1NR7A 4JPRA 1QBZA 4LF5B 3FYIB 3CMAV 2BTQB 2YICA 1GN4A 2WLLB 2OCCC 5CB4A 2AHYA 2ZM6B 4JI6O 4B3RB 4LF8O 1XDCA 1EN6A 5IY5B 5C8YB 5L3EA 4DR6O 1HW7A 2CTRA 1XHZA 4P9PA 3CS5A 2DQ3A 5JQGA 5L3CA 1FXKA 1SRYA 3FB7C 3ZHTA 3ZS8C 5IWAB 2RQ6A 3CSXA 2LQTA 2GUZA 4Z1VA 1JFFA 1YITV 2W0FC 1FJGO 2Y0PA 1NH2D 1WAZA 2P67A 3BABA 1XEQA 3H1KH 1NVPB 1W0JG 2CTWA 3NXSA 3A0RA 1MZFA 4DUYB 2FTKA 3GWOA 3JAKB 4EFEA 1PV0A 5EBWC 1J5EB 5DECA 4JI7B 1D2DA 4MTXA 3W7UA 2R9AA 4UCUA 4Q6GA 4DUZO 3E8BA 1P4RA 1R3JC 4UVAA 1AILA 3T2MA 4TV9A 3HPLC 4K0KO 4PA3A 2QSAA 5LMUO 5BZBA 2LW1A 4B3SB 1Z5VA 3FB6C 4DR7O 1TUBA 2UXNA 4ZOLB 3AG1C 1D5NA 1XOUA 4YJ2A 3ZHQA 1THZA 4QIWF 1U96A 1K33A 2ZIOA 3JATB 3STLC 4DW0A 1QNMA 2DN9A 3ZMZA 4KHPB 1AP5A 1HNXB 3LSQA 5C8YA 1TA8A 1PL0A 2FKXA 2DYRB 1FXKB 1S3JA 3ETQA 4X8AA 4EKWA 2LFSA 2C2AA 2ETNA 1NJIW 2Y4TA 4F6EA 2F93B 4DO2A 3MHHC 4CS3A 4YHHB 2ZCEA 5GONB 3RT3C 3L71H 3OMNB 1HNXO 1N36B 1XL4A 4K35A 1ROPA 2A7WA 5LHHA 1ZL8A 3E35A 2JGDB 1GM8A 2UUAO 1GM7A 4JYAB 2JDIG 2YEVA 3ZHUA 4O4JA 2ARHA 3IC7A 4MVRA 3CCQV 1XQ8A 5H6RA 4JGSA 2JK5C 4MVQA 4WF9V 1BQ0A 2D2CB 3CEIA 4MTFA 4EB6B 1KQSU 4NTXA 1OCOC 3BY6A 3H1IH 2ADQB 1HWYA 3W7WA 5KMGB 3ZMTA 1WPXA 1AJNA 1PPJH 4UXNA 5IYZB 5L3GA 4GKKO 1K92A 2WLHA 2FMLA 4DR5B 4UB8Z 4F4LA 4E2LA 2EIMB 5LP6A 4X9QA 1GRJA 1AROP 4D7TA 4PHZA 4NXNB 4PA9A 3T4ZA 1NR1A 3U10A 3SPCA 2YS8A 3CRRA 4JYYA 2AHZA 3ABMB 4RUEA 1JJOA 3SDLA 3OAAG 2GSMB 4UUJC 3RYIB 1N33O 4UV8A 2JS5A 3E89A 2MW2B 5K1PA 1SZTA 2KQXA 1WNSA 1GN2A 2EULA 2M6YA 1PL4A 2YSUB 3S3WA 3T1HO 5EZYA 2Y0IA 2LGQA 3DC5A 2RDCA 1HNWO 3GWKC 3RWRD 2EIJC 2UUAB 1HDJA 5H6QA 3F5WC 1E1RG 4J42A 5B1BC 2P4VA 4ZHQB 3KZIZ 1YJNV 2OTLV 4NKGB 4HBNA 2A0LA 3B09A 1Q82W 2ZXWB 4WBNB 3ICXA 3E2EA 4LNUB 1YSCA 2K1EA 4FFKA 1H8EG 3ZIAG 4U7OA 2P22C 1GKFA 3IJ4A 4FPPA 1M9NA 1YI2V 1P84F 5FPOA 1TVKB 3CCSV 5KMGA 3TGUH 4FM0A 3Q4HB 5CA0B 4GX0A 2JEXA 4JAAA 3CCLV 4I9QA 4KHPO 2Q6AA 1XMQO 1HNZO 2YXLA 2ITDC 4O2AA 3K5NA 4DR5O 4JZGA 4MW8A 4X65B 2HLDG 1PKXA 3ZHRA 3UM7A 3OT7A 3D36C 1WLEA 5EC1C 2ZNJA 3E86A 3N2KB 3RYHB 1L0NH 1IBLO 4JI2B 5JJJB 1R73A 5EYPB 1BZKA 4I55A 4YXWG 3ABLB 4TSFG 3CD6V 4TV9B 1QLNA 4IYHA 1F4NA 2YXYA 5KA6A 2R70A 4J9YB 1O9HA 1Q86W 4WFBV 3ETGA 3CCVV 2P7TC 1QQHA 2BSKB 5CA0A 3BAAA 4IHJB 1JJ2U 4HYOA 3D3IA 3FB8C 4NB5A 4UB6Z 1KMIZ 1NS1A 1ZL8B 3F7VC 1PD3A 1G1XB 2P4KA 2WLIB 2ZKOA 3S3XA 4LNUA 4YJ3A 1NI8A 1EFRG 5LP6C 2KKWA 3EFFK 1RPRA 4XDKA 2HEPA 1FKAO 5GW7A 2HJFC 4LC1A 2X6CA 3K5MA 2VWKA 2YI8A 1MMMA 4FMTA 4CC6A 1IBLB 1M56B 2P6JA 4QE7A 1KBHA 4YIOA 4DR6B 1IZ3A 3HKCB 4JAVA 3P3NA 3CCJV 4CH5A 4JI6B 4B3RO 3AG2C 5CB4B 2XAFA 3WFVA 4I50B 1QLEB 1WA8A 2V7QG 5DEDA 2GDSA 1R3KC 2X6BA 4ZBMA 4WFFA 4LF4O 3CXCU 1NTZH 5JH7B 1D5AA 4LF9B 2DYRC 4JI0O 3OM3B 3JD3A 2P90A 4JV5B 1XILA 3N2GA 4IIJB 4BIOA 4DRXA 2IJIA 1I5YA 3JALB 2YIBA 4JI1B 4UCRA 2OYQA 1M57B 1YDXA 4I4TA 1JCHA 1VQKV 4JYBA 3OEHG 3KKYA 1ZTEA 1L8DA 3DXRA 2AXTZ 4DR4O 1Z5WA 3HKDB 4GKJB 3RBZA 1K4DC 5LGNA 2QA4V 1Y66A 2JGUA 1Y67A 3I55V 1VP7A 3ETDA 1MG1A 1Z2GA 4DV4O 4FM1A 4CH4A 4GKJO 2LGWA 2QWPB 4I0XA 2YC0A 4I50A 2ZD9A 3L70H 1FXHA 4KUMA 4N23A 1R6TA 1B06A 2BTOA 1Q3EA 2F43G 4DW1A 3ABMC 4O2BB 4LFAO 4MTGA 4DR1O 1WPBA 3T1YB 5ITZA 4X1YA 4X20A 4OX9B 3F7YC 4R50A 3JD1A 1YIJV 3K06A 3JASA 4X1KB 4LF6O 3ZBHA 2HJDA 4G28B 1B3QA 4JI4O 4AI8A 5EC2C 4C7UA 1Q8IA 2EILB 5B5EZ 1SQFA 1P7GA 3DXRB 5B1AC 4F6RB 4LFCB 3B4SA 2UUCB 4DUYO 4KL1A 2WWWA 4UCSA 5LHGA 3CP1A 1PNMA 3TCUA 3DGEA 3JARB 1IVSA 3N2KA 3R65A 4DV7O 4B3MB 5E79Z 2LP7A 3HKEB 2R72A 3OFNG 3ZRSA 2LO1A 4EB6A 5E1AC 1JR9A 3BA8A 4YY3B 1VQ7V 1KB9F 3M8AA 5LOVB 3MD0A 3SYPA 1IBMB 3ZRWA 4BAYA 5LMNB 1K4CC 2X6AA 2X7RB 2P5OA 2ATKC 2UUBO 3PN1A 4O2BA 3EVKA 3G6EV 3P30A 4O4HB 1RSOB 1RM1B 2Q73A 3CMEV 1RP3B 3CC4V 1BL8A 1EM1A 3AK2A 3G4SV 2ZR3A 1M93A 3HKBA 1K34A 1QVFU 4PDMA 4WFGA 2QJ1A 1EZVH 5KUKA 1VQNV 4J10A 3JARA 4UCOA 1AVMA 2Z3YA 1TGOA 3QTCA 3AG1B 4DV1O 3OR7C 1KECA 2A9HA 4OPAA 5B1BB 2WPDG 3CRCA 1PNKA 1N33B 3L72H 5KHKA 5IJ9A 1VQ6V 1KKDA 5HFMA 1M56C 2E3CA 1JA8A 3OMAB 5IYCO 2JJ2G 4JI3O 3ZRVA 4TQDA 2KSDA 2AZ0A 2ZM6O
chains in the Genus database with same CATH topology
4JYCA 1XL6A 2XASA 1SESA 1GM8A 2XNDG 1FS0G 4XDLA 1V55B 5EK0A 1GM7A 2JDIG 4FJCC 2YEVA 2IH3C 1BHBA 3IC7A 1B6QA 3SYOA 4MVRA 1SETA 3CYOA 3CCQV 5H6RA 4G27B 1RM1C 4JGSA 2JK5C 1YJ9V 4MVQA 3KG2A 4WF9V 5C93A 1ENVA 1AI4A 5KA5A 2WLJA 4MTFA 5CMUA 5IYDO 1V55C 3QO7A 3ASNB 1YHQV 1QR8A 1KQSU 1OHHG 1OCOC 3FB5C 3BY6A 3ABKC 3K0GA 1OCCB 4H37A 4HAMA 1K8AW 1F23A 1HWYA 3K9AA 1Q7YW 1W0KG 4ZKIA 3W7WA 3JD4A 3ZMTA 1TUEB 1E79G 1AJNA 1WPXA 4G2KA 4MVMA 4UXNA 5B3SB 5L3GA 3CC2V 2EINB 1K92A 5KUMA 2WLHA 2ITCC 2QTOA 1VQPV 5B1NA 4F4LA 2DWDC 4E2LA 2EIMB 1VQ4V 2ZR2A 4P9OA 3AG4B 1AROP 4MSWC 4PA9A 3T4ZA 1NR1A 4RAIA 2YEVB 3SPCA 2XAGA 1K9MW 2WLMA 3ABTA 3B77A 2AHZA 3ABMB 4RUEA 2EIMC 1YTFD 1QCEA 1JOYA 3OAAG 2GSMB 4UUJC 2QEXV 2WLIA 4R6ZA 2EIJB 3MHSC 4UV8A 1JPXA 3E89A 1K97A 4Q20A 1SZTA 3QO5A 1F4MA 4GX1A 2YSUB 3ZMSA 1S72V 1NKDA 1EZJA 4MTOA 2PI5A 5J9PC 4PELA 4Z1MG 4KFMA 2B1IA 3VBBA 3ABKB 2HG5C 2BOBC 3SPIA 4MVOA 4BIUA 2Y69B 3SJQC 5B1AB 2ZXWC 2EIJC 3ZRXA 3RVZA 1W2BU 5B1OA 1K5QA 2OT5A 5H6QA 3OE7G 1FFTB 3F5WC 3W7SA 1E1RG 3T1CA 2H94A 5H9CA 2DYSB 4FIPC 5B1BC 3LNMB 3RW0A 1E1QG 1FXKC 1YJNV 3AG4C 2OTLV 1P7BA 2Q69A 3WG7B 2A0LA 5HFLA 2D3OW 1S0VA 4OXSA 1Q82W 2ZXWB 1GTOA 1QLEC 3CCUV 3E2EA 1GO3F 1YSCA 2K1EA 3ZIAG 1H8EG 1YTFB 3OGCC 4U7OA 2R9IA 1G4YB 1GKFA 4FPPA 1M9NA 1YI2V 1I5XA 2HFEC 4GX5A 3SPGA 2XOKG 1OCCC 2EJRA 3CCSV 4N21A 5LBQA 4LBEC 1SERA 3LSSA 4GX0A 2JEXA 3CCLV 2EIKC 2Q6AA 2B5UA 1H38A 1UJWB 2EINC 1M90W 2ITDC 3K08A 1GK9A 1MSWD 3K0DA 1S5HC 4MW8A 4RUFA 3ASOC 2Z5UA 3W7TA 2HLDG 3BEHA 2ZDIC 1PKXA 2ZQMA 3UM7A 3X2QC 1WLEA 3B8MA 3E86A 5EC1C 2BOCC 2JJ1G 1NQTA 1R73A 1OCRC 4JTCB 4GX2A 4YXWG 3ABLB 4TSFG 1ZWIC 4U7NA 4LP8A 4GCZA 1QLNA 3CD6V 3JD0A 3ZN1A 2W6JG 1F4NA 1M57C 5KA6A 1CPYA 3TK1A 4J9YB 1Q86W 3ZCCA 4WFBV 3ETGA 1AI5A 4PDVA 2IU0A 3AG2B 2MK3A 3CCVV 4PDRA 1OZ0A 2P7TC 1QQHA 3ABLC 3CCRV 3DTUB 1KP3A 1JJ2U 3SYQA 4HYOA 1OCRB 3D3IA 3E8FA 3FB8C 3JYCA 2Q68A 5L3DA 1R3LC 3F7VC 1KC8W 1PD3A 3OR6C 1MABG 4JAUA 1NH2B 2WLIB 3ZMVA 3E83A 1DF4A 1VQMV 3OMIB 1KP2A 5CN0A 3WG7C 4P2ZA 3AG3C 1EFRG 1J95A 2W6IG 3EFFK 1RPRA 4QPKA 4XDKA 2EZOA 3ASOB 1VQ5V 5GW7A 2HJFC 4LC1A 3JD2A 1MOFA 2X6CA 2B1GA 1NVPD 3AG3B 3STZC 1JX9A 2IU3A 3OUSA 1BHAA 2ZDIA 3OEEG 2JIZG 4FMTA 1VQOV 2Y69C 5LGTA 1M56B 2P6JA 2JEUA 4QE7A 2QE7G 5CBFA 5FL7G 2M7WA 4MW3A 3EHBB 4JAVA 1L1FA 3CC7V 3CCJV 3ABUA 3AG2C 3LDEA 4TWKA 2EBOA 2XAFA 1S76D 3WFVA 4PDLA 1QLEB 1OCOB 5EBMC 1OCZB 2DW4A 3X2QB 1RPOA 2V7QG 4KP4A 4WCEV 1K3EA 1R3KC 2X6BA 2HVJC 4ZBMA 4WFFA 3CXCU 1AI6A 1Y4MA 2DYRC 3OM3B 3JD3A 4PA6A 5CBHA 2P90A 3G71V 4QJFB 3CCEV 1DF5A 3CPWU 3OUFA 2IJJA 2EIKB 1VQ9V 2LFRA 4MS2A 4MT8A 2IJIA 3K04A 4UV9A 1I5YA 1JQ0A 3W7XA 4WFHA 4J9ZB 1M57B 2EILC 3LDDA 1VQLV 1JCHA 1VQKV 4PA7A 4JYBA 3OEHG 3PJSK 2XAQA 3I56V 1AI7A 2IW5A 3ML0A 5LGUA 1CEZA 2PI4A 3GB7C 4XBFA 2IJHA 1DTOA 2NLJC 2UXXA 4UVBA 2Q67A 2KB1A 3JCZA 4UVCA 1K5SA 2XAJA 5IDJA 1R6NA 4MVZA 3LUTB 4TT3G 2XAHA 2IH1C 3RBZA 1K4DC 2DYSC 3ZMUA 5LGNA 1S77D 2QA4V 3K03A 3SPJA 1Y66A 3HB3B 4JTDB 4FK5C 3K3WA 3T4DA 2CK3G 1F51A 3I55V 3CCMV 4R8CA 3ETDA 1MG1A 5B3SC 3P32A 1V54B 1M1KW 3RVYA 1NR7A 4JPRA 3ZRWB 1LNQA 1CP9A 1H8HG 4BIZA 1QBZA 1GMGA 3FYIB 3CMAV 2ZD9A 1FXHA 4KUMA 1AJQA 4N23A 4DXWA 1YJWV 4JF3A 4RQEA 2F43G 3M99B 4GT1A 2WLLB 2A79B 2OCCC 3ABMC 1COWG 1ORQC 1IXMA 4MTGA 3VOUA 2AHYA 5DN6G 3AEIA 3D36A 1V54C 1FXVA 4JTAB 4CZZA 4WFEA 3F7YC 4R50A 5IY5B 5EBLC 5L3EA 3JD1A 3QNEA 2IJKA 2OCCB 1YIJV 3K06A 4QPJA 4P9PA 2DQ3A 1AR1B 4L87A 5L3CA 1FXKA 1SRYA 2Y48A 3FB7C 3LDCA 4QE9A 4G28B 1PNLA 4XDJA 5EC2C 1VQ8V 2EILB 5LHIA 1QR9A 4RQFA 1N8RW 1YITV 2W0FC 5B1AC 2DQ0A 2DWEC 4QNHB 1NH2D 1Q81W 5CA3A 2WWWA 3IGAC 2P67A 5L3BA 2WLLA 1EBOA 5LHGA 3CP1A 5L3FA 1K73W 3H01A 1BMFG 3SYCA 1NVPB 1PNMA 3TCUA 1W0JG 2X0LA 3DGEA 3A0RA 3NXSA 2GHYA 3FYEB 2R9RB 3TETA 3OW2U 2FTKA 3GWOA 5EBWC 2EZPA 3R65A 4PA4A 2LP7A 4MTXA 2QKSA 3W7UA 1G8MA 3OFNG 3ZRSA 3ETEA 3ZJZA 5E1AC 3E8BA 4H33A 1P4RA 4LCUC 1R3JC 1VQ7V 4UVAA 1R6KA 2H8PC 4RO2A 1KD1W 3T2MA 3MD0A 3SYPA 4HZ3A 3ZRWA 3HPLC 3K79A 4JASA 5DM6V 4PA3A 1K4CC 4BAYA 4CBCA 3ASNC 3E8GA 4R7CA 2X6AA 2X7RB 3SYAA 2ATKC 4MVSA 5BZBA 3FKSG 3B8NA 4P30A 2OTJV 3FB6C 3G6EV 2UXNA 1NBMG 3P30A 2QM7A 3AG1C 2WLKA 3UKMA 1RM1B 3CMEV 5CBGA 1THZA 4QIWF 3CC4V 1K33A 1BL8A 3G4SV 2WAMA 2ZR3A 4X89A 1AJPA 3IFXA 3STLC 1K34A 3ZMZA 1QVFU 4PDMA 3LSQA 4WFGA 1K7DA 1QVGU 5IY5C 5KUKA 2V1DA 3QO8A 2HR3A 1H2GA 1OCZC 2WSSG 1GM9A 1DLBA 2HKOA 3E8HA 1VQNV 1PL0A 3SPHA 2DYRB 1FXKB 1S3JA 2Z3YA 4I9WA 4X8AA 3AG1B 4X88A 3OR7C 1KECA 4ASUG 2WLNA 4EKWA 2LFSA 2A9HA 5B1BB 2C2AA 2WPDG 4I5SA 1NJIW 3ZN0A 1PNKA 4DO2A 3MHHC 2QM8A 1VQ6V 1KKDA 5HFMA 3OMNB 2NNUA 1M56C 1JVMA 3OMAB 5IYBO 5IYCO 2HVKC 2JJ2G 4BW5A 1XL4A 3ZRVA 4MVUA 1ROPA 1R3IC 5LHHA 3E35A 4WFAV
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DTO A;  2JEU A;  1QQH A;  2JEX A;  2NNU A;  1TUE B;  1R6K A;  1R6N A; 
#chains in the Genus database with same CATH topology
 2XAS A;  1FS0 G;  2PZS A;  2N74 A;  2YIB D;  3CYO A;  4G27 B;  5KHI A;  4YY3 O;  3CB2 A;  4U3J A;  3KG2 A;  2HP8 A;  1AI4 A;  2WLJ A;  5CMU A;  4JI5 B;  1FD9 A;  3QO7 A;  3J80 N;  3ASN B;  1QR8 A;  1NU1 H;  3ABK C;  3K0G A;  4H37 A;  1SS3 A;  4HAM A;  1N4C A;  1F23 A;  3Q4H A;  4JI2 O;  2CUG A;  1W0K G;  4O4H A;  4G2K A;  1MA1 A;  3CC2 V;  2RMK B;  5KUM A;  2ITC C;  2QTO A;  4U3F H;  3CJH B;  2VQF B;  4L8J A;  3K5O A;  2F4V O;  4PI2 A;  3AG4 B;  1W59 A;  4MSW C;  4NTW A;  3CWB H;  5ITZ B;  2XAG A;  1K9M W;  3TXQ A;  3B77 A;  1YTF D;  1QCE A;  4DV5 B;  1JPX A;  4ICG A;  3CX5 F;  1G6U A;  3QO5 A;  1XMO B;  1F4M A;  4GX1 A;  5IE9 A;  1S72 V;  2QTS A;  2PI5 A;  1FAF A;  5J9P C;  4Z1M G;  4DV7 B;  4B3M O;  1NT2 B;  3VBB A;  4NXM B;  2VWJ A;  2HG5 C;  3JSL A;  1X4T A;  4MVO A;  4UCT A;  2O57 A;  2ZXW C;  1UFI A;  3RVZ A;  5B1O A;  1K5Q A;  3OE7 G;  3VQX A;  3UO3 A;  2H94 A;  2DYS B;  4FIP C;  2UXD B;  3LNN A;  5EIB C;  2YID A;  1YVW A;  1FXK C;  3AG4 C;  3WG7 B;  5HFL A;  4B3S O;  1X59 A;  4IYI A;  3TJT A;  2ZE6 A;  4OXS A;  2Q9L A;  2OWO A;  1QLE C;  1GO3 F;  2QGN A;  2FB5 A;  3OGC C;  2R9I A;  2JS3 A;  4DV3 O;  4J7Z A;  3HKE A;  1I5X A;  4O4L A;  2F66 C;  2XOK G;  3UQ8 A;  2BTQ A;  1BQZ A;  2EJR A;  5LBQ A;  4GUN A;  4LBE C;  4FFB A;  2A3Q A;  1JMK C;  2EIK C;  4TUY B;  3K08 A;  1GK9 A;  1MSW D;  1LUW A;  1OV9 A;  1ZLZ A;  4RUF A;  2RN9 A;  3W7T A;  5LP6 B;  2UUB B;  3CXH F;  4AQY B;  2ZNI A;  4Z2W A;  1P49 A;  1N0N A;  4U7N A;  1ZWI C;  1WB7 A;  3ZN1 A;  4IT5 A;  3TK1 A;  1MNG A;  4AQY O;  2ZT9 B;  4DK1 A;  4FLT A;  4PDV A;  1VIB A;  1ZSP A;  1OZ0 A;  3O65 A;  3ABL C;  2GTA A;  3E8F A;  2JVD A;  4NTY A;  4DR4 B;  2UXD O;  1AR4 A;  4JI3 B;  2Q0A A;  1KC8 W;  4DK0 A;  3OR6 C;  2UUC O;  2Q5Z A;  4ZI7 B;  3ZMV A;  3OMI B;  1KP2 A;  5CN0 A;  3WG7 C;  4D6T H;  3AG3 C;  1J95 A;  2ILM A;  4QGP A;  4QPK A;  5B66 Z;  1VQ5 V;  4O4L B;  1MOF A;  4BR6 A;  1VF7 A;  2IU3 A;  1HR0 O;  2ZDI A;  3OEE G;  2JIZ G;  3JAL A;  2JEU A;  2F23 A;  2XT9 A;  2Q0O C;  4KXR A;  2M7W A;  2YXH A;  4UCV A;  2QM4 A;  1L1F A;  4LF4 B;  3CC7 V;  3ABU A;  1SF9 A;  2PYL A;  4FLU A;  4PDL A;  4LFA B;  3ZX6 A;  5EBM C;  2JGD A;  2DW4 A;  3X2Q B;  1RPO A;  3ZHS A;  1DK1 A;  3QG5 A;  1K3E A;  2RNB A;  1BE3 H;  5KHH A;  5D5P A;  1HNW B;  1Y4M A;  4X1I B;  4JZ2 A;  4DV2 O;  4QJF B;  5JVD A;  3CCE V;  5IWA O;  5BMV A;  4H0L B;  2CTP A;  5JJN B;  1VQ9 V;  4I55 B;  3W7X A;  3H9V A;  4WFH A;  3MAQ A;  2WA3 A;  4DV2 B;  2EIL C;  3LDD A;  2QWN B;  1VQL V;  1QU7 A;  1Y74 B;  4PA7 A;  1AP6 A;  5JWP A;  2IW5 A;  5LGU A;  1CEZ A;  2PI4 A;  3LSU A;  1IUR A;  4UVB A;  1WA8 B;  4LF7 B;  2Q67 A;  3ZED A;  3UO2 A;  1K5S A;  4MVZ A;  4JI8 B;  1H2L A;  5KLV H;  4AHC A;  1N32 O;  2YDE A;  1N36 O;  1S77 D;  1H2S B;  3JAS B;  4X1K A;  2CAZ C;  3T4D A;  1KU9 A;  1I0H A;  4R8C A;  1SZX A;  2PUS A;  4JV5 O;  4NYK A;  1WP7 A;  3P32 A;  3J7A U;  2RCV A;  5J2T A;  4CS4 A;  4X64 O;  1N32 B;  4BIZ A;  4H13 B;  4DXW A;  1YJW V;  4JF3 A;  2DOS A;  3M99 B;  1TUB B;  4J80 A;  4DV6 B;  3VOU A;  3AEI A;  1GN3 A;  2GTS A;  4LR3 A;  3D36 A;  4J7J A;  4X1I A;  4JTA B;  4CZZ A;  3JAT A;  4O4I A;  4WFE A;  1N0J A;  3RYC A;  3QNE A;  2OCC B;  1YEW A;  2E75 B;  4QPJ A;  4NXM O;  1YCI A;  4L87 A;  4YHH O;  4FLZ A;  1N34 O;  1LUV A;  2Q4P A;  4QE9 A;  2P06 A;  4B3T O;  3O9O A;  4LWS B;  1VQ8 V;  5LHI A;  4DYL A;  4QNH B;  1FYJ A;  2ODM A;  2AGA A;  3A2F A;  1EN5 A;  1IBK B;  1QHT A;  1AB3 A;  1WN7 A;  1EBO A;  1Q43 A;  4B7E A;  1K73 W;  1BMF G;  3HKB B;  2X0L A;  4TV8 B;  5KAF Z;  4WBN A;  3TET A;  5BXZ A;  3APQ A;  1PM9 A;  1L0L H;  4PA4 A;  2F95 B;  2QKS A;  1G8M A;  5FPR A;  2CDY A;  4DV3 B;  3A0H Z;  4H33 A;  1R6K A;  2H8P C;  4RO2 A;  2Q7E A;  3JAW A;  4JAS A;  4LFB B;  3E8G A;  4R7C A;  1ZUQ A;  3SYA A;  4MVS A;  2QKC A;  4F6R A;  1XNR B;  4P30 A;  3U11 A;  5CA1 A;  5IYZ A;  4OX9 O;  1NBM G;  2QM7 A;  4X65 O;  2PF4 E;  4FLW A;  2ZE8 A;  3AK3 A;  1ZX3 A;  1AJP A;  3IFX A;  2PYJ A;  1GN6 A;  1FFX B;  1R1B A;  3RYF B;  5FLX N;  1QVG U;  5LMN O;  2V1D A;  2HR3 A;  1SQB H;  1H2G A;  2WSS G;  1DLB A;  5LYJ B;  3SPH A;  2CTQ A;  3C3S A;  3JAK A;  4X88 A;  5AG2 A;  4B3T B;  2L35 A;  1LR1 A;  1VMG A;  2ADP A;  1SA0 B;  2CGO A;  4H44 B;  1JFF B;  1SQG A;  5IJ0 B;  2HVK C;  4BW5 A;  4MVU A;  4X20 B;  5CA1 B;  1XL6 A;  5LXT B;  4XDL A;  3WU2 Z;  5EK0 A;  2IH3 C;  1BHB A;  4X62 B;  1YJ9 V;  3RYF A;  3CRM A;  3M7M X;  4JI4 B;  2PGG A;  4DV0 B;  1ENV A;  4YIP A;  2K9P A;  3IAY A;  2VQE B;  3N2G B;  1OHH G;  3FB5 C;  2L6L A;  3JAW B;  1K8A W;  3K9A A;  4LH7 A;  1SA0 A;  4DR3 B;  4TQF A;  1TUE B;  1E79 G;  2KG7 A;  4MVM A;  2RJZ A;  5B3S B;  4HNA B;  2EIN B;  1VQP V;  3N27 A;  2XHB A;  3RGB A;  3GVM A;  1XMQ B;  1VQ4 V;  4P9O A;  1Q6I A;  2DJV A;  1TAE A;  4O2A B;  3K58 A;  4RAI A;  2YEV B;  3L74 H;  4DR3 O;  3G67 A;  2WLM A;  4K8X A;  5JJE B;  4K0K B;  2QEX V;  4R6Z A;  2EIJ B;  3SGI A;  3RYC B;  1K97 A;  4DR2 O;  3RYH A;  1KYO F;  2QWR B;  1XNQ O;  5BR8 O;  4J11 A;  1WP8 A;  3ABK B;  4FVM A;  2BOB C;  3UCS C;  4JYA O;  5B1A B;  3ZRX A;  2WA4 A;  1W2B U;  2OT5 A;  3W7S A;  1VEW A;  5H9C A;  3SJA C;  4EEQ A;  2HHH O;  5BR8 B;  4K8Z A;  4GLX A;  2D3O W;  1S0V A;  2JRI A;  2LW7 A;  2CH7 A;  4FM2 A;  5EYP A;  1GTO A;  3JAM N;  3CCU V;  5FNV A;  2UXC O;  1YTF B;  2FL4 A;  3FX7 A;  5KHJ A;  1XMO O;  3SPG A;  5LL6 Y;  1BCC H;  3QVN A;  4N21 A;  3RFR A;  3LSS A;  1XUQ A;  2EJ7 A;  3HKC A;  1UJW B;  1M90 W;  1WJZ A;  1S5H C;  3A0B Z;  3SR2 C;  2F4V B;  3DSQ A;  2Z5U A;  3APO A;  5H2F Z;  4NR1 A;  4CH3 A;  3BEH A;  1ZAU A;  3KCY A;  3NR7 A;  2BOC C;  4OPH A;  5BMV B;  1EN4 A;  4GZR B;  3CRQ A;  1XNQ B;  5J2U B;  4GX2 A;  4JI1 O;  5EIB D;  4DV1 B;  4LP8 A;  4GCZ A;  3WB1 A;  3RN4 A;  2W6J G;  1Y74 A;  3CRA A;  3ZCC A;  1AI5 A;  2IU0 A;  1TVK A;  1SQP H;  4PDR A;  5F2V O;  2PY5 A;  3OTO O;  4NXN O;  3CCR V;  1OCR B;  3BFR A;  4LF7 O;  2Z0A A;  3OTO B;  5L3D A;  1R3L C;  4JAU A;  3J81 N;  3E83 A;  1VQM V;  5LYJ A;  4P2Z A;  1SKV A;  2W6I G;  5FNV B;  3ASO B;  4O4I B;  3JD2 A;  3AG3 B;  1JX9 A;  1M4U A;  5GTH Z;  2QR4 A;  1VQO V;  3BPZ A;  3VQY A;  5LA6 A;  4DV0 O;  5CBF A;  4NVP A;  5KAI Z;  5FL7 G;  2OIE A;  4CS2 A;  1VF5 B;  3LDE A;  4TWK A;  2ZIM A;  2EBO A;  1OCZ B;  4IHJ A;  4KP4 A;  3G80 A;  3UT5 B;  4X1Y B;  1F7Y A;  3G71 V;  1YF2 A;  1B04 A;  3VQW A;  3CPW U;  3SJC C;  2BCC H;  1DGS A;  3OUF A;  2NR5 A;  1SQX H;  1MZE A;  2H3O A;  4MS2 A;  4LF6 B;  3C3T A;  4J9Z B;  2F1M A;  4B7K A;  4ZIB A;  3PJS K;  4JI8 O;  2VRZ A;  2YI9 A;  3F5T A;  4PJ0 Z;  1AI7 A;  4FZ1 A;  1IBK O;  2VQF O;  3GB7 C;  4XBF A;  1Y6X A;  3KCX A;  2IJH A;  3VQV A;  3BRC A;  2KB1 A;  3JCZ A;  4UVC A;  1AR5 A;  1IDS A;  4ZI7 A;  3JSN A;  2E5L O;  2XAH A;  2IH1 C;  3K59 A;  4DV4 B;  1A32 A;  4W4K A;  4JTD B;  5LA6 B;  3K3W A;  2CK3 G;  1F51 A;  3CCM V;  2CE4 A;  4JI5 O;  3I5D A;  1V54 B;  2UXC B;  3RVY A;  3ZRW B;  1LNQ A;  1CP9 A;  1H8H G;  2GUZ B;  2PTM A;  4ABM A;  3MDS A;  1GMG A;  4X62 O;  1AJQ A;  4RQE A;  1VF6 A;  4GT1 A;  2A79 B;  1COW G;  1ORQ C;  1IXM A;  4ZHQ A;  5DN6 G;  2UXB O;  1V54 C;  1FXV A;  5KHG A;  4CH6 A;  5EBL C;  2IJK A;  2G38 A;  4DRX B;  2Q7G A;  3AK1 A;  1AR1 B;  1M5I A;  2Y48 A;  3FD9 A;  3LDC A;  3T1H B;  3EXA A;  1PNL A;  4XDJ A;  2FYU H;  1VAR A;  1I94 B;  5IJ0 A;  5BY1 A;  1QR9 A;  4RQF A;  1N8R W;  1XHX A;  3FAV A;  4JI7 O;  2DQ0 A;  2DWE C;  1Q81 W;  2DE0 X;  4W4L A;  2QDO A;  5CA3 A;  3IGA C;  5L3B A;  2WLL A;  1U97 A;  4UFZ A;  4YJ2 B;  3B2E E;  5L3F A;  4DV6 O;  2BSK A;  3H01 A;  3SYC A;  5JVD B;  3L73 H;  4BW9 A;  1Q5O A;  3OTF A;  2GHY A;  1BS3 A;  3FYE B;  2R9R B;  5LMU B;  2CGN A;  3OW2 U;  2EZP A;  3BHP A;  2ZE5 A;  4U3J B;  3ETE A;  3ZJZ A;  2AW9 A;  1I7F A;  4LCU C;  4I0X B;  4LWS A;  1KD1 W;  4HZ3 A;  3B40 A;  3K79 A;  5DM6 V;  4CBC A;  3ASN C;  2AZ2 A;  3FKS G;  3B8N A;  2OTJ V;  5A2Q N;  2YIA A;  4OGQ B;  2WLK A;  4DR1 B;  3CJH A;  3UKM A;  5CBG A;  1Q6H A;  2WAM A;  4X89 A;  1BSM A;  3K57 A;  1VF6 C;  1K7D A;  5IY5 C;  3QO8 A;  2HKO A;  1OCZ C;  3E8H A;  1GM9 A;  4I9W A;  1Q90 D;  4ASU G;  2WLN A;  4I5S A;  4DR2 B;  1KKC A;  1S5L Z;  3ZN0 A;  1N34 B;  1RFY A;  5EZY B;  2QM8 A;  5JCO A;  2DMX A;  2NNU A;  1JVM A;  5IYB O;  4LF8 B;  1R3I C;  4IGG A;  1FPO A;  4WFA V;  4JYC A;  1SES A;  2XND G;  1V55 B;  3QF7 A;  4FJC C;  1OJH A;  4PD4 F;  3H1H H;  1B6Q A;  3SYO A;  2QWQ B;  1SET A;  4X64 B;  2LJ2 A;  1RM1 C;  4RWU A;  4K3A A;  3OD4 A;  3D3Q A;  1YZB A;  4FLY A;  3U0Z A;  5C93 A;  4LFB O;  3H1J H;  1GH6 A;  1NZ6 A;  5KA5 A;  3SJB C;  5IYD O;  1V55 C;  1YHQ V;  5LOV A;  1XI1 A;  4I4T B;  3E22 A;  1OCC B;  1Q7Y W;  5J2U A;  1KUQ A;  4X66 B;  5IJ9 B;  4ZKI A;  1S5J A;  3JD4 A;  4FFB B;  2Y4U A;  3A8T A;  1WB8 A;  3AG7 A;  4TV8 A;  1RSO A;  1NTK H;  5B1N A;  1BT8 A;  1H2N A;  4ZOL A;  5LXT A;  4PI0 A;  2DWD C;  2ZR2 A;  3BCC H;  4TUY A;  2EX3 A;  2ZIN A;  2E76 B;  4O4J B;  4LF5 O;  5KX5 A;  1I94 O;  1O9G A;  3JCU Z;  4X66 O;  4FZ0 A;  3ABT A;  2VS0 A;  2EIM C;  1JOY A;  1SC5 B;  1US6 A;  3H1L H;  2WLI A;  3MHS C;  1IBM O;  3ZHV A;  2BE3 A;  3CHX A;  4Q20 A;  1YXB A;  3ZMS A;  2GBO A;  4J7K A;  1NKD A;  1EZJ A;  4MTO A;  4PEL A;  4KFM A;  2B1I A;  1H2K A;  3E22 B;  5TIS Z;  3SPI A;  4BIU A;  2Y69 B;  3SJQ C;  5JCO C;  3FAV B;  1FFT B;  5A9G A;  3T1C A;  4FLX A;  2N04 A;  2UU9 O;  3LNM B;  1SQQ H;  3RW0 A;  1E1Q G;  4TOI A;  4YJ3 B;  4DR7 B;  1P7B A;  2Q69 A;  1XNR O;  1BGY H;  5GON A;  2VQE O;  1HR0 B;  2V4D A;  1NTM H;  4DUZ B;  3UT5 A;  1G4Y B;  2HFE C;  4GX5 A;  1Y76 A;  1OCC C;  1J5E O;  2N05 A;  1SER A;  2B5U A;  1H38 A;  4A5U B;  2EIN C;  3CE2 A;  2QKA A;  3K0D A;  2Q7H A;  3ASO C;  1CXZ B;  3G6B A;  1HNZ B;  5JQG B;  2ZDI C;  2ZQM A;  3X2Q C;  3B8M A;  4IIJ A;  2JJ1 G;  3HKD A;  4BWA A;  1NQT A;  1OCR C;  4JTC B;  2A06 H;  1HP8 A;  1QQC A;  4LF9 O;  3DC6 A;  3JD0 A;  4HNA A;  5K1X A;  1M57 C;  4FLV A;  1CPY A;  2W0X A;  4J41 A;  4D7S A;  1H2M A;  1MSD A;  1Y76 B;  3AG2 B;  5H5N A;  2MK3 A;  3BA9 A;  2OIG A;  2HHH B;  2XUM A;  3DTU B;  1KP3 A;  3SYQ A;  2UU9 B;  1V9P A;  3P3P A;  2E74 B;  3JYC A;  2Q68 A;  5D5Q A;  4AIL C;  1MAB G;  1NH2 B;  3RYI A;  1DF4 A;  1Q6U A;  3THO A;  5JH7 A;  2Q8V A;  4LFC O;  1FFX A;  2EZO A;  1NVP D;  2B1G A;  2B9Z A;  3STZ C;  3K5L A;  3OUS A;  3L75 H;  1BHA A;  2YUA A;  2QWO B;  2Y69 C;  5LGT A;  3FFQ A;  3WB0 A;  4IL6 Z;  2QE7 G;  4JI0 B;  1SQV H;  4MW3 A;  5J2T B;  3R66 A;  3EHB B;  1PP9 H;  1URF A;  4CC5 A;  2UXB B;  3T1Y O;  1S76 D;  1OCO B;  2IM9 A;  4I7Z B;  3HR0 A;  3K9S A;  2CH7 B;  4WCE V;  4GYC B;  2HVJ C;  4LH6 A;  1FJG B;  4GKK B;  2OCH A;  1AI6 A;  2GV9 A;  4PA6 A;  5CBH A;  1UPG A;  2ZE7 A;  5KX5 B;  1DF5 A;  2NN4 A;  3WB2 A;  2IJJ A;  4DV5 O;  2EIK B;  4MT8 A;  2LFR A;  3BVO A;  3K04 A;  3L9D A;  1JQ0 A;  4UV9 A;  4B08 A;  2E5L B;  1GAX A;  2XAQ A;  3I56 V;  2IBZ H;  3ML0 A;  1I08 A;  1IXB A;  1XRE A;  1DTO A;  2NLJ C;  2UXX A;  5GTI Z;  2XAJ A;  5IDJ A;  1R6N A;  3LUT B;  4TT3 G;  3ZMU A;  3OGI B;  2DYS C;  3IC9 A;  3D8C A;  3K03 A;  3SPJ A;  3C90 A;  3HB3 B;  1T5E A;  4FK5 C;  1IX9 A;  5IT9 N;  4EFB A;  5B3S C;  4E4E A;  2KG7 B;  1XBL A;  2XTA A;  4PV1 B;  1M1K W;  3TXS A;  1NR7 A;  4JPR A;  1QBZ A;  4LF5 B;  3FYI B;  3CMA V;  2BTQ B;  2YIC A;  1GN4 A;  2WLL B;  2OCC C;  5CB4 A;  2AHY A;  2ZM6 B;  4JI6 O;  4B3R B;  4LF8 O;  1XDC A;  1EN6 A;  5IY5 B;  5C8Y B;  5L3E A;  4DR6 O;  1HW7 A;  2CTR A;  1XHZ A;  4P9P A;  3CS5 A;  2DQ3 A;  5JQG A;  5L3C A;  1FXK A;  1SRY A;  3FB7 C;  3ZHT A;  3ZS8 C;  5IWA B;  2RQ6 A;  3CSX A;  2LQT A;  2GUZ A;  4Z1V A;  1JFF A;  1YIT V;  2W0F C;  1FJG O;  2Y0P A;  1NH2 D;  1WAZ A;  2P67 A;  3BAB A;  1XEQ A;  3H1K H;  1NVP B;  1W0J G;  2CTW A;  3NXS A;  3A0R A;  1MZF A;  4DUY B;  2FTK A;  3GWO A;  3JAK B;  4EFE A;  1PV0 A;  5EBW C;  1J5E B;  5DEC A;  4JI7 B;  1D2D A;  4MTX A;  3W7U A;  2R9A A;  4UCU A;  4Q6G A;  4DUZ O;  3E8B A;  1P4R A;  1R3J C;  4UVA A;  1AIL A;  3T2M A;  4TV9 A;  3HPL C;  4K0K O;  4PA3 A;  2QSA A;  5LMU O;  5BZB A;  2LW1 A;  4B3S B;  1Z5V A;  3FB6 C;  4DR7 O;  1TUB A;  2UXN A;  4ZOL B;  3AG1 C;  1D5N A;  1XOU A;  4YJ2 A;  3ZHQ A;  1THZ A;  4QIW F;  1U96 A;  1K33 A;  2ZIO A;  3JAT B;  3STL C;  4DW0 A;  1QNM A;  2DN9 A;  3ZMZ A;  4KHP B;  1AP5 A;  1HNX B;  3LSQ A;  5C8Y A;  1TA8 A;  1PL0 A;  2FKX A;  2DYR B;  1FXK B;  1S3J A;  3ETQ A;  4X8A A;  4EKW A;  2LFS A;  2C2A A;  2ETN A;  1NJI W;  2Y4T A;  4F6E A;  2F93 B;  4DO2 A;  3MHH C;  4CS3 A;  4YHH B;  2ZCE A;  5GON B;  3RT3 C;  3L71 H;  3OMN B;  1HNX O;  1N36 B;  1XL4 A;  4K35 A;  1ROP A;  2A7W A;  5LHH A;  1ZL8 A;  3E35 A;  2JGD B;  1GM8 A;  2UUA O;  1GM7 A;  4JYA B;  2JDI G;  2YEV A;  3ZHU A;  4O4J A;  2ARH A;  3IC7 A;  4MVR A;  3CCQ V;  1XQ8 A;  5H6R A;  4JGS A;  2JK5 C;  4MVQ A;  4WF9 V;  1BQ0 A;  2D2C B;  3CEI A;  4MTF A;  4EB6 B;  1KQS U;  4NTX A;  1OCO C;  3BY6 A;  3H1I H;  2ADQ B;  1HWY A;  3W7W A;  5KMG B;  3ZMT A;  1WPX A;  1AJN A;  1PPJ H;  4UXN A;  5IYZ B;  5L3G A;  4GKK O;  1K92 A;  2WLH A;  2FML A;  4DR5 B;  4UB8 Z;  4F4L A;  4E2L A;  2EIM B;  5LP6 A;  4X9Q A;  1GRJ A;  1ARO P;  4D7T A;  4PHZ A;  4NXN B;  4PA9 A;  3T4Z A;  1NR1 A;  3U10 A;  3SPC A;  2YS8 A;  3CRR A;  4JYY A;  2AHZ A;  3ABM B;  4RUE A;  1JJO A;  3SDL A;  3OAA G;  2GSM B;  4UUJ C;  3RYI B;  1N33 O;  4UV8 A;  2JS5 A;  3E89 A;  2MW2 B;  5K1P A;  1SZT A;  2KQX A;  1WNS A;  1GN2 A;  2EUL A;  2M6Y A;  1PL4 A;  2YSU B;  3S3W A;  3T1H O;  5EZY A;  2Y0I A;  2LGQ A;  3DC5 A;  2RDC A;  1HNW O;  3GWK C;  3RWR D;  2EIJ C;  2UUA B;  1HDJ A;  5H6Q A;  3F5W C;  1E1R G;  4J42 A;  5B1B C;  2P4V A;  4ZHQ B;  3KZI Z;  1YJN V;  2OTL V;  4NKG B;  4HBN A;  2A0L A;  3B09 A;  1Q82 W;  2ZXW B;  4WBN B;  3ICX A;  3E2E A;  4LNU B;  1YSC A;  2K1E A;  4FFK A;  1H8E G;  3ZIA G;  4U7O A;  2P22 C;  1GKF A;  3IJ4 A;  4FPP A;  1M9N A;  1YI2 V;  1P84 F;  5FPO A;  1TVK B;  3CCS V;  5KMG A;  3TGU H;  4FM0 A;  3Q4H B;  5CA0 B;  4GX0 A;  2JEX A;  4JAA A;  3CCL V;  4I9Q A;  4KHP O;  2Q6A A;  1XMQ O;  1HNZ O;  2YXL A;  2ITD C;  4O2A A;  3K5N A;  4DR5 O;  4JZG A;  4MW8 A;  4X65 B;  2HLD G;  1PKX A;  3ZHR A;  3UM7 A;  3OT7 A;  3D36 C;  1WLE A;  5EC1 C;  2ZNJ A;  3E86 A;  3N2K B;  3RYH B;  1L0N H;  1IBL O;  4JI2 B;  5JJJ B;  1R73 A;  5EYP B;  1BZK A;  4I55 A;  4YXW G;  3ABL B;  4TSF G;  3CD6 V;  4TV9 B;  1QLN A;  4IYH A;  1F4N A;  2YXY A;  5KA6 A;  2R70 A;  4J9Y B;  1O9H A;  1Q86 W;  4WFB V;  3ETG A;  3CCV V;  2P7T C;  1QQH A;  2BSK B;  5CA0 A;  3BAA A;  4IHJ B;  1JJ2 U;  4HYO A;  3D3I A;  3FB8 C;  4NB5 A;  4UB6 Z;  1KMI Z;  1NS1 A;  1ZL8 B;  3F7V C;  1PD3 A;  1G1X B;  2P4K A;  2WLI B;  2ZKO A;  3S3X A;  4LNU A;  4YJ3 A;  1NI8 A;  1EFR G;  5LP6 C;  2KKW A;  3EFF K;  1RPR A;  4XDK A;  2HEP A;  1FKA O;  5GW7 A;  2HJF C;  4LC1 A;  2X6C A;  3K5M A;  2VWK A;  2YI8 A;  1MMM A;  4FMT A;  4CC6 A;  1IBL B;  1M56 B;  2P6J A;  4QE7 A;  1KBH A;  4YIO A;  4DR6 B;  1IZ3 A;  3HKC B;  4JAV A;  3P3N A;  3CCJ V;  4CH5 A;  4JI6 B;  4B3R O;  3AG2 C;  5CB4 B;  2XAF A;  3WFV A;  4I50 B;  1QLE B;  1WA8 A;  2V7Q G;  5DED A;  2GDS A;  1R3K C;  2X6B A;  4ZBM A;  4WFF A;  4LF4 O;  3CXC U;  1NTZ H;  5JH7 B;  1D5A A;  4LF9 B;  2DYR C;  4JI0 O;  3OM3 B;  3JD3 A;  2P90 A;  4JV5 B;  1XIL A;  3N2G A;  4IIJ B;  4BIO A;  4DRX A;  2IJI A;  1I5Y A;  3JAL B;  2YIB A;  4JI1 B;  4UCR A;  2OYQ A;  1M57 B;  1YDX A;  4I4T A;  1JCH A;  1VQK V;  4JYB A;  3OEH G;  3KKY A;  1ZTE A;  1L8D A;  3DXR A;  2AXT Z;  4DR4 O;  1Z5W A;  3HKD B;  4GKJ B;  3RBZ A;  1K4D C;  5LGN A;  2QA4 V;  1Y66 A;  2JGU A;  1Y67 A;  3I55 V;  1VP7 A;  3ETD A;  1MG1 A;  1Z2G A;  4DV4 O;  4FM1 A;  4CH4 A;  4GKJ O;  2LGW A;  2QWP B;  4I0X A;  2YC0 A;  4I50 A;  2ZD9 A;  3L70 H;  1FXH A;  4KUM A;  4N23 A;  1R6T A;  1B06 A;  2BTO A;  1Q3E A;  2F43 G;  4DW1 A;  3ABM C;  4O2B B;  4LFA O;  4MTG A;  4DR1 O;  1WPB A;  3T1Y B;  5ITZ A;  4X1Y A;  4X20 A;  4OX9 B;  3F7Y C;  4R50 A;  3JD1 A;  1YIJ V;  3K06 A;  3JAS A;  4X1K B;  4LF6 O;  3ZBH A;  2HJD A;  4G28 B;  1B3Q A;  4JI4 O;  4AI8 A;  5EC2 C;  4C7U A;  1Q8I A;  2EIL B;  5B5E Z;  1SQF A;  1P7G A;  3DXR B;  5B1A C;  4F6R B;  4LFC B;  3B4S A;  2UUC B;  4DUY O;  4KL1 A;  2WWW A;  4UCS A;  5LHG A;  3CP1 A;  1PNM A;  3TCU A;  3DGE A;  3JAR B;  1IVS A;  3N2K A;  3R65 A;  4DV7 O;  4B3M B;  5E79 Z;  2LP7 A;  3HKE B;  2R72 A;  3OFN G;  3ZRS A;  2LO1 A;  4EB6 A;  5E1A C;  1JR9 A;  3BA8 A;  4YY3 B;  1VQ7 V;  1KB9 F;  3M8A A;  5LOV B;  3MD0 A;  3SYP A;  1IBM B;  3ZRW A;  4BAY A;  5LMN B;  1K4C C;  2X6A A;  2X7R B;  2P5O A;  2ATK C;  2UUB O;  3PN1 A;  4O2B A;  3EVK A;  3G6E V;  3P30 A;  4O4H B;  1RSO B;  1RM1 B;  2Q73 A;  3CME V;  1RP3 B;  3CC4 V;  1BL8 A;  1EM1 A;  3AK2 A;  3G4S V;  2ZR3 A;  1M93 A;  3HKB A;  1K34 A;  1QVF U;  4PDM A;  4WFG A;  2QJ1 A;  1EZV H;  5KUK A;  1VQN V;  4J10 A;  3JAR A;  4UCO A;  1AVM A;  2Z3Y A;  1TGO A;  3QTC A;  3AG1 B;  4DV1 O;  3OR7 C;  1KEC A;  2A9H A;  4OPA A;  5B1B B;  2WPD G;  3CRC A;  1PNK A;  1N33 B;  3L72 H;  5KHK A;  5IJ9 A;  1VQ6 V;  1KKD A;  5HFM A;  1M56 C;  2E3C A;  1JA8 A;  3OMA B;  5IYC O;  2JJ2 G;  4JI3 O;  3ZRV A;  4TQD A;  2KSD A;  2AZ0 A;  2ZM6 O; 
#chains in the Genus database with same CATH homology
 4JYC A;  1XL6 A;  2XAS A;  1SES A;  1GM8 A;  2XND G;  1FS0 G;  4XDL A;  1V55 B;  5EK0 A;  1GM7 A;  2JDI G;  4FJC C;  2YEV A;  2IH3 C;  1BHB A;  3IC7 A;  1B6Q A;  3SYO A;  4MVR A;  1SET A;  3CYO A;  3CCQ V;  5H6R A;  4G27 B;  1RM1 C;  4JGS A;  2JK5 C;  1YJ9 V;  4MVQ A;  3KG2 A;  4WF9 V;  5C93 A;  1ENV A;  1AI4 A;  5KA5 A;  2WLJ A;  4MTF A;  5CMU A;  5IYD O;  1V55 C;  3QO7 A;  3ASN B;  1YHQ V;  1QR8 A;  1KQS U;  1OHH G;  1OCO C;  3FB5 C;  3BY6 A;  3ABK C;  3K0G A;  1OCC B;  4H37 A;  4HAM A;  1K8A W;  1F23 A;  1HWY A;  3K9A A;  1Q7Y W;  1W0K G;  4ZKI A;  3W7W A;  3JD4 A;  3ZMT A;  1TUE B;  1E79 G;  1AJN A;  1WPX A;  4G2K A;  4MVM A;  4UXN A;  5B3S B;  5L3G A;  3CC2 V;  2EIN B;  1K92 A;  5KUM A;  2WLH A;  2ITC C;  2QTO A;  1VQP V;  5B1N A;  4F4L A;  2DWD C;  4E2L A;  2EIM B;  1VQ4 V;  2ZR2 A;  4P9O A;  3AG4 B;  1ARO P;  4MSW C;  4PA9 A;  3T4Z A;  1NR1 A;  4RAI A;  2YEV B;  3SPC A;  2XAG A;  1K9M W;  2WLM A;  3ABT A;  3B77 A;  2AHZ A;  3ABM B;  4RUE A;  2EIM C;  1YTF D;  1QCE A;  1JOY A;  3OAA G;  2GSM B;  4UUJ C;  2QEX V;  2WLI A;  4R6Z A;  2EIJ B;  3MHS C;  4UV8 A;  1JPX A;  3E89 A;  1K97 A;  4Q20 A;  1SZT A;  3QO5 A;  1F4M A;  4GX1 A;  2YSU B;  3ZMS A;  1S72 V;  1NKD A;  1EZJ A;  4MTO A;  2PI5 A;  5J9P C;  4PEL A;  4Z1M G;  4KFM A;  2B1I A;  3VBB A;  3ABK B;  2HG5 C;  2BOB C;  3SPI A;  4MVO A;  4BIU A;  2Y69 B;  3SJQ C;  5B1A B;  2ZXW C;  2EIJ C;  3ZRX A;  3RVZ A;  1W2B U;  5B1O A;  1K5Q A;  2OT5 A;  5H6Q A;  3OE7 G;  1FFT B;  3F5W C;  3W7S A;  1E1R G;  3T1C A;  2H94 A;  5H9C A;  2DYS B;  4FIP C;  5B1B C;  3LNM B;  3RW0 A;  1E1Q G;  1FXK C;  1YJN V;  3AG4 C;  2OTL V;  1P7B A;  2Q69 A;  3WG7 B;  2A0L A;  5HFL A;  2D3O W;  1S0V A;  4OXS A;  1Q82 W;  2ZXW B;  1GTO A;  1QLE C;  3CCU V;  3E2E A;  1GO3 F;  1YSC A;  2K1E A;  3ZIA G;  1H8E G;  1YTF B;  3OGC C;  4U7O A;  2R9I A;  1G4Y B;  1GKF A;  4FPP A;  1M9N A;  1YI2 V;  1I5X A;  2HFE C;  4GX5 A;  3SPG A;  2XOK G;  1OCC C;  2EJR A;  3CCS V;  4N21 A;  5LBQ A;  4LBE C;  1SER A;  3LSS A;  4GX0 A;  2JEX A;  3CCL V;  2EIK C;  2Q6A A;  2B5U A;  1H38 A;  1UJW B;  2EIN C;  1M90 W;  2ITD C;  3K08 A;  1GK9 A;  1MSW D;  3K0D A;  1S5H C;  4MW8 A;  4RUF A;  3ASO C;  2Z5U A;  3W7T A;  2HLD G;  3BEH A;  2ZDI C;  1PKX A;  2ZQM A;  3UM7 A;  3X2Q C;  1WLE A;  3B8M A;  3E86 A;  5EC1 C;  2BOC C;  2JJ1 G;  1NQT A;  1R73 A;  1OCR C;  4JTC B;  4GX2 A;  4YXW G;  3ABL B;  4TSF G;  1ZWI C;  4U7N A;  4LP8 A;  4GCZ A;  1QLN A;  3CD6 V;  3JD0 A;  3ZN1 A;  2W6J G;  1F4N A;  1M57 C;  5KA6 A;  1CPY A;  3TK1 A;  4J9Y B;  1Q86 W;  3ZCC A;  4WFB V;  3ETG A;  1AI5 A;  4PDV A;  2IU0 A;  3AG2 B;  2MK3 A;  3CCV V;  4PDR A;  1OZ0 A;  2P7T C;  1QQH A;  3ABL C;  3CCR V;  3DTU B;  1KP3 A;  1JJ2 U;  3SYQ A;  4HYO A;  1OCR B;  3D3I A;  3E8F A;  3FB8 C;  3JYC A;  2Q68 A;  5L3D A;  1R3L C;  3F7V C;  1KC8 W;  1PD3 A;  3OR6 C;  1MAB G;  4JAU A;  1NH2 B;  2WLI B;  3ZMV A;  3E83 A;  1DF4 A;  1VQM V;  3OMI B;  1KP2 A;  5CN0 A;  3WG7 C;  4P2Z A;  3AG3 C;  1EFR G;  1J95 A;  2W6I G;  3EFF K;  1RPR A;  4QPK A;  4XDK A;  2EZO A;  3ASO B;  1VQ5 V;  5GW7 A;  2HJF C;  4LC1 A;  3JD2 A;  1MOF A;  2X6C A;  2B1G A;  1NVP D;  3AG3 B;  3STZ C;  1JX9 A;  2IU3 A;  3OUS A;  1BHA A;  2ZDI A;  3OEE G;  2JIZ G;  4FMT A;  1VQO V;  2Y69 C;  5LGT A;  1M56 B;  2P6J A;  2JEU A;  4QE7 A;  2QE7 G;  5CBF A;  5FL7 G;  2M7W A;  4MW3 A;  3EHB B;  4JAV A;  1L1F A;  3CC7 V;  3CCJ V;  3ABU A;  3AG2 C;  3LDE A;  4TWK A;  2EBO A;  2XAF A;  1S76 D;  3WFV A;  4PDL A;  1QLE B;  1OCO B;  5EBM C;  1OCZ B;  2DW4 A;  3X2Q B;  1RPO A;  2V7Q G;  4KP4 A;  4WCE V;  1K3E A;  1R3K C;  2X6B A;  2HVJ C;  4ZBM A;  4WFF A;  3CXC U;  1AI6 A;  1Y4M A;  2DYR C;  3OM3 B;  3JD3 A;  4PA6 A;  5CBH A;  2P90 A;  3G71 V;  4QJF B;  3CCE V;  1DF5 A;  3CPW U;  3OUF A;  2IJJ A;  2EIK B;  1VQ9 V;  2LFR A;  4MS2 A;  4MT8 A;  2IJI A;  3K04 A;  4UV9 A;  1I5Y A;  1JQ0 A;  3W7X A;  4WFH A;  4J9Z B;  1M57 B;  2EIL C;  3LDD A;  1VQL V;  1JCH A;  1VQK V;  4PA7 A;  4JYB A;  3OEH G;  3PJS K;  2XAQ A;  3I56 V;  1AI7 A;  2IW5 A;  3ML0 A;  5LGU A;  1CEZ A;  2PI4 A;  3GB7 C;  4XBF A;  2IJH A;  1DTO A;  2NLJ C;  2UXX A;  4UVB A;  2Q67 A;  2KB1 A;  3JCZ A;  4UVC A;  1K5S A;  2XAJ A;  5IDJ A;  1R6N A;  4MVZ A;  3LUT B;  4TT3 G;  2XAH A;  2IH1 C;  3RBZ A;  1K4D C;  2DYS C;  3ZMU A;  5LGN A;  1S77 D;  2QA4 V;  3K03 A;  3SPJ A;  1Y66 A;  3HB3 B;  4JTD B;  4FK5 C;  3K3W A;  3T4D A;  2CK3 G;  1F51 A;  3I55 V;  3CCM V;  4R8C A;  3ETD A;  1MG1 A;  5B3S C;  3P32 A;  1V54 B;  1M1K W;  3RVY A;  1NR7 A;  4JPR A;  3ZRW B;  1LNQ A;  1CP9 A;  1H8H G;  4BIZ A;  1QBZ A;  1GMG A;  3FYI B;  3CMA V;  2ZD9 A;  1FXH A;  4KUM A;  1AJQ A;  4N23 A;  4DXW A;  1YJW V;  4JF3 A;  4RQE A;  2F43 G;  3M99 B;  4GT1 A;  2WLL B;  2A79 B;  2OCC C;  3ABM C;  1COW G;  1ORQ C;  1IXM A;  4MTG A;  3VOU A;  2AHY A;  5DN6 G;  3AEI A;  3D36 A;  1V54 C;  1FXV A;  4JTA B;  4CZZ A;  4WFE A;  3F7Y C;  4R50 A;  5IY5 B;  5EBL C;  5L3E A;  3JD1 A;  3QNE A;  2IJK A;  2OCC B;  1YIJ V;  3K06 A;  4QPJ A;  4P9P A;  2DQ3 A;  1AR1 B;  4L87 A;  5L3C A;  1FXK A;  1SRY A;  2Y48 A;  3FB7 C;  3LDC A;  4QE9 A;  4G28 B;  1PNL A;  4XDJ A;  5EC2 C;  1VQ8 V;  2EIL B;  5LHI A;  1QR9 A;  4RQF A;  1N8R W;  1YIT V;  2W0F C;  5B1A C;  2DQ0 A;  2DWE C;  4QNH B;  1NH2 D;  1Q81 W;  5CA3 A;  2WWW A;  3IGA C;  2P67 A;  5L3B A;  2WLL A;  1EBO A;  5LHG A;  3CP1 A;  5L3F A;  1K73 W;  3H01 A;  1BMF G;  3SYC A;  1NVP B;  1PNM A;  3TCU A;  1W0J G;  2X0L A;  3DGE A;  3A0R A;  3NXS A;  2GHY A;  3FYE B;  2R9R B;  3TET A;  3OW2 U;  2FTK A;  3GWO A;  5EBW C;  2EZP A;  3R65 A;  4PA4 A;  2LP7 A;  4MTX A;  2QKS A;  3W7U A;  1G8M A;  3OFN G;  3ZRS A;  3ETE A;  3ZJZ A;  5E1A C;  3E8B A;  4H33 A;  1P4R A;  4LCU C;  1R3J C;  1VQ7 V;  4UVA A;  1R6K A;  2H8P C;  4RO2 A;  1KD1 W;  3T2M A;  3MD0 A;  3SYP A;  4HZ3 A;  3ZRW A;  3HPL C;  3K79 A;  4JAS A;  5DM6 V;  4PA3 A;  1K4C C;  4BAY A;  4CBC A;  3ASN C;  3E8G A;  4R7C A;  2X6A A;  2X7R B;  3SYA A;  2ATK C;  4MVS A;  5BZB A;  3FKS G;  3B8N A;  4P30 A;  2OTJ V;  3FB6 C;  3G6E V;  2UXN A;  1NBM G;  3P30 A;  2QM7 A;  3AG1 C;  2WLK A;  3UKM A;  1RM1 B;  3CME V;  5CBG A;  1THZ A;  4QIW F;  3CC4 V;  1K33 A;  1BL8 A;  3G4S V;  2WAM A;  2ZR3 A;  4X89 A;  1AJP A;  3IFX A;  3STL C;  1K34 A;  3ZMZ A;  1QVF U;  4PDM A;  3LSQ A;  4WFG A;  1K7D A;  1QVG U;  5IY5 C;  5KUK A;  2V1D A;  3QO8 A;  2HR3 A;  1H2G A;  1OCZ C;  2WSS G;  1GM9 A;  1DLB A;  2HKO A;  3E8H A;  1VQN V;  1PL0 A;  3SPH A;  2DYR B;  1FXK B;  1S3J A;  2Z3Y A;  4I9W A;  4X8A A;  3AG1 B;  4X88 A;  3OR7 C;  1KEC A;  4ASU G;  2WLN A;  4EKW A;  2LFS A;  2A9H A;  5B1B B;  2C2A A;  2WPD G;  4I5S A;  1NJI W;  3ZN0 A;  1PNK A;  4DO2 A;  3MHH C;  2QM8 A;  1VQ6 V;  1KKD A;  5HFM A;  3OMN B;  2NNU A;  1M56 C;  1JVM A;  3OMA B;  5IYB O;  5IYC O;  2HVK C;  2JJ2 G;  4BW5 A;  1XL4 A;  3ZRV A;  4MVU A;  1ROP A;  1R3I C;  5LHH A;  3E35 A;  4WFA V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...