1TUEB

The x-ray structure of the papillomavirus helicase in complex with its molecular matchmaker e2
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
194
structure length
194
Chain Sequence
b'HMQTPKETLSERLSALQDKIIDHYENDSKDIDSQIQYWQLIRWENAIFFAAREHGIQTLNHQVVPAYNISKSKAHKAIELQMALQGLAQSAYKTEDWTLQDTCEELWNTEPTHCFKKGGQTVQVYFDGNKDNCMTYVAWDSVYYMTDAGTWDKTATCVSHRGLYYVKEGYNTFYIEFKSECEKYGNTGTWEVHF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replication protein E1
publication title The X-ray structure of the papillomavirus helicase in complex with its molecular matchmaker E2
pubmed doi rcsb
source organism Human papillomavirus type 18
molecule tags Replication
total genus 62
structure length 194
sequence length 194
chains with identical sequence E, G, J, L, Q
ec nomenclature
pdb deposition date 2004-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00508 PPV_E2_N E2 (early) protein, N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.30 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1tueB01
2.170.200.10 Mainly Beta Beta Complex Regulatory Protein E2; Chain: A; Domain 2 Regulatory Protein E2; Chain: A; Domain 2 1tueB02
2JEUA 1QQHA 1R6NA 2JEXA 1R6KA 1TUEB 1DTOA 2NNUA
chains in the Genus database with same CATH superfamily
5J9PC 4I0XA 1AI4A 4J10A 4DR7B 2Q67A 3FB8C 4I7ZB 2IU0A 3OD4A 2OTJV 4C7UA 2WPDG 1H8EG 4FZ0A 4GX1A 5KX5B 5EYPB 3JD4A 4NR1A 1HW7A 4DV7O 5IYDO 3BA8A 3NXSA 4X9QA 5KHIA 3CCEV 3ZN1A 2OIEA 3CXHF 4NXNO 5IY5B 1P7GA 3CWBH 2E75B 4DR6B 1SESA 3OMAB 5B1NA 3OM3B 3ZRWB 1ZL8A 3AEIA 1N4CA 1K5QA 3N2GA 2RJZA 3G6BA 1BE3H 2DE0X 3SPHA 3ABMB 1QQCA 1K97A 4DK1A 3JAKB 2IW5A 5LGUA 2KG7B 2Y48A 3E8BA 4LNUB 5EZYB 2UXDO 1I7FA 3RYHB 1R3LC 3AK3A 3UO2A 2QA4V 2W0FC 1I5XA 4DR2B 1K9MW 5B66Z 1R73A 4X62O 3CCLV 2QM7A 3BRCA 3M8AA 3W7SA 1MSWD 3OE7G 4AI8A 1YVWA 2GUZB 4TUYA 3STLC 1HR0O 4CS3A 4P30A 1IZ3A 1NQTA 1Y74B 5JQGA 2CGNA 3RYIA 4MVMA 5KHKA 4LH6A 3ZX6A 4XDLA 5LXTB 5KLVH 4CH5A 1L0NH 4G27B 3T1CA 3K0DA 3W7XA 2X7RB 2ODMA 4U3JA 3WG7C 3JSLA 1OCOB 3T4ZA 2F23A 4DV7B 3E8GA 4QE7A 2CH7B 3D3QA 3TETA 1IX9A 5CB4B 4BWAA 2HVKC 3KKYA 4R50A 4NXNB 5L3EA 3UCSC 2RNBA 1SS3A 1TGOA 2L35A 1SQBH 1H38A 1YITV 2VWJA 3R66A 1NTKH 5D5PA 2FYUH 2EZPA 1T5EA 5BMVB 4PDRA 4BIZA 4UFZA 5LA6A 2Q9LA 1BCCH 2UXDB 2WA3A 2CK3G 4TV9A 2BTOA 3H01A 1GM7A 2NR5A 3WB1A 5JVDB 3K3WA 3VBBA 3B09A 1MNGA 4R7CA 1DGSA 4DW1A 3CYOA 4K0KO 4BIOA 1N0JA 4X62B 4OPHA 3DXRA 1V55C 3Q4HB 5J2TB 2D2CB 3JAWA 1Q6IA 3RYFB 3CCJV 2E5LB 1R6KA 1YIJV 3ZMSA 4CZZA 1VEWA 2VWKA 3U0ZA 2CE4A 4L87A 1Y76B 3VQVA 1HR0B 5B3SC 2QDOA 5IWAO 1D5NA 2JEXA 5ITZB 5L3FA 3GVMA 4EB6B 4WFEA 1EN4A 4DV5O 1PL4A 4DUZB 1E1QG 2F1MA 4ZHQB 1IBMO 1DK1A 2WSSG 2CUGA 1SRYA 5JH7A 5HFMA 4X1IA 1K73W 1FJGB 3TGUH 1R3KC 3G67A 3E2EA 4YJ2B 5LL6Y 1GO3F 4DR3O 4X8AA 4O2BB 3CS5A 4D7TA 4YHHB 3HKDA 1FFTB 1QR9A 4GYCB 2A9HA 4X64B 3OGCC 4GKKO 1K34A 1L0LH 1QQHA 1UFIA 2DQ3A 4CH3A 2RQ6A 4X66B 1WP8A 1AR5A 3L9DA 2DYSB 5CBHA 4LWSA 4GX5A 2OCCB 1MMMA 2EIJC 1I08A 2CTPA 2WLLA 3SJQC 1M4UA 2ZE6A 2HJFC 2Q0OC 5FL7G 1WN7A 4U3FH 2E3CA 2PI4A 4LF5O 2XNDG 4H44B 5LMNO 3K5NA 2UUAO 1S5LZ 1Q86W 3SR2C 4UCOA 3QG5A 3A2FA 3G4SV 4K8ZA 4IIJB 2CAZC 1XUQA 3ZBHA 1FYJA 2WAMA 3JARB 4MTGA 2JGDB 4EFBA 3ZJZA 4AQYO 3I5DA 4DV5B 2IJIA 2ZM6O 1IBMB 3FYEB 1M93A 5JJJB 4DV1O 1N32B 2Y69B 1EN5A 1IXBA 2R9IA 2QWNB 4B3MO 3KCYA 2EX3A 3CCQV 3BHPA 3OR6C 1FXKB 1EBOA 1XBLA 4JAUA 1ZX3A 4LBEC 5C8YB 2FKXA 4MW8A 5LYJB 2Q4PA 1YI2V 4GUNA 1EN6A 4EFEA 1GK9A 3JASB 2G38A 4GKKB 3B40A 2QEXV 3VOUA 2PF4E 1VF6A 1SQQH 3ASNB 4TQFA 3ZHVA 1IDSA 3TCUA 4B3TB 1CP9A 1CEZA 1VQ6V 3H9VA 4B3RO 3OEEG 4UCVA 4PA9A 5KHGA 4LF5B 5LMNB 2UUAB 4Z1MG 2VQFO 3TJTA 3CCVV 2GDSA 3SPCA 3VQYA 2ZT9B 3JCUZ 5B1BC 4J9ZB 5LHHA 3LSQA 3AG1B 4YXWG 2V1DA 4LF9O 4PDMA 2BSKA 4FIPC 2PTMA 3ZHTA 4DR4O 1JJ2U 3ZRXA 1KKCA 1R6TA 3QO8A 2KKWA 2YEVB 1QLEC 4WF9V 3OTFA 4DV1B 4DV0B 5LGTA 4X1KA 1AI5A 2NNUA 2V4DA 1FAFA 2ZDIC 1Y4MA 2QE7G 2B9ZA 3RFRA 1YJNV 1JX9A 2DJVA 1SETA 2DQ0A 2JEUA 3FKSG 2ARHA 3DTUB 1H2GA 3K57A 4B7KA 1QVFU 5KHJA 3ABKB 4LCUC 1BHAA 1F4MA 4O4IB 3B2EE 3BVOA 1NVPB 4YIPA 1URFA 2JGUA 4KFMA 1VF7A 1OCCB 3D36A 2AZ2A 1NTMH 5A2QN 4JI7O 3ZHUA 2XAHA 1KYOF 3CCRV 1NJIW 4W4LA 2DYRC 1KQSU 4X1YB 4PA7A 5BXZA 1QNMA 1XOUA 4DRXA 1NZ6A 3T2MA 3TK1A 3M7MX 2YXYA 2YI8A 5IJ9B 3LNMB 2XAFA 3BPZA 5EZYA 4QE9A 2LGQA 1YHQV 2IH3C 4YIOA 3X2QB 2FB5A 3MHSC 3IGAC 5DN6G 2VQFB 2LQTA 3AG3B 3ETQA 2ZE5A 1K33A 1QLNA 4GZRB 2AGAA 1V54B 1SERA 3OMNB 2YDEA 1U96A 1VQPV 4LF9B 4TQDA 1M56B 5H2FZ 2GUZA 4DR4B 1NH2B 1K92A 1I94B 4ICGA 3LDDA 5IY5C 3NR7A 5JCOC 4H13B 3U11A 3ABMC 3B77A 1SZXA 2NLJC 1I0HA 4FLUA 4LFAB 3CMEV 1KD1W 4JI5B 3ZHSA 4MVUA 2YXHA 2ZIOA 4I9WA 2CH7A 4DUYO 5K1PA 1AB3A 4UVBA 5CB4A 4I4TB 2N04A 1XNRO 5KMGB 1QCEA 4FPPA 3SDLA 1VQ7V 1D2DA 3DC5A 1VARA 3RVZA 2QM4A 3EVKA 2V7QG 4Z2WA 2WLMA 5D5QA 2XAGA 5J2UA 2M6YA 4NTYA 4UB8Z 3E22B 2WLJA 1FKAO 2WLKA 1WA8B 1OHHG 5IYBO 1WB8A 2ZIMA 4CS2A 5L3BA 2Q73A 1VQLV 1VQ8V 1W59A 2DWDC 3LNNA 3HB3B 3Q4HA 2YIBA 3ZMUA 3APOA 3RYFA 1OCOC 4J7ZA 2ZNJA 3P3NA 4LC1A 5FPOA 5CA0B 4JAAA 4LF4O 1Y76A 5JWPA 3UKMA 3N2KA 3UM7A 5BR8O 2MK3A 1MA1A 2HP8A 5KA6A 3WB2A 1S5HC 3E8FA 3SPGA 2CTQA 3H1IH 1TA8A 5AG2A 1TVKB 1UPGA 5KA5A 1JPXA 4O4LA 1N34O 3LSSA 2ZR2A 4JTDB 4QGPA 3ZHQA 4I5SA 3CMAV 1BL8A 1NT2B 1PL0A 5B5EZ 3FYIB 4O2BA 4NKGB 4L8JA 1PP9H 1YCIA 4F6EA 1XNRB 4GX0A 2HR3A 3L75H 1N0NA 4JI0O 2LFSA 2P90A 2KB1A 5LHIA 2Z3YA 3K9SA 3ML0A 1PKXA 1WPXA 1M57B 5E1AC 3E83A 4P9OA 2F4VB 3C90A 2QGNA 1VQ5V 1SF9A 4ZOLB 2YIBD 4OX9O 5GTHZ 1FD9A 3F5WC 4X65O 2UU9O 3LUTB 2UXBO 5A9GA 1HNXO 2UUBB 1R6NA 3AK2A 4NB5A 1PV0A 1YF2A 4O4HA 1RSOB 4K3AA 2AW9A 1JFFA 1WNSA 4XBFA 4ZIBA 1MZFA 2Q7HA 4JI8B 5CN0A 1LR1A 1RP3B 3AG2B 5BR8B 4FLZA 4FLTA 3H1JH 4LF7O 2JRIA 4MVSA 2JGDA 2UXXA 5L3CA 5CA1A 5CBGA 1KMIZ 4F6RB 4J11A 3D3IA 5H5NA 2DYSC 3JATA 2Y0IA 5IJ0B 2OCCC 1SZTA 4PDLA 1QVGU 2HG5C 1AI7A 1N34B 4PDVA 1COWG 1KP3A 4HBNA 1N8RW 1SQGA 5LOVB 1HNWO 3JSNA 3ABUA 4CH4A 5IDJA 2WA4A 3QTCA 2N05A 1JQ0A 4I55B 3JD2A 4DV2O 4UCSA 1AJPA 3QO7A 1M5IA 3T1HO 4JI0B 3RYCB 5IYZB 2LJ2A 2OIGA 4JASA 5LGNA 4NYKA 3ZN0A 4QJFB 3JD0A 3OMIB 1SKVA 1NKDA 2P67A 3BA9A 3FB5C 2JS5A 4YJ3A 4OX9B 2ILMA 3SJBC 5DM6V 4DV6O 3E86A 1H2MA 2ADQB 4X65B 1HNXB 2Y69C 3RGBA 3ABLB 3UQ8A 4O4JA 1B3QA 3SPJA 1FXKC 1KP2A 1F23A 1OCRB 3R65A 2Y4TA 1VQ9V 4TT3G 1JJOA 4FZ1A 1VP7A 1TUEB 3B4SA 1G4YB 5H6RA 4JZGA 1JCHA 1S72V 4LF7B 3JALB 2XASA 4I50B 3HKCA 2HKOA 1R3IC 1SQXH 1WJZA 3BEHA 3ASNC 2WLIB 1K4DC 3HPLC 4KXRA 4N23A 1QHTA 3K5LA 4G28B 1QU7A 3KCXA 5FPRA 4IHJB 2BOCC 1GH6A 4LF6O 1UJWB 3JYCA 4JAVA 2QKSA 4UXNA 5LP6A 3FAVA 1HNWB 3IC9A 4WBNB 4J80A 4DV4O 3E89A 2GSMB 3WB0A 2RCVA 1S3JA 4NTWA 2PYLA 4O4IA 4DV2B 3SYQA 3H1KH 3E8HA 4E2LA 3APQA 3DGEA 4JF3A 4I0XB 4JYAO 2ZD9A 3HKBA 1YEWA 2XAQA 4PI2A 2JDIG 1H2NA 4X1YA 2ETNA 3AG1C 4JYCA 1GKFA 2MW2B 1D5AA 1XQ8A 1SQPH 4DV6B 1IXMA 1EZJA 4UUJC 4FM0A 1BQ0A 4HNAA 1QBZA 2H94A 4MTXA 5TISZ 1P84F 3B8MA 4AHCA 1J5EO 2EJ7A 4K0KB 1ZL8B 1BMFG 5LMUO 5LP6C 3OGIB 4MVQA 3H1HH 2JJ2G 2B5UA 4R8CA 1Q81W 5EBWC 3ABKC 1XEQA 1SQFA 1SQVH 3G6EV 2EINB 2BE3A 1OCZB 5IWAB 2ZXWB 4IYHA 2ADPA 3ZHRA 3BABA 4FLXA 4J7KA 3BFRA 3OW2U 1N36O 4Z1VA 1BZKA 2GTSA 4LF6B 1AROP 3MD0A 1AJNA 4RUEA 4DV4B 1TUBB 4DR3B 3X2QC 4TUYB 5B1AB 2LGWA 1WAZA 5JQGB 3RYIB 3AG3C 2P22C 4FFBA 5KMGA 1NI8A 4JYAB 2P4KA 2HLDG 4HYOA 1V54C 4GT1A 2Z5UA 4BR6A 2IM9A 1M56C 1KKDA 3ETEA 1FXHA 2R72A 2JJ1G 4U3JB 2AZ0A 1ZUQA 4JI4O 2ZDIA 4BIUA 1HP8A 2XT9A 4I9QA 4F4LA 4Q20A 4X20A 1VQKV 3CJHA 2RMKB 1BT8A 2K9PA 4LH7A 3L73H 1PNKA 4OGQB 1VQNV 4TSFG 3ZRVA 4DR5O 4IGGA 3A8TA 2CDYA 5EIBC 4JTAB 1SA0B 2DN9A 4LFCO 3OUFA 4QIWF 3RWRD 4DV3O 3UT5A 2A79B 5LA6B 1H8HG 2DOSA 5GONA 3QNEA 4TV9B 4O2AA 1K7DA 4J7JA 3F5TA 2GHYA 1B6QA 4FK5C 4AQYB 1HWYA 5EIBD 3FD9A 1ROPA 2UUCO 2IH1C 2R9RB 2ZM6B 4JI6O 2WLNA 1N36B 5H6QA 4DYLA 3DXRB 4B3MB 3QF7A 3JAWB 1XL6A 4BW5A 4JYYA 1PD3A 5KX5A 5EYPA 4UVAA 1US6A 4QPJA 5FLXN 3SJAC 4RQEA 2BOBC 4UCTA 1YJ9V 5JCOA 1L8DA 4FLWA 2PY5A 3DC6A 3ZRWA 1YTFD 2B1GA 4GKJO 3T4DA 2ATKC 1AJQA 3JAKA 2KG7A 2EIKB 1AR1B 2ITDC 1G8MA 4H33A 2H3OA 3CD6V 1Q6HA 4LNUA 4B3RB 3RYHA 3HKDB 3CPWU 1XI1A 2L6LA 1GN2A 2DMXA 2JVDA 2A3QA 4UV8A 4ABMA 4NTXA 4P2ZA 4W4KA 1S77D 4XDKA 5EBLC 3A0RA 1RSOA 3K06A 2UXNA 4LWSB 3MHHC 4DW0A 1Q3EA 4DR1O 2LW7A 2GV9A 4DV3B 2Q8VA 1O9HA 3CSXA 3ETGA 1XMQO 3L72H 2KSDA 1W0JG 4D7SA 3CHXA 3SYCA 2R9AA 2IBZH 4H0LB 5HFLA 1Y74A 3FB7C 4F6RA 2OWOA 4J9YB 2UUCB 2EILB 1OZ0A 1WLEA 5IJ0A 1FFXB 1M57C 4IL6Z 5LXTA 5KUMA 1LUWA 2R70A 3KZIZ 5B1OA 4FM1A 3CC2V 2UXCO 3SYPA 1Q5OA 2AXTZ 2ZCEA 4JI1O 3ZEDA 1M1KW 2ZNIA 1RPRA 1I5YA 4I55A 1MOFA 1NR7A 5LBQA 4G2KA 1U97A 1IBKO 1N33O 3RYCA 2D3OW 4JPRA 1K8AW 4JI7B 4UCRA 3LDEA 1YDXA 2DW4A 4PD4F 3IFXA 4GKJB 4UCUA 5CBFA 3AG2C 5IE9A 3RT3C 3OT7A 1DLBA 1Y67A 2QTOA 2XOKG 1Q6UA 1Z2GA 4U7OA 5BMVA 4K8XA 1ZWIC 3K79A 3L71H 4WFAV 4MS2A 3TXSA 2Q6AA 5JVDA 4WFBV 2AHYA 3K04A 4RUFA 2HHHO 2QWOB 3OR7C 1MZEA 3K08A 1AILA 2LP7A 5J2TA 3K0GA 3RN4A 4DR1B 4ZI7B 3AG4B 3ZIAG 4RQFA 1Z5WA 2Q0AA 1VQ4V 3LDCA 1XMQB 5CMUA 1S76D 3ZMTA 1P7BA 2N74A 2EJRA 3W7TA 3JALA 1YZBA 3KG2A 1DF4A 3IJ4A 3P30A 1XHXA 5ITZA 2WLIA 5JJEB 4EB6A 1VMGA 1P49A 2JK5C 3H1LH 4ZHQA 2CTRA 2OCHA 2QWRB 2UXCB 1ENVA 2OYQA 4JI1B 2F95B 1L1FA 3CXCU 1GN3A 1OJHA 4YJ2A 2BSKB 3ABLC 3AK1A 4JYBA 3SJCC 4DUYB 1IBKB 3CE2A 2LO1A 2LW1A 1Z5VA 3M99B 4A5UB 1OCRC 4X1KB 1BHBA 3MAQA 4JI2O 2Q7GA 4NXMO 3I55V 3PJSK 2A06H 1AP5A 2VQEO 1KECA 1DF5A 3ETDA 3JCZA 1RFYA 2FTKA 3ZMVA 4QNHB 1NR1A 4DXWA 2W0XA 2EULA 2PGGA 1JA8A 1BS3A 1P4RA 1KB9F 2HHHB 1W2BU 3K9AA 4DRXB 1K3EA 4ASUG 2EBOA 4FJCC 4CS4A 1H2KA 4IYIA 4IIJA 4LF4B 1M9NA 4WCEV 3O9OA 3OTOO 3O65A 4WFHA 1QR8A 3JARA 1XREA 3SYOA 4MW3A 1EZVH 1PNLA 3A0BZ 1KUQA 2E5LO 3EFFK 1TAEA 1FXKA 1XNQO 1TUBA 3WFVA 4CBCA 5C8YA 2AHZA 5LYJA 5KAIZ 2XHBA 1R1BA 4RAIA 3PN1A 2HFEC 2XUMA 2FL4A 3HKEB 4UB6Z 3JASA 2LFRA 4DUZO 2RDCA 4JI2B 3W7UA 3L70H 1AVMA 1RM1B 3S3WA 3ZCCA 4NXMB 2WLHA 1FJGO 1AP6A 4LF8O 2VQEB 2EINC 1A32A 4LP8A 2VS0A 1FPOA 1OCZC 2ZXWC 3JD3A 2QJ1A 2EIMB 5BZBA 4YHHO 2X0LA 3ASOB 2IJHA 3L74H 2UU9B 2UXBB 1K4CC 1NBMG 2WWWA 4X64O 3CB2A 2ITCC 3GWOA 2K1EA 4X66O 1G1XB 2PYJA 2Z0AA 4X88A 2M7WA 2P4VA 2YICA 1SA0A 3CEIA 5J2UB 2ZQMA 5B1AC 3QVNA 1GN6A 4B3SO 1E79G 4TV8B 2F93B 1FS0G 2ZE8A 5EC2C 3OTOB 1RPOA 3U10A 1KBHA 5L3GA 4MVRA 2X6CA 4XDJA 1F7YA 1AI6A 2QM8A 3CRCA 2YEVA 2P06A 4QPKA 2Y0PA 3CRMA 5K1XA 1SC5B 2BTQB 4P9PA 2YC0A 4FLVA 1XNQB 1ZTEA 2EZOA 2B1IA 3BY6A 1GM9A 3N2KB 5FNVB 1PPJH 4R6ZA 1BGYH 4RWUA 3CCMV 4TWKA 4E4EA 3T1HB 3J81N 1S0VA 1N32O 5LHGA 4MTFA 5JJNB 3THOA 1OV9A 1GRJA 4GX2A 4O4LB 3AG7A 3OUSA 4LF8B 4DO2A 2F43G 5IYCO 2A7WA 4KHPO 3CCUV 5IJ9A 5BY1A 1S5JA 2VRZA 3QO5A 2IJJA 1MSDA 4CC6A 2PZSA 3OAAG 2DWEC 2P5OA 4PA6A 4YY3O 5GTIZ 4EEQA 3EXAA 3J7AU 2PUSA 3N2GB 5C93A 4B3TO 2RN9A 1YXBA 3FB6C 1MG1A 3B8NA 4B3SB 2HEPA 2P6JA 3JAMN 1Q8IA 4PELA 4D6TH 4H37A 3WG7B 2Q69A 1OCCC 1XL4A 3F7VC 4J42A 4CH6A 1EFRG 3K58A 3STZC 4UVCA 1FFXA 5F2VO 1G6UA 2JS3A 4O4HB 3K5MA 2EIKC 3K59A 1WP7A 1NVPD 1ORQC 1JFFB 3GB7C 4MVOA 3J80N 3C3SA 3T1YO 4OXSA 1LUVA 4U7NA 2BCCH 5CA1B 3GWKC 1WPBA 4PA4A 3P3PA 3WU2Z 3F7YC 3CC4V 3D8CA 4I4TA 1HNZO 4DV0O 3JATB 3UO3A 4GLXA 1ZLZA 1JOYA 4J41A 4WFGA 4FFKA 4OPAA 4MSWC 4KHPB 5DECA 3K5OA 1NU1H 1V55B 3E35A 3OEHG 4X89A 2QWQB 3E22A 1THZA 1VF5B 2EILC 3ZMZA 1NTZH 1M90W 1WA8A 3RBZA 1PNMA 4YY3B 5B3SB 3EHBB 1H2SB 2Y4UA 1NH2D 1J5EB 3I56V 5LMUB 1BQZA 1LNQA 4BAYA 1B04A 4ZI7A 3TXQA 2JIZG 4YJ3B 5CA0A 3G80A 4FLYA 1MABG 1B06A 1BSMA 3G71V 2OTLV 2W6JG 3VQWA 1X4TA 2Q7EA 4PI0A 4O4JB 3HR0A 2ZKOA 2E76B 4K35A 3SYAA 4PV1B 1TVKA 3BAAA 3T1YB 3IC7A 1VQMV 1CXZB 2F66C 3SGIA 1VIBA 1I94O 5H9CA 3CRAA 3HKCB 4HAMA 1KC8W 2QKCA 2EIJB 1GN4A 1VF6C 4DK0A 1HNZB 5GW7A 4TOIA 1K5SA 5KAFZ 3SPIA 4LFBO 3AG4C 1XDCA 1HDJA 3IAYA 1NS1A 1JVMA 3CRRA 5JH7B 4LFAO 3CP1A 3S3XA 2KQXA 4FM2A 5LP6B 3FAVB 1Q82W 4X1IB 4JI5O 1XHZA 3RVYA 4JI4B 1IBLO 1R3JC 3ZRSA 4ZOLA 5EK0A 1EM1A 2YSUB 2YS8A 1E1RG 2NN4A 2YXLA 4N21A 4NVPA 1YSCA 1ZSPA 2A0LA 3HKBB 1AR4A 2ZE7A 4JV5O 4FMTA 2CTWA 1Y6XA 3ICXA 4DR5B 1IURA 5IT9N 4CC5A 4LFCB 4PHZA 1PM9A 4GCZA 2W6IG 2O57A 3FFQA 3DSQA 2WLLB 4B7EA 4HNAB 2QTSA 1JMKC 4FVMA 2YIDA 2YIAA 2IJKA 4JI3O 1ZAUA 1XILA 4JI6B 3CX5F 2E74B 2XTAA 5E79Z 1XMOO 3CC7V 2PI5A 2X6BA 5LOVA 3C3TA 3N27A 1Q7YW 4PA3A 3D36C 1GAXA 4PJ0Z 4AILC 2XAJA 2H8PC 1GM8A 3HKEA 3MDSA 3ABTA 5IYZA 2FMLA 3K03A 2QSAA 4JGSA 4LFBB 2GBOA 4DR7O 1H2LA 1V9PA 1W0KG 2QWPB 4UV9A 1FXVA 2YI9A 2HVJC 2HJDA 5EBMC 3A0HZ 4MTOA 3BCCH 1Q43A 1IBLB 1F51A 1J95A 2GTAA 2YUAA 2P7TC 3FX7A 3P32A 3RW0A 1YJWV 5B1BB 2QR4A 4EKWA 2Q68A 5KUKA 1JR9A 3LSUA 4FFBB 3ZS8C 1X59A 1Y66A 4JV5B 4DR6O 2C2AA 1WB7A 1QLEB 5EC1C 2ZR3A 4KL1A 1F4NA 4MT8A 4Q6GA 3CRQA 2F4VO 4TV8A 4ZKIA 1GMGA 4HZ3A 3VQXA 4X20B 4ZBMA 4I50A 3W7WA 1YTFB 3CJHB 2X6AA 4WFFA 4BW9A 2UUBO 5L3DA 1IVSA 4JI3B 1RM1C 1O9GA 2OT5A 2ZINA 1Q90D 4LR3A 4MVZA 4DR2O 1XMOB 2BTQA 1DTOA 1GTOA 4B08A 2CGOA 4IHJA 3JD1A 4JZ2A 2IU3A 1VQOV 2Q5ZA 2DYRB 3UT5B 2EIMC 3CCSV 4WBNA 4JI8O 4RO2A 3ASOC 2QKAA 5FNVA 5CA3A 5GONB 4JTCB 5KHHA 5DEDA 4O2AB 4KUMA 1KU9A 3OFNG 4KP4A 1CPYA 4IT5A 1N33B
chains in the Genus database with same CATH topology
5J9PC 4QE9A 4X88A 2M7WA 1AI4A 2IH3C 1YHQV 3X2QC 3X2QB 2ZQMA 5B1AC 2Q67A 5B1AB 3FB8C 3MHSC 3IGAC 1E79G 5DN6G 3AG3C 3AG3B 2IU0A 1FS0G 5EC2C 2OTJV 1K33A 1RPOA 2WPDG 1H8EG 1QLNA 4GX1A 5L3GA 2HLDG 4HYOA 1V54C 1V54B 1SERA 3JD4A 4MVRA 2X6CA 3OMNB 4XDJA 1AI6A 4GT1A 2QM8A 2YEVA 2Z5UA 1VQPV 1M56C 1M56B 5IYDO 4QPKA 1KKDA 3ETEA 3NXSA 1FXHA 3CCEV 2JJ1G 3ZN1A 1NH2B 1K92A 3LDDA 5IY5C 5IY5B 2ZDIA 4BIUA 4P9PA 1SESA 3OMAB 5B1NA 3OM3B 3ZRWB 4F4LA 3AEIA 4Q20A 1K5QA 2EZOA 1VQKV 2B1IA 3BY6A 3SPHA 3ABMC 1GM9A 3ABMB 3B77A 1K97A 2NLJC 2IW5A 5LGUA 2Y48A 1PNKA 4R6ZA 1VQNV 3E8BA 4TSFG 3CCMV 4TWKA 3CMEV 1KD1W 3ZRVA 1R3LC 4MVUA 1S0VA 5LHGA 4I9WA 4MTFA 4JTAB 2QA4V 3OUFA 4QIWF 4GX2A 2W0FC 1I5XA 4UVBA 3OUSA 2A79B 4DO2A 1H8HG 2F43G 1K9MW 1QCEA 5IYCO 1R73A 3QNEA 3CCUV 3CCLV 2QM7A 4FPPA 1K7DA 3W7SA 1VQ7V 2GHYA 1MSWD 1B6QA 3OE7G 4FK5C 3RVZA 1HWYA 3QO5A 1ROPA 2IJJA 2IH1C 2R9RB 3OAAG 2V7QG 2WLNA 2DWEC 5H6QA 2WLMA 2XAGA 3STLC 4PA6A 4P30A 1NQTA 1XL6A 4MVMA 4BW5A 2WLJA 2WLKA 1PD3A 5C93A 1OHHG 4XDLA 3FB6C 5IYBO 5L3BA 4UVAA 1MG1A 3B8NA 1VQLV 1VQ8V 2P6JA 4QPJA 2DWDC 4RQEA 4G27B 3T1CA 3K0DA 4PELA 2BOBC 3HB3B 3W7XA 4H37A 2X7RB 3WG7C 3WG7B 2Q69A 3ZMUA 1YJ9V 1OCCC 1OCOC 1OCOB 1XL4A 3T4ZA 3F7VC 3E8GA 4QE7A 4LC1A 1EFRG 3ZRWA 3TETA 1YTFD 2B1GA 3STZC 4UVCA 2HVKC 4R50A 3UKMA 5L3EA 3T4DA 2ATKC 1AJQA 2MK3A 3UM7A 2EIKC 2EIKB 1NVPD 1AR1B 5KA6A 2ITDC 1ORQC 1S5HC 1G8MA 3GB7C 4H33A 4MVOA 3CD6V 4OXSA 1H38A 3E8FA 1YITV 3SPGA 3CPWU 4U7NA 4UV8A 5KA5A 4P2ZA 2EZPA 1JPXA 4PA4A 4PDRA 3LSSA 2ZR2A 1S77D 3F7YC 4JTDB 4BIZA 3CC4V 4XDKA 5EBLC 4I5SA 3CMAV 2CK3G 1BL8A 3A0RA 3K06A 2UXNA 1PL0A 3H01A 3MHHC 1GM7A 3FYIB 1JOYA 3K3WA 3VBBA 3ETGA 4R7CA 3CYOA 1W0JG 4WFGA 4GX0A 2HR3A 4MSWC 3SYCA 1V55C 1V55B 2LFSA 2P90A 5HFLA 3E35A 2KB1A 3OEHG 3FB7C 5LHIA 4X89A 3CCJV 2Z3YA 3ML0A 1R6KA 1YIJV 4J9YB 3ZMSA 1THZA 2EILC 2EILB 1OZ0A 4CZZA 3ZMZA 1WLEA 1M90W 1PKXA 1WPXA 4L87A 1M57C 1M57B 3RBZA 1PNMA 5E1AC 5KUMA 3E83A 4P9OA 5B1OA 5B3SC 5B3SB 1VQ5V 3EHBB 3CC2V 3SYPA 2JEXA 5L3FA 1NH2D 3I56V 4WFEA 1M1KW 1LNQA 3F5WC 1E1QG 4BAYA 3LUTB 1RPRA 1I5YA 2JIZG 1MOFA 2WSSG 1SRYA 1NR7A 5HFMA 5LBQA 1R6NA 4G2KA 1MABG 1K73W 3E2EA 2D3OW 1R3KC 3G71V 4JPRA 1K8AW 2OTLV 2W6JG 1GO3F 4X8AA 3LDEA 2DW4A 4XBFA 3IFXA 5CN0A 1FFTB 1QR9A 3AG2B 3AG2C 5CBFA 2A9HA 3SYAA 1DLBA 3OGCC 4MVSA 1K34A 2QTOA 2XOKG 2UXXA 5L3CA 1QQHA 4U7OA 2DQ3A 5CBGA 3IC7A 1VQMV 1ZWIC 3D3IA 3K79A 2DYSC 2DYSB 4WFAV 5CBHA 4MS2A 4GX5A 5H9CA 2OCCC 2OCCB 1SZTA 4PDLA 4HAMA 1QVGU 2HG5C 1AI7A 2Q6AA 4WFBV 4PDVA 2AHYA 1KC8W 1COWG 2EIJC 2EIJB 3K04A 4RUFA 1KP3A 3OR7C 2WLLA 3SJQC 2HJFC 5GW7A 3K08A 1N8RW 2LP7A 1K5SA 3ABUA 3K0GA 5FL7G 5IDJA 3SPIA 3AG4C 3AG4B 3ZIAG 4RQFA 1VQ4V 2PI4A 1JQ0A 2XNDG 3LDCA 1S76D 3JD2A 5CMUA 1JVMA 3ZMTA 1AJPA 1P7BA 2EJRA 3CP1A 3QO7A 3W7TA 1Q82W 1Q86W 3KG2A 3RVYA 1DF4A 4JASA 5LGNA 3P30A 1R3JC 3ZRSA 3ZN0A 5EK0A 2YSUB 4QJFB 3JD0A 1E1RG 2WLIA 3G4SV 3OMIB 1NKDA 2P67A 4N21A 2JK5C 1YSCA 3FB5C 2A0LA 2WAMA 1ENVA 4MTGA 3ZJZA 5DM6V 4FMTA 3E86A 1L1FA 3CXCU 2IJIA 3FYEB 2Y69C 2Y69B 3ABLC 3ABLB 4JYBA 2R9IA 4GCZA 3SPJA 2W6IG 3CCQV 3OR6C 1FXKC 1FXKB 1EBOA 1KP2A 3M99B 2WLLB 4JAUA 1F23A 4LBEC 1OCRC 1OCRB 3R65A 1VQ9V 1BHBA 4MW8A 4TT3G 1TUEB 2IJKA 1YI2V 1G4YB 5H6RA 3I55V 3PJSK 1JCHA 1GK9A 1S72V 1KECA 2XASA 1DF5A 3ETDA 2HKOA 1R3IC 3JCZA 2QEXV 2FTKA 3CC7V 3VOUA 3ZMVA 4QNHB 2X6BA 2PI5A 1NR1A 3BEHA 3ASNC 3ASNB 2WLIB 1K4DC 4DXWA 3HPLC 4N23A 3TCUA 1Q7YW 4PA3A 4G28B 1CP9A 1P4RA 1CEZA 2BOCC 2XAJA 1UJWB 2H8PC 1GM8A 1VQ6V 3JYCA 4JAVA 2QKSA 4UXNA 1W2BU 3ABTA 3K9AA 3OEEG 3E89A 3K03A 2GSMB 4JGSA 1K3EA 4PA9A 4ASUG 1S3JA 2EBOA 4FJCC 1W0KG 3SYQA 4Z1MG 3E8HA 4UV9A 1FXVA 2HVJC 1M9NA 4E2LA 4WCEV 5EBMC 4MTOA 3DGEA 3CCVV 4JF3A 4WFHA 1F51A 1J95A 2ZD9A 1QR8A 3SPCA 2P7TC 3P32A 3RW0A 3SYOA 2XAQA 2JDIG 1YJWV 5B1BC 5B1BB 4J9ZB 5LHHA 4EKWA 3AG1C 3AG1B 2Q68A 3LSQA 4MW3A 4JYCA 4YXWG 1GKFA 2V1DA 5KUKA 4PDMA 1PNLA 4FIPC 1Y66A 1JJ2U 3ZRXA 3EFFK 1IXMA 3QO8A 2YEVB 1FXKA 2C2AA 1EZJA 4UUJC 1QLEC 1QLEB 4WF9V 5EC1C 2ZR3A 3WFVA 1QBZA 2H94A 4CBCA 4MTXA 5LGTA 1AI5A 1F4NA 4MT8A 2NNUA 3B8MA 2AHZA 2ZDIC 1Y4MA 4ZKIA 2QE7G 4RAIA 1GMGA 1YJNV 2HFEC 1JX9A 4HZ3A 1BMFG 1SETA 2DQ0A 2JEUA 3FKSG 2LFRA 3DTUB 4MVQA 4ZBMA 3W7WA 1Q81W 2JJ2G 2B5UA 1H2GA 4R8CA 1YTFB 4WFFA 2X6AA 3W7UA 1QVFU 5EBWC 3ABKC 3ABKB 5L3DA 4LCUC 1BHAA 1F4MA 1RM1B 2OT5A 3ZCCA 1RM1C 1NVPB 2WLHA 4MVZA 4KFMA 1OCCB 3D36A 1DTOA 1GTOA 2EINC 2EINB 4LP8A 3G6EV 2XAHA 3JD1A 1OCZC 1OCZB 2ZXWC 2ZXWB 3CCRV 3JD3A 2IU3A 1NJIW 1VQOV 2DYRC 2DYRB 1KQSU 4PA7A 2EIMC 2EIMB 3CCSV 5BZBA 4RO2A 2X0LA 3OW2U 3ASOC 3ASOB 2IJHA 5CA3A 1K4CC 1NBMG 2WWWA 4JTCB 3T2MA 3TK1A 4KUMA 1AROP 2ITCC 3LNMB 3GWOA 2K1EA 2XAFA 3MD0A 3OFNG 1AJNA 1CPYA 4KP4A 4RUEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JEU A;  1QQH A;  1R6N A;  2JEX A;  1R6K A;  1TUE B;  1DTO A;  2NNU A; 
#chains in the Genus database with same CATH topology
 5J9P C;  4I0X A;  1AI4 A;  4J10 A;  4DR7 B;  2Q67 A;  3FB8 C;  4I7Z B;  2IU0 A;  3OD4 A;  2OTJ V;  4C7U A;  2WPD G;  1H8E G;  4FZ0 A;  4GX1 A;  5KX5 B;  5EYP B;  3JD4 A;  4NR1 A;  1HW7 A;  4DV7 O;  5IYD O;  3BA8 A;  3NXS A;  4X9Q A;  5KHI A;  3CCE V;  3ZN1 A;  2OIE A;  3CXH F;  4NXN O;  5IY5 B;  1P7G A;  3CWB H;  2E75 B;  4DR6 B;  1SES A;  3OMA B;  5B1N A;  3OM3 B;  3ZRW B;  1ZL8 A;  3AEI A;  1N4C A;  1K5Q A;  3N2G A;  2RJZ A;  3G6B A;  1BE3 H;  2DE0 X;  3SPH A;  3ABM B;  1QQC A;  1K97 A;  4DK1 A;  3JAK B;  2IW5 A;  5LGU A;  2KG7 B;  2Y48 A;  3E8B A;  4LNU B;  5EZY B;  2UXD O;  1I7F A;  3RYH B;  1R3L C;  3AK3 A;  3UO2 A;  2QA4 V;  2W0F C;  1I5X A;  4DR2 B;  1K9M W;  5B66 Z;  1R73 A;  4X62 O;  3CCL V;  2QM7 A;  3BRC A;  3M8A A;  3W7S A;  1MSW D;  3OE7 G;  4AI8 A;  1YVW A;  2GUZ B;  4TUY A;  3STL C;  1HR0 O;  4CS3 A;  4P30 A;  1IZ3 A;  1NQT A;  1Y74 B;  5JQG A;  2CGN A;  3RYI A;  4MVM A;  5KHK A;  4LH6 A;  3ZX6 A;  4XDL A;  5LXT B;  5KLV H;  4CH5 A;  1L0N H;  4G27 B;  3T1C A;  3K0D A;  3W7X A;  2X7R B;  2ODM A;  4U3J A;  3WG7 C;  3JSL A;  1OCO B;  3T4Z A;  2F23 A;  4DV7 B;  3E8G A;  4QE7 A;  2CH7 B;  3D3Q A;  3TET A;  1IX9 A;  5CB4 B;  4BWA A;  2HVK C;  3KKY A;  4R50 A;  4NXN B;  5L3E A;  3UCS C;  2RNB A;  1SS3 A;  1TGO A;  2L35 A;  1SQB H;  1H38 A;  1YIT V;  2VWJ A;  3R66 A;  1NTK H;  5D5P A;  2FYU H;  2EZP A;  1T5E A;  5BMV B;  4PDR A;  4BIZ A;  4UFZ A;  5LA6 A;  2Q9L A;  1BCC H;  2UXD B;  2WA3 A;  2CK3 G;  4TV9 A;  2BTO A;  3H01 A;  1GM7 A;  2NR5 A;  3WB1 A;  5JVD B;  3K3W A;  3VBB A;  3B09 A;  1MNG A;  4R7C A;  1DGS A;  4DW1 A;  3CYO A;  4K0K O;  4BIO A;  1N0J A;  4X62 B;  4OPH A;  3DXR A;  1V55 C;  3Q4H B;  5J2T B;  2D2C B;  3JAW A;  1Q6I A;  3RYF B;  3CCJ V;  2E5L B;  1R6K A;  1YIJ V;  3ZMS A;  4CZZ A;  1VEW A;  2VWK A;  3U0Z A;  2CE4 A;  4L87 A;  1Y76 B;  3VQV A;  1HR0 B;  5B3S C;  2QDO A;  5IWA O;  1D5N A;  2JEX A;  5ITZ B;  5L3F A;  3GVM A;  4EB6 B;  4WFE A;  1EN4 A;  4DV5 O;  1PL4 A;  4DUZ B;  1E1Q G;  2F1M A;  4ZHQ B;  1IBM O;  1DK1 A;  2WSS G;  2CUG A;  1SRY A;  5JH7 A;  5HFM A;  4X1I A;  1K73 W;  1FJG B;  3TGU H;  1R3K C;  3G67 A;  3E2E A;  4YJ2 B;  5LL6 Y;  1GO3 F;  4DR3 O;  4X8A A;  4O2B B;  3CS5 A;  4D7T A;  4YHH B;  3HKD A;  1FFT B;  1QR9 A;  4GYC B;  2A9H A;  4X64 B;  3OGC C;  4GKK O;  1K34 A;  1L0L H;  1QQH A;  1UFI A;  2DQ3 A;  4CH3 A;  2RQ6 A;  4X66 B;  1WP8 A;  1AR5 A;  3L9D A;  2DYS B;  5CBH A;  4LWS A;  4GX5 A;  2OCC B;  1MMM A;  2EIJ C;  1I08 A;  2CTP A;  2WLL A;  3SJQ C;  1M4U A;  2ZE6 A;  2HJF C;  2Q0O C;  5FL7 G;  1WN7 A;  4U3F H;  2E3C A;  2PI4 A;  4LF5 O;  2XND G;  4H44 B;  5LMN O;  3K5N A;  2UUA O;  1S5L Z;  1Q86 W;  3SR2 C;  4UCO A;  3QG5 A;  3A2F A;  3G4S V;  4K8Z A;  4IIJ B;  2CAZ C;  1XUQ A;  3ZBH A;  1FYJ A;  2WAM A;  3JAR B;  4MTG A;  2JGD B;  4EFB A;  3ZJZ A;  4AQY O;  3I5D A;  4DV5 B;  2IJI A;  2ZM6 O;  1IBM B;  3FYE B;  1M93 A;  5JJJ B;  4DV1 O;  1N32 B;  2Y69 B;  1EN5 A;  1IXB A;  2R9I A;  2QWN B;  4B3M O;  3KCY A;  2EX3 A;  3CCQ V;  3BHP A;  3OR6 C;  1FXK B;  1EBO A;  1XBL A;  4JAU A;  1ZX3 A;  4LBE C;  5C8Y B;  2FKX A;  4MW8 A;  5LYJ B;  2Q4P A;  1YI2 V;  4GUN A;  1EN6 A;  4EFE A;  1GK9 A;  3JAS B;  2G38 A;  4GKK B;  3B40 A;  2QEX V;  3VOU A;  2PF4 E;  1VF6 A;  1SQQ H;  3ASN B;  4TQF A;  3ZHV A;  1IDS A;  3TCU A;  4B3T B;  1CP9 A;  1CEZ A;  1VQ6 V;  3H9V A;  4B3R O;  3OEE G;  4UCV A;  4PA9 A;  5KHG A;  4LF5 B;  5LMN B;  2UUA B;  4Z1M G;  2VQF O;  3TJT A;  3CCV V;  2GDS A;  3SPC A;  3VQY A;  2ZT9 B;  3JCU Z;  5B1B C;  4J9Z B;  5LHH A;  3LSQ A;  3AG1 B;  4YXW G;  2V1D A;  4LF9 O;  4PDM A;  2BSK A;  4FIP C;  2PTM A;  3ZHT A;  4DR4 O;  1JJ2 U;  3ZRX A;  1KKC A;  1R6T A;  3QO8 A;  2KKW A;  2YEV B;  1QLE C;  4WF9 V;  3OTF A;  4DV1 B;  4DV0 B;  5LGT A;  4X1K A;  1AI5 A;  2NNU A;  2V4D A;  1FAF A;  2ZDI C;  1Y4M A;  2QE7 G;  2B9Z A;  3RFR A;  1YJN V;  1JX9 A;  2DJV A;  1SET A;  2DQ0 A;  2JEU A;  3FKS G;  2ARH A;  3DTU B;  1H2G A;  3K57 A;  4B7K A;  1QVF U;  5KHJ A;  3ABK B;  4LCU C;  1BHA A;  1F4M A;  4O4I B;  3B2E E;  3BVO A;  1NVP B;  4YIP A;  1URF A;  2JGU A;  4KFM A;  1VF7 A;  1OCC B;  3D36 A;  2AZ2 A;  1NTM H;  5A2Q N;  4JI7 O;  3ZHU A;  2XAH A;  1KYO F;  3CCR V;  1NJI W;  4W4L A;  2DYR C;  1KQS U;  4X1Y B;  4PA7 A;  5BXZ A;  1QNM A;  1XOU A;  4DRX A;  1NZ6 A;  3T2M A;  3TK1 A;  3M7M X;  2YXY A;  2YI8 A;  5IJ9 B;  3LNM B;  2XAF A;  3BPZ A;  5EZY A;  4QE9 A;  2LGQ A;  1YHQ V;  2IH3 C;  4YIO A;  3X2Q B;  2FB5 A;  3MHS C;  3IGA C;  5DN6 G;  2VQF B;  2LQT A;  3AG3 B;  3ETQ A;  2ZE5 A;  1K33 A;  1QLN A;  4GZR B;  2AGA A;  1V54 B;  1SER A;  3OMN B;  2YDE A;  1U96 A;  1VQP V;  4LF9 B;  4TQD A;  1M56 B;  5H2F Z;  2GUZ A;  4DR4 B;  1NH2 B;  1K92 A;  1I94 B;  4ICG A;  3LDD A;  5IY5 C;  3NR7 A;  5JCO C;  4H13 B;  3U11 A;  3ABM C;  3B77 A;  1SZX A;  2NLJ C;  1I0H A;  4FLU A;  4LFA B;  3CME V;  1KD1 W;  4JI5 B;  3ZHS A;  4MVU A;  2YXH A;  2ZIO A;  4I9W A;  2CH7 A;  4DUY O;  5K1P A;  1AB3 A;  4UVB A;  5CB4 A;  4I4T B;  2N04 A;  1XNR O;  5KMG B;  1QCE A;  4FPP A;  3SDL A;  1VQ7 V;  1D2D A;  3DC5 A;  1VAR A;  3RVZ A;  2QM4 A;  3EVK A;  2V7Q G;  4Z2W A;  2WLM A;  5D5Q A;  2XAG A;  5J2U A;  2M6Y A;  4NTY A;  4UB8 Z;  3E22 B;  2WLJ A;  1FKA O;  2WLK A;  1WA8 B;  1OHH G;  5IYB O;  1WB8 A;  2ZIM A;  4CS2 A;  5L3B A;  2Q73 A;  1VQL V;  1VQ8 V;  1W59 A;  2DWD C;  3LNN A;  3HB3 B;  3Q4H A;  2YIB A;  3ZMU A;  3APO A;  3RYF A;  1OCO C;  4J7Z A;  2ZNJ A;  3P3N A;  4LC1 A;  5FPO A;  5CA0 B;  4JAA A;  4LF4 O;  1Y76 A;  5JWP A;  3UKM A;  3N2K A;  3UM7 A;  5BR8 O;  2MK3 A;  1MA1 A;  2HP8 A;  5KA6 A;  3WB2 A;  1S5H C;  3E8F A;  3SPG A;  2CTQ A;  3H1I H;  1TA8 A;  5AG2 A;  1TVK B;  1UPG A;  5KA5 A;  1JPX A;  4O4L A;  1N34 O;  3LSS A;  2ZR2 A;  4JTD B;  4QGP A;  3ZHQ A;  4I5S A;  3CMA V;  1BL8 A;  1NT2 B;  1PL0 A;  5B5E Z;  3FYI B;  4O2B A;  4NKG B;  4L8J A;  1PP9 H;  1YCI A;  4F6E A;  1XNR B;  4GX0 A;  2HR3 A;  3L75 H;  1N0N A;  4JI0 O;  2LFS A;  2P90 A;  2KB1 A;  5LHI A;  2Z3Y A;  3K9S A;  3ML0 A;  1PKX A;  1WPX A;  1M57 B;  5E1A C;  3E83 A;  4P9O A;  2F4V B;  3C90 A;  2QGN A;  1VQ5 V;  1SF9 A;  4ZOL B;  2YIB D;  4OX9 O;  5GTH Z;  1FD9 A;  3F5W C;  4X65 O;  2UU9 O;  3LUT B;  2UXB O;  5A9G A;  1HNX O;  2UUB B;  1R6N A;  3AK2 A;  4NB5 A;  1PV0 A;  1YF2 A;  4O4H A;  1RSO B;  4K3A A;  2AW9 A;  1JFF A;  1WNS A;  4XBF A;  4ZIB A;  1MZF A;  2Q7H A;  4JI8 B;  5CN0 A;  1LR1 A;  1RP3 B;  3AG2 B;  5BR8 B;  4FLZ A;  4FLT A;  3H1J H;  4LF7 O;  2JRI A;  4MVS A;  2JGD A;  2UXX A;  5L3C A;  5CA1 A;  5CBG A;  1KMI Z;  4F6R B;  4J11 A;  3D3I A;  5H5N A;  2DYS C;  3JAT A;  2Y0I A;  5IJ0 B;  2OCC C;  1SZT A;  4PDL A;  1QVG U;  2HG5 C;  1AI7 A;  1N34 B;  4PDV A;  1COW G;  1KP3 A;  4HBN A;  1N8R W;  1SQG A;  5LOV B;  1HNW O;  3JSN A;  3ABU A;  4CH4 A;  5IDJ A;  2WA4 A;  3QTC A;  2N05 A;  1JQ0 A;  4I55 B;  3JD2 A;  4DV2 O;  4UCS A;  1AJP A;  3QO7 A;  1M5I A;  3T1H O;  4JI0 B;  3RYC B;  5IYZ B;  2LJ2 A;  2OIG A;  4JAS A;  5LGN A;  4NYK A;  3ZN0 A;  4QJF B;  3JD0 A;  3OMI B;  1SKV A;  1NKD A;  2P67 A;  3BA9 A;  3FB5 C;  2JS5 A;  4YJ3 A;  4OX9 B;  2ILM A;  3SJB C;  5DM6 V;  4DV6 O;  3E86 A;  1H2M A;  2ADQ B;  4X65 B;  1HNX B;  2Y69 C;  3RGB A;  3ABL B;  3UQ8 A;  4O4J A;  1B3Q A;  3SPJ A;  1FXK C;  1KP2 A;  1F23 A;  1OCR B;  3R65 A;  2Y4T A;  1VQ9 V;  4TT3 G;  1JJO A;  4FZ1 A;  1VP7 A;  1TUE B;  3B4S A;  1G4Y B;  5H6R A;  4JZG A;  1JCH A;  1S72 V;  4LF7 B;  3JAL B;  2XAS A;  4I50 B;  3HKC A;  2HKO A;  1R3I C;  1SQX H;  1WJZ A;  3BEH A;  3ASN C;  2WLI B;  1K4D C;  3HPL C;  4KXR A;  4N23 A;  1QHT A;  3K5L A;  4G28 B;  1QU7 A;  3KCX A;  5FPR A;  4IHJ B;  2BOC C;  1GH6 A;  4LF6 O;  1UJW B;  3JYC A;  4JAV A;  2QKS A;  4UXN A;  5LP6 A;  3FAV A;  1HNW B;  3IC9 A;  4WBN B;  4J80 A;  4DV4 O;  3E89 A;  2GSM B;  3WB0 A;  2RCV A;  1S3J A;  4NTW A;  2PYL A;  4O4I A;  4DV2 B;  3SYQ A;  3H1K H;  3E8H A;  4E2L A;  3APQ A;  3DGE A;  4JF3 A;  4I0X B;  4JYA O;  2ZD9 A;  3HKB A;  1YEW A;  2XAQ A;  4PI2 A;  2JDI G;  1H2N A;  4X1Y A;  2ETN A;  3AG1 C;  4JYC A;  1GKF A;  2MW2 B;  1D5A A;  1XQ8 A;  1SQP H;  4DV6 B;  1IXM A;  1EZJ A;  4UUJ C;  4FM0 A;  1BQ0 A;  4HNA A;  1QBZ A;  2H94 A;  4MTX A;  5TIS Z;  1P84 F;  3B8M A;  4AHC A;  1J5E O;  2EJ7 A;  4K0K B;  1ZL8 B;  1BMF G;  5LMU O;  5LP6 C;  3OGI B;  4MVQ A;  3H1H H;  2JJ2 G;  2B5U A;  4R8C A;  1Q81 W;  5EBW C;  3ABK C;  1XEQ A;  1SQF A;  1SQV H;  3G6E V;  2EIN B;  2BE3 A;  1OCZ B;  5IWA B;  2ZXW B;  4IYH A;  2ADP A;  3ZHR A;  3BAB A;  4FLX A;  4J7K A;  3BFR A;  3OW2 U;  1N36 O;  4Z1V A;  1BZK A;  2GTS A;  4LF6 B;  1ARO P;  3MD0 A;  1AJN A;  4RUE A;  4DV4 B;  1TUB B;  4DR3 B;  3X2Q C;  4TUY B;  5B1A B;  2LGW A;  1WAZ A;  5JQG B;  3RYI B;  3AG3 C;  2P22 C;  4FFB A;  5KMG A;  1NI8 A;  4JYA B;  2P4K A;  2HLD G;  4HYO A;  1V54 C;  4GT1 A;  2Z5U A;  4BR6 A;  2IM9 A;  1M56 C;  1KKD A;  3ETE A;  1FXH A;  2R72 A;  2JJ1 G;  4U3J B;  2AZ0 A;  1ZUQ A;  4JI4 O;  2ZDI A;  4BIU A;  1HP8 A;  2XT9 A;  4I9Q A;  4F4L A;  4Q20 A;  4X20 A;  1VQK V;  3CJH A;  2RMK B;  1BT8 A;  2K9P A;  4LH7 A;  3L73 H;  1PNK A;  4OGQ B;  1VQN V;  4TSF G;  3ZRV A;  4DR5 O;  4IGG A;  3A8T A;  2CDY A;  5EIB C;  4JTA B;  1SA0 B;  2DN9 A;  4LFC O;  3OUF A;  4QIW F;  3RWR D;  4DV3 O;  3UT5 A;  2A79 B;  5LA6 B;  1H8H G;  2DOS A;  5GON A;  3QNE A;  4TV9 B;  4O2A A;  1K7D A;  4J7J A;  3F5T A;  2GHY A;  1B6Q A;  4FK5 C;  4AQY B;  1HWY A;  5EIB D;  3FD9 A;  1ROP A;  2UUC O;  2IH1 C;  2R9R B;  2ZM6 B;  4JI6 O;  2WLN A;  1N36 B;  5H6Q A;  4DYL A;  3DXR B;  4B3M B;  3QF7 A;  3JAW B;  1XL6 A;  4BW5 A;  4JYY A;  1PD3 A;  5KX5 A;  5EYP A;  4UVA A;  1US6 A;  4QPJ A;  5FLX N;  3SJA C;  4RQE A;  2BOB C;  4UCT A;  1YJ9 V;  5JCO A;  1L8D A;  4FLW A;  2PY5 A;  3DC6 A;  3ZRW A;  1YTF D;  2B1G A;  4GKJ O;  3T4D A;  2ATK C;  1AJQ A;  3JAK A;  2KG7 A;  2EIK B;  1AR1 B;  2ITD C;  1G8M A;  4H33 A;  2H3O A;  3CD6 V;  1Q6H A;  4LNU A;  4B3R B;  3RYH A;  3HKD B;  3CPW U;  1XI1 A;  2L6L A;  1GN2 A;  2DMX A;  2JVD A;  2A3Q A;  4UV8 A;  4ABM A;  4NTX A;  4P2Z A;  4W4K A;  1S77 D;  4XDK A;  5EBL C;  3A0R A;  1RSO A;  3K06 A;  2UXN A;  4LWS B;  3MHH C;  4DW0 A;  1Q3E A;  4DR1 O;  2LW7 A;  2GV9 A;  4DV3 B;  2Q8V A;  1O9H A;  3CSX A;  3ETG A;  1XMQ O;  3L72 H;  2KSD A;  1W0J G;  4D7S A;  3CHX A;  3SYC A;  2R9A A;  2IBZ H;  4H0L B;  5HFL A;  1Y74 A;  3FB7 C;  4F6R A;  2OWO A;  4J9Y B;  2UUC B;  2EIL B;  1OZ0 A;  1WLE A;  5IJ0 A;  1FFX B;  1M57 C;  4IL6 Z;  5LXT A;  5KUM A;  1LUW A;  2R70 A;  3KZI Z;  5B1O A;  4FM1 A;  3CC2 V;  2UXC O;  3SYP A;  1Q5O A;  2AXT Z;  2ZCE A;  4JI1 O;  3ZED A;  1M1K W;  2ZNI A;  1RPR A;  1I5Y A;  4I55 A;  1MOF A;  1NR7 A;  5LBQ A;  4G2K A;  1U97 A;  1IBK O;  1N33 O;  3RYC A;  2D3O W;  4JPR A;  1K8A W;  4JI7 B;  4UCR A;  3LDE A;  1YDX A;  2DW4 A;  4PD4 F;  3IFX A;  4GKJ B;  4UCU A;  5CBF A;  3AG2 C;  5IE9 A;  3RT3 C;  3OT7 A;  1DLB A;  1Y67 A;  2QTO A;  2XOK G;  1Q6U A;  1Z2G A;  4U7O A;  5BMV A;  4K8X A;  1ZWI C;  3K79 A;  3L71 H;  4WFA V;  4MS2 A;  3TXS A;  2Q6A A;  5JVD A;  4WFB V;  2AHY A;  3K04 A;  4RUF A;  2HHH O;  2QWO B;  3OR7 C;  1MZE A;  3K08 A;  1AIL A;  2LP7 A;  5J2T A;  3K0G A;  3RN4 A;  4DR1 B;  4ZI7 B;  3AG4 B;  3ZIA G;  4RQF A;  1Z5W A;  2Q0A A;  1VQ4 V;  3LDC A;  1XMQ B;  5CMU A;  1S76 D;  3ZMT A;  1P7B A;  2N74 A;  2EJR A;  3W7T A;  3JAL A;  1YZB A;  3KG2 A;  1DF4 A;  3IJ4 A;  3P30 A;  1XHX A;  5ITZ A;  2WLI A;  5JJE B;  4EB6 A;  1VMG A;  1P49 A;  2JK5 C;  3H1L H;  4ZHQ A;  2CTR A;  2OCH A;  2QWR B;  2UXC B;  1ENV A;  2OYQ A;  4JI1 B;  2F95 B;  1L1F A;  3CXC U;  1GN3 A;  1OJH A;  4YJ2 A;  2BSK B;  3ABL C;  3AK1 A;  4JYB A;  3SJC C;  4DUY B;  1IBK B;  3CE2 A;  2LO1 A;  2LW1 A;  1Z5V A;  3M99 B;  4A5U B;  1OCR C;  4X1K B;  1BHB A;  3MAQ A;  4JI2 O;  2Q7G A;  4NXM O;  3I55 V;  3PJS K;  2A06 H;  1AP5 A;  2VQE O;  1KEC A;  1DF5 A;  3ETD A;  3JCZ A;  1RFY A;  2FTK A;  3ZMV A;  4QNH B;  1NR1 A;  4DXW A;  2W0X A;  2EUL A;  2PGG A;  1JA8 A;  1BS3 A;  1P4R A;  1KB9 F;  2HHH B;  1W2B U;  3K9A A;  4DRX B;  1K3E A;  4ASU G;  2EBO A;  4FJC C;  4CS4 A;  1H2K A;  4IYI A;  4IIJ A;  4LF4 B;  1M9N A;  4WCE V;  3O9O A;  3OTO O;  3O65 A;  4WFH A;  1QR8 A;  3JAR A;  1XRE A;  3SYO A;  4MW3 A;  1EZV H;  1PNL A;  3A0B Z;  1KUQ A;  2E5L O;  3EFF K;  1TAE A;  1FXK A;  1XNQ O;  1TUB A;  3WFV A;  4CBC A;  5C8Y A;  2AHZ A;  5LYJ A;  5KAI Z;  2XHB A;  1R1B A;  4RAI A;  3PN1 A;  2HFE C;  2XUM A;  2FL4 A;  3HKE B;  4UB6 Z;  3JAS A;  2LFR A;  4DUZ O;  2RDC A;  4JI2 B;  3W7U A;  3L70 H;  1AVM A;  1RM1 B;  3S3W A;  3ZCC A;  4NXM B;  2WLH A;  1FJG O;  1AP6 A;  4LF8 O;  2VQE B;  2EIN C;  1A32 A;  4LP8 A;  2VS0 A;  1FPO A;  1OCZ C;  2ZXW C;  3JD3 A;  2QJ1 A;  2EIM B;  5BZB A;  4YHH O;  2X0L A;  3ASO B;  2IJH A;  3L74 H;  2UU9 B;  2UXB B;  1K4C C;  1NBM G;  2WWW A;  4X64 O;  3CB2 A;  2ITC C;  3GWO A;  2K1E A;  4X66 O;  1G1X B;  2PYJ A;  2Z0A A;  4X88 A;  2M7W A;  2P4V A;  2YIC A;  1SA0 A;  3CEI A;  5J2U B;  2ZQM A;  5B1A C;  3QVN A;  1GN6 A;  4B3S O;  1E79 G;  4TV8 B;  2F93 B;  1FS0 G;  2ZE8 A;  5EC2 C;  3OTO B;  1RPO A;  3U10 A;  1KBH A;  5L3G A;  4MVR A;  2X6C A;  4XDJ A;  1F7Y A;  1AI6 A;  2QM8 A;  3CRC A;  2YEV A;  2P06 A;  4QPK A;  2Y0P A;  3CRM A;  5K1X A;  1SC5 B;  2BTQ B;  4P9P A;  2YC0 A;  4FLV A;  1XNQ B;  1ZTE A;  2EZO A;  2B1I A;  3BY6 A;  1GM9 A;  3N2K B;  5FNV B;  1PPJ H;  4R6Z A;  1BGY H;  4RWU A;  3CCM V;  4TWK A;  4E4E A;  3T1H B;  3J81 N;  1S0V A;  1N32 O;  5LHG A;  4MTF A;  5JJN B;  3THO A;  1OV9 A;  1GRJ A;  4GX2 A;  4O4L B;  3AG7 A;  3OUS A;  4LF8 B;  4DO2 A;  2F43 G;  5IYC O;  2A7W A;  4KHP O;  3CCU V;  5IJ9 A;  5BY1 A;  1S5J A;  2VRZ A;  3QO5 A;  2IJJ A;  1MSD A;  4CC6 A;  2PZS A;  3OAA G;  2DWE C;  2P5O A;  4PA6 A;  4YY3 O;  5GTI Z;  4EEQ A;  3EXA A;  3J7A U;  2PUS A;  3N2G B;  5C93 A;  4B3T O;  2RN9 A;  1YXB A;  3FB6 C;  1MG1 A;  3B8N A;  4B3S B;  2HEP A;  2P6J A;  3JAM N;  1Q8I A;  4PEL A;  4D6T H;  4H37 A;  3WG7 B;  2Q69 A;  1OCC C;  1XL4 A;  3F7V C;  4J42 A;  4CH6 A;  1EFR G;  3K58 A;  3STZ C;  4UVC A;  1FFX A;  5F2V O;  1G6U A;  2JS3 A;  4O4H B;  3K5M A;  2EIK C;  3K59 A;  1WP7 A;  1NVP D;  1ORQ C;  1JFF B;  3GB7 C;  4MVO A;  3J80 N;  3C3S A;  3T1Y O;  4OXS A;  1LUV A;  4U7N A;  2BCC H;  5CA1 B;  3GWK C;  1WPB A;  4PA4 A;  3P3P A;  3WU2 Z;  3F7Y C;  3CC4 V;  3D8C A;  4I4T A;  1HNZ O;  4DV0 O;  3JAT B;  3UO3 A;  4GLX A;  1ZLZ A;  1JOY A;  4J41 A;  4WFG A;  4FFK A;  4OPA A;  4MSW C;  4KHP B;  5DEC A;  3K5O A;  1NU1 H;  1V55 B;  3E35 A;  3OEH G;  4X89 A;  2QWQ B;  3E22 A;  1THZ A;  1VF5 B;  2EIL C;  3ZMZ A;  1NTZ H;  1M90 W;  1WA8 A;  3RBZ A;  1PNM A;  4YY3 B;  5B3S B;  3EHB B;  1H2S B;  2Y4U A;  1NH2 D;  1J5E B;  3I56 V;  5LMU B;  1BQZ A;  1LNQ A;  4BAY A;  1B04 A;  4ZI7 A;  3TXQ A;  2JIZ G;  4YJ3 B;  5CA0 A;  3G80 A;  4FLY A;  1MAB G;  1B06 A;  1BSM A;  3G71 V;  2OTL V;  2W6J G;  3VQW A;  1X4T A;  2Q7E A;  4PI0 A;  4O4J B;  3HR0 A;  2ZKO A;  2E76 B;  4K35 A;  3SYA A;  4PV1 B;  1TVK A;  3BAA A;  3T1Y B;  3IC7 A;  1VQM V;  1CXZ B;  2F66 C;  3SGI A;  1VIB A;  1I94 O;  5H9C A;  3CRA A;  3HKC B;  4HAM A;  1KC8 W;  2QKC A;  2EIJ B;  1GN4 A;  1VF6 C;  4DK0 A;  1HNZ B;  5GW7 A;  4TOI A;  1K5S A;  5KAF Z;  3SPI A;  4LFB O;  3AG4 C;  1XDC A;  1HDJ A;  3IAY A;  1NS1 A;  1JVM A;  3CRR A;  5JH7 B;  4LFA O;  3CP1 A;  3S3X A;  2KQX A;  4FM2 A;  5LP6 B;  3FAV B;  1Q82 W;  4X1I B;  4JI5 O;  1XHZ A;  3RVY A;  4JI4 B;  1IBL O;  1R3J C;  3ZRS A;  4ZOL A;  5EK0 A;  1EM1 A;  2YSU B;  2YS8 A;  1E1R G;  2NN4 A;  2YXL A;  4N21 A;  4NVP A;  1YSC A;  1ZSP A;  2A0L A;  3HKB B;  1AR4 A;  2ZE7 A;  4JV5 O;  4FMT A;  2CTW A;  1Y6X A;  3ICX A;  4DR5 B;  1IUR A;  5IT9 N;  4CC5 A;  4LFC B;  4PHZ A;  1PM9 A;  4GCZ A;  2W6I G;  2O57 A;  3FFQ A;  3DSQ A;  2WLL B;  4B7E A;  4HNA B;  2QTS A;  1JMK C;  4FVM A;  2YID A;  2YIA A;  2IJK A;  4JI3 O;  1ZAU A;  1XIL A;  4JI6 B;  3CX5 F;  2E74 B;  2XTA A;  5E79 Z;  1XMO O;  3CC7 V;  2PI5 A;  2X6B A;  5LOV A;  3C3T A;  3N27 A;  1Q7Y W;  4PA3 A;  3D36 C;  1GAX A;  4PJ0 Z;  4AIL C;  2XAJ A;  2H8P C;  1GM8 A;  3HKE A;  3MDS A;  3ABT A;  5IYZ A;  2FML A;  3K03 A;  2QSA A;  4JGS A;  4LFB B;  2GBO A;  4DR7 O;  1H2L A;  1V9P A;  1W0K G;  2QWP B;  4UV9 A;  1FXV A;  2YI9 A;  2HVJ C;  2HJD A;  5EBM C;  3A0H Z;  4MTO A;  3BCC H;  1Q43 A;  1IBL B;  1F51 A;  1J95 A;  2GTA A;  2YUA A;  2P7T C;  3FX7 A;  3P32 A;  3RW0 A;  1YJW V;  5B1B B;  2QR4 A;  4EKW A;  2Q68 A;  5KUK A;  1JR9 A;  3LSU A;  4FFB B;  3ZS8 C;  1X59 A;  1Y66 A;  4JV5 B;  4DR6 O;  2C2A A;  1WB7 A;  1QLE B;  5EC1 C;  2ZR3 A;  4KL1 A;  1F4N A;  4MT8 A;  4Q6G A;  3CRQ A;  2F4V O;  4TV8 A;  4ZKI A;  1GMG A;  4HZ3 A;  3VQX A;  4X20 B;  4ZBM A;  4I50 A;  3W7W A;  1YTF B;  3CJH B;  2X6A A;  4WFF A;  4BW9 A;  2UUB O;  5L3D A;  1IVS A;  4JI3 B;  1RM1 C;  1O9G A;  2OT5 A;  2ZIN A;  1Q90 D;  4LR3 A;  4MVZ A;  4DR2 O;  1XMO B;  2BTQ A;  1DTO A;  1GTO A;  4B08 A;  2CGO A;  4IHJ A;  3JD1 A;  4JZ2 A;  2IU3 A;  1VQO V;  2Q5Z A;  2DYR B;  3UT5 B;  2EIM C;  3CCS V;  4WBN A;  4JI8 O;  4RO2 A;  3ASO C;  2QKA A;  5FNV A;  5CA3 A;  5GON B;  4JTC B;  5KHH A;  5DED A;  4O2A B;  4KUM A;  1KU9 A;  3OFN G;  4KP4 A;  1CPY A;  4IT5 A;  1N33 B; 
#chains in the Genus database with same CATH homology
 5J9P C;  4QE9 A;  4X88 A;  2M7W A;  1AI4 A;  2IH3 C;  1YHQ V;  3X2Q C;  3X2Q B;  2ZQM A;  5B1A C;  2Q67 A;  5B1A B;  3FB8 C;  3MHS C;  3IGA C;  1E79 G;  5DN6 G;  3AG3 C;  3AG3 B;  2IU0 A;  1FS0 G;  5EC2 C;  2OTJ V;  1K33 A;  1RPO A;  2WPD G;  1H8E G;  1QLN A;  4GX1 A;  5L3G A;  2HLD G;  4HYO A;  1V54 C;  1V54 B;  1SER A;  3JD4 A;  4MVR A;  2X6C A;  3OMN B;  4XDJ A;  1AI6 A;  4GT1 A;  2QM8 A;  2YEV A;  2Z5U A;  1VQP V;  1M56 C;  1M56 B;  5IYD O;  4QPK A;  1KKD A;  3ETE A;  3NXS A;  1FXH A;  3CCE V;  2JJ1 G;  3ZN1 A;  1NH2 B;  1K92 A;  3LDD A;  5IY5 C;  5IY5 B;  2ZDI A;  4BIU A;  4P9P A;  1SES A;  3OMA B;  5B1N A;  3OM3 B;  3ZRW B;  4F4L A;  3AEI A;  4Q20 A;  1K5Q A;  2EZO A;  1VQK V;  2B1I A;  3BY6 A;  3SPH A;  3ABM C;  1GM9 A;  3ABM B;  3B77 A;  1K97 A;  2NLJ C;  2IW5 A;  5LGU A;  2Y48 A;  1PNK A;  4R6Z A;  1VQN V;  3E8B A;  4TSF G;  3CCM V;  4TWK A;  3CME V;  1KD1 W;  3ZRV A;  1R3L C;  4MVU A;  1S0V A;  5LHG A;  4I9W A;  4MTF A;  4JTA B;  2QA4 V;  3OUF A;  4QIW F;  4GX2 A;  2W0F C;  1I5X A;  4UVB A;  3OUS A;  2A79 B;  4DO2 A;  1H8H G;  2F43 G;  1K9M W;  1QCE A;  5IYC O;  1R73 A;  3QNE A;  3CCU V;  3CCL V;  2QM7 A;  4FPP A;  1K7D A;  3W7S A;  1VQ7 V;  2GHY A;  1MSW D;  1B6Q A;  3OE7 G;  4FK5 C;  3RVZ A;  1HWY A;  3QO5 A;  1ROP A;  2IJJ A;  2IH1 C;  2R9R B;  3OAA G;  2V7Q G;  2WLN A;  2DWE C;  5H6Q A;  2WLM A;  2XAG A;  3STL C;  4PA6 A;  4P30 A;  1NQT A;  1XL6 A;  4MVM A;  4BW5 A;  2WLJ A;  2WLK A;  1PD3 A;  5C93 A;  1OHH G;  4XDL A;  3FB6 C;  5IYB O;  5L3B A;  4UVA A;  1MG1 A;  3B8N A;  1VQL V;  1VQ8 V;  2P6J A;  4QPJ A;  2DWD C;  4RQE A;  4G27 B;  3T1C A;  3K0D A;  4PEL A;  2BOB C;  3HB3 B;  3W7X A;  4H37 A;  2X7R B;  3WG7 C;  3WG7 B;  2Q69 A;  3ZMU A;  1YJ9 V;  1OCC C;  1OCO C;  1OCO B;  1XL4 A;  3T4Z A;  3F7V C;  3E8G A;  4QE7 A;  4LC1 A;  1EFR G;  3ZRW A;  3TET A;  1YTF D;  2B1G A;  3STZ C;  4UVC A;  2HVK C;  4R50 A;  3UKM A;  5L3E A;  3T4D A;  2ATK C;  1AJQ A;  2MK3 A;  3UM7 A;  2EIK C;  2EIK B;  1NVP D;  1AR1 B;  5KA6 A;  2ITD C;  1ORQ C;  1S5H C;  1G8M A;  3GB7 C;  4H33 A;  4MVO A;  3CD6 V;  4OXS A;  1H38 A;  3E8F A;  1YIT V;  3SPG A;  3CPW U;  4U7N A;  4UV8 A;  5KA5 A;  4P2Z A;  2EZP A;  1JPX A;  4PA4 A;  4PDR A;  3LSS A;  2ZR2 A;  1S77 D;  3F7Y C;  4JTD B;  4BIZ A;  3CC4 V;  4XDK A;  5EBL C;  4I5S A;  3CMA V;  2CK3 G;  1BL8 A;  3A0R A;  3K06 A;  2UXN A;  1PL0 A;  3H01 A;  3MHH C;  1GM7 A;  3FYI B;  1JOY A;  3K3W A;  3VBB A;  3ETG A;  4R7C A;  3CYO A;  1W0J G;  4WFG A;  4GX0 A;  2HR3 A;  4MSW C;  3SYC A;  1V55 C;  1V55 B;  2LFS A;  2P90 A;  5HFL A;  3E35 A;  2KB1 A;  3OEH G;  3FB7 C;  5LHI A;  4X89 A;  3CCJ V;  2Z3Y A;  3ML0 A;  1R6K A;  1YIJ V;  4J9Y B;  3ZMS A;  1THZ A;  2EIL C;  2EIL B;  1OZ0 A;  4CZZ A;  3ZMZ A;  1WLE A;  1M90 W;  1PKX A;  1WPX A;  4L87 A;  1M57 C;  1M57 B;  3RBZ A;  1PNM A;  5E1A C;  5KUM A;  3E83 A;  4P9O A;  5B1O A;  5B3S C;  5B3S B;  1VQ5 V;  3EHB B;  3CC2 V;  3SYP A;  2JEX A;  5L3F A;  1NH2 D;  3I56 V;  4WFE A;  1M1K W;  1LNQ A;  3F5W C;  1E1Q G;  4BAY A;  3LUT B;  1RPR A;  1I5Y A;  2JIZ G;  1MOF A;  2WSS G;  1SRY A;  1NR7 A;  5HFM A;  5LBQ A;  1R6N A;  4G2K A;  1MAB G;  1K73 W;  3E2E A;  2D3O W;  1R3K C;  3G71 V;  4JPR A;  1K8A W;  2OTL V;  2W6J G;  1GO3 F;  4X8A A;  3LDE A;  2DW4 A;  4XBF A;  3IFX A;  5CN0 A;  1FFT B;  1QR9 A;  3AG2 B;  3AG2 C;  5CBF A;  2A9H A;  3SYA A;  1DLB A;  3OGC C;  4MVS A;  1K34 A;  2QTO A;  2XOK G;  2UXX A;  5L3C A;  1QQH A;  4U7O A;  2DQ3 A;  5CBG A;  3IC7 A;  1VQM V;  1ZWI C;  3D3I A;  3K79 A;  2DYS C;  2DYS B;  4WFA V;  5CBH A;  4MS2 A;  4GX5 A;  5H9C A;  2OCC C;  2OCC B;  1SZT A;  4PDL A;  4HAM A;  1QVG U;  2HG5 C;  1AI7 A;  2Q6A A;  4WFB V;  4PDV A;  2AHY A;  1KC8 W;  1COW G;  2EIJ C;  2EIJ B;  3K04 A;  4RUF A;  1KP3 A;  3OR7 C;  2WLL A;  3SJQ C;  2HJF C;  5GW7 A;  3K08 A;  1N8R W;  2LP7 A;  1K5S A;  3ABU A;  3K0G A;  5FL7 G;  5IDJ A;  3SPI A;  3AG4 C;  3AG4 B;  3ZIA G;  4RQF A;  1VQ4 V;  2PI4 A;  1JQ0 A;  2XND G;  3LDC A;  1S76 D;  3JD2 A;  5CMU A;  1JVM A;  3ZMT A;  1AJP A;  1P7B A;  2EJR A;  3CP1 A;  3QO7 A;  3W7T A;  1Q82 W;  1Q86 W;  3KG2 A;  3RVY A;  1DF4 A;  4JAS A;  5LGN A;  3P30 A;  1R3J C;  3ZRS A;  3ZN0 A;  5EK0 A;  2YSU B;  4QJF B;  3JD0 A;  1E1R G;  2WLI A;  3G4S V;  3OMI B;  1NKD A;  2P67 A;  4N21 A;  2JK5 C;  1YSC A;  3FB5 C;  2A0L A;  2WAM A;  1ENV A;  4MTG A;  3ZJZ A;  5DM6 V;  4FMT A;  3E86 A;  1L1F A;  3CXC U;  2IJI A;  3FYE B;  2Y69 C;  2Y69 B;  3ABL C;  3ABL B;  4JYB A;  2R9I A;  4GCZ A;  3SPJ A;  2W6I G;  3CCQ V;  3OR6 C;  1FXK C;  1FXK B;  1EBO A;  1KP2 A;  3M99 B;  2WLL B;  4JAU A;  1F23 A;  4LBE C;  1OCR C;  1OCR B;  3R65 A;  1VQ9 V;  1BHB A;  4MW8 A;  4TT3 G;  1TUE B;  2IJK A;  1YI2 V;  1G4Y B;  5H6R A;  3I55 V;  3PJS K;  1JCH A;  1GK9 A;  1S72 V;  1KEC A;  2XAS A;  1DF5 A;  3ETD A;  2HKO A;  1R3I C;  3JCZ A;  2QEX V;  2FTK A;  3CC7 V;  3VOU A;  3ZMV A;  4QNH B;  2X6B A;  2PI5 A;  1NR1 A;  3BEH A;  3ASN C;  3ASN B;  2WLI B;  1K4D C;  4DXW A;  3HPL C;  4N23 A;  3TCU A;  1Q7Y W;  4PA3 A;  4G28 B;  1CP9 A;  1P4R A;  1CEZ A;  2BOC C;  2XAJ A;  1UJW B;  2H8P C;  1GM8 A;  1VQ6 V;  3JYC A;  4JAV A;  2QKS A;  4UXN A;  1W2B U;  3ABT A;  3K9A A;  3OEE G;  3E89 A;  3K03 A;  2GSM B;  4JGS A;  1K3E A;  4PA9 A;  4ASU G;  1S3J A;  2EBO A;  4FJC C;  1W0K G;  3SYQ A;  4Z1M G;  3E8H A;  4UV9 A;  1FXV A;  2HVJ C;  1M9N A;  4E2L A;  4WCE V;  5EBM C;  4MTO A;  3DGE A;  3CCV V;  4JF3 A;  4WFH A;  1F51 A;  1J95 A;  2ZD9 A;  1QR8 A;  3SPC A;  2P7T C;  3P32 A;  3RW0 A;  3SYO A;  2XAQ A;  2JDI G;  1YJW V;  5B1B C;  5B1B B;  4J9Z B;  5LHH A;  4EKW A;  3AG1 C;  3AG1 B;  2Q68 A;  3LSQ A;  4MW3 A;  4JYC A;  4YXW G;  1GKF A;  2V1D A;  5KUK A;  4PDM A;  1PNL A;  4FIP C;  1Y66 A;  1JJ2 U;  3ZRX A;  3EFF K;  1IXM A;  3QO8 A;  2YEV B;  1FXK A;  2C2A A;  1EZJ A;  4UUJ C;  1QLE C;  1QLE B;  4WF9 V;  5EC1 C;  2ZR3 A;  3WFV A;  1QBZ A;  2H94 A;  4CBC A;  4MTX A;  5LGT A;  1AI5 A;  1F4N A;  4MT8 A;  2NNU A;  3B8M A;  2AHZ A;  2ZDI C;  1Y4M A;  4ZKI A;  2QE7 G;  4RAI A;  1GMG A;  1YJN V;  2HFE C;  1JX9 A;  4HZ3 A;  1BMF G;  1SET A;  2DQ0 A;  2JEU A;  3FKS G;  2LFR A;  3DTU B;  4MVQ A;  4ZBM A;  3W7W A;  1Q81 W;  2JJ2 G;  2B5U A;  1H2G A;  4R8C A;  1YTF B;  4WFF A;  2X6A A;  3W7U A;  1QVF U;  5EBW C;  3ABK C;  3ABK B;  5L3D A;  4LCU C;  1BHA A;  1F4M A;  1RM1 B;  2OT5 A;  3ZCC A;  1RM1 C;  1NVP B;  2WLH A;  4MVZ A;  4KFM A;  1OCC B;  3D36 A;  1DTO A;  1GTO A;  2EIN C;  2EIN B;  4LP8 A;  3G6E V;  2XAH A;  3JD1 A;  1OCZ C;  1OCZ B;  2ZXW C;  2ZXW B;  3CCR V;  3JD3 A;  2IU3 A;  1NJI W;  1VQO V;  2DYR C;  2DYR B;  1KQS U;  4PA7 A;  2EIM C;  2EIM B;  3CCS V;  5BZB A;  4RO2 A;  2X0L A;  3OW2 U;  3ASO C;  3ASO B;  2IJH A;  5CA3 A;  1K4C C;  1NBM G;  2WWW A;  4JTC B;  3T2M A;  3TK1 A;  4KUM A;  1ARO P;  2ITC C;  3LNM B;  3GWO A;  2K1E A;  2XAF A;  3MD0 A;  3OFN G;  1AJN A;  1CPY A;  4KP4 A;  4RUE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...