1TUEB

The x-ray structure of the papillomavirus helicase in complex with its molecular matchmaker e2
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
194
structure length
194
Chain Sequence
HMQTPKETLSERLSALQDKIIDHYENDSKDIDSQIQYWQLIRWENAIFFAAREHGIQTLNHQVVPAYNISKSKAHKAIELQMALQGLAQSAYKTEDWTLQDTCEELWNTEPTHCFKKGGQTVQVYFDGNKDNCMTYVAWDSVYYMTDAGTWDKTATCVSHRGLYYVKEGYNTFYIEFKSECEKYGNTGTWEVHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replication protein E1
publication title The X-ray structure of the papillomavirus helicase in complex with its molecular matchmaker E2
pubmed doi rcsb
source organism Human papillomavirus type 18
molecule tags Replication
total genus 62
structure length 194
sequence length 194
chains with identical sequence E, G, J, L, Q
ec nomenclature
pdb deposition date 2004-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00508 PPV_E2_N E2 (early) protein, N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.30 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1tueB01
2.170.200.10 Mainly Beta Beta Complex Regulatory Protein E2; Chain: A; Domain 2 Regulatory Protein E2; Chain: A; Domain 2 1tueB02
1R6KA 2JEXA 1QQHA 2JEUA 2NNUA 1DTOA 1R6NA 1TUEB
chains in the Genus database with same CATH superfamily
2WA4A 2BOBC 4UV9A 1NS1A 3RYFA 3ZS8C 4R6ZA 1UFIA 4HZ3A 1Q6HA 4JI6O 3JCUZ 1B3QA 5EIBC 2PUSA 4PA3A 3GWOA 1TUEB 1HNZO 3GWKC 4JTDB 3K08A 3JAMN 4ZOLA 1HW7A 2A7WA 4I55B 4O4HB 4LF7O 1JCHA 2E75B 4MVUA 3FFQA 3JASB 3K9AA 1RFYA 2IJIA 4IGGA 2XHBA 1XOUA 3DXRB 1ZAUA 2UXDB 3ASNB 1GM8A 2ZNIA 3OFNG 2QM4A 3MHSC 4N21A 3D36A 5EZYB 1PPJH 1H2KA 3HKEA 3MHHC 2R9IA 5KHGA 3DTUB 2QWOB 5DECA 4MTXA 4JZ2A 3ZMVA 1Z2GA 3SPIA 1OCCB 1GN6A 4HAMA 4H37A 5KX5A 3ZMSA 4MW8A 5HFLA 1H2LA 3HB3B 4YIPA 2AZ0A 4ASUG 3J81N 5J2TB 1V9PA 4U7OA 2WLIB 5B1BC 2R9RB 4CC6A 2QE7G 2XNDG 4YY3B 2CH7B 2OT5A 4GX0A 5D5PA 3LNMB 3BHPA 5L3CA 1NR1A 5KHKA 4Q6GA 4PDLA 2KKWA 2UXCB 2Q8VA 3S3XA 2QGNA 3ZHQA 3I56V 5LYJB 3K9SA 1N32B 3ABKC 1PV0A 3QO5A 5LGNA 3VQVA 3B8MA 3J80N 1TA8A 1AP5A 2IU0A 2ITDC 1AVMA 1HNXB 3P32A 1V54C 2GBOA 3K04A 3ZHRA 2BTQA 1FFTB 3SYQA 1PL0A 2WLMA 1M1KW 4MVMA 2VWJA 1JR9A 4P30A 1N4CA 4KXRA 2EIJB 2A06H 2E74B 4JYBA 4L8JA 2QJ1A 1KQSU 5IYDO 1N34O 5J2UB 4X20A 3CRMA 1WNSA 3I55V 1H2NA 4DUZB 1EN4A 4ZHQB 2Q0AA 4K35A 4X64B 5FL7G 3CMAV 1PNKA 3JCZA 1V55B 2PYLA 4NB5A 4NKGB 1OHHG 5KHHA 1ZSPA 1YTFD 1FXKC 4WF9V 4YJ2B 1P84F 2F4VO 3OTOB 4X66B 2ZDIC 1F4NA 2X7RB 4BIOA 4AQYO 1VF5B 5LP6C 4DYLA 4LF6B 3A8TA 3A0HZ 3K5NA 1JX9A 1YVWA 3G67A 4MW3A 4L87A 1NZ6A 2GTAA 3WU2Z 3RVZA 4LFCB 2A3QA 3SGIA 1SERA 1O9HA 1CXZB 1GKFA 2MW2B 2Q69A 2B1GA 1UPGA 3E8GA 4TWKA 4DV5O 1IBMB 3B8NA 5JQGB 3X2QB 1QLEB 1H2MA 2DQ3A 3C90A 4X88A 3SYPA 3ZHSA 1QVFU 2B1IA 3VQXA 4DV3O 3TXQA 1T5EA 2JGDB 3AG4C 3UT5B 5JJNB 2OCCB 5J9PC 4QGPA 4MSWC 4MVSA 1IBMO 1S5HC 3CS5A 1S5LZ 3E22B 4X65O 1Q82W 1WA8B 1QQHA 3OR7C 4I9WA 4R8CA 2GUZA 3TETA 4JI0B 2BSKA 3L71H 1WP7A 1NTKH 3ZRWB 4B7KA 2RQ6A 1GN2A 4MVOA 1U97A 4GUNA 4EB6B 4H44B 2CGNA 1SS3A 3LDCA 4DUYO 1LUVA 2IU3A 3OW2U 1BHAA 4CS2A 5FLXN 3K0DA 1GN4A 1ORQC 4DR7B 2BE3A 4DW0A 4IYHA 5K1PA 3CRQA 1F7YA 1KB9F 2UUCB 3AG3C 2PYJA 2YEVB 2FL4A 1RPRA 1E1RG 2E5LO 1I94B 3AK1A 1SQQH 2R9AA 3CP1A 4YHHB 1G6UA 4I0XA 2MK3A 2UUAO 2UU9B 2QKSA 2A9HA 2CK3G 5HFMA 5IYBO 4GT1A 2CDYA 1YI2V 5B1AC 4DR2O 3ML0A 2C2AA 1O9GA 2ZR3A 4UUJC 1K9MW 5CA1B 4DRXA 4J7JA 3RT3C 4JI5O 3HPLC 4JV5O 2QM8A 1ZWIC 2UU9O 2Q9LA 1BGYH 1A32A 2LGQA 3JAWB 2OYQA 2QM7A 2JEXA 4LFBB 3SPJA 2P06A 4WFAV 2R72A 1TUBA 3DSQA 1N36B 4HYOA 3DC5A 3CWBH 5FPOA 3B77A 3BEHA 2BTOA 1N33B 5LGTA 2ETNA 3GB7C 4LCUC 1DLBA 1PP9H 2P90A 2B9ZA 3ZRVA 4JYCA 2UXNA 3ZCCA 3A0BZ 2ADPA 1ZX3A 2DE0X 1CP9A 2F66C 3G6EV 3QO8A 4Z1MG 1V54B 1XNRB 2FKXA 1AROP 1AI5A 2CUGA 5CBFA 4MVQA 1F23A 5LGUA 3SYAA 3D8CA 3UO2A 3W7UA 2L35A 1PNMA 3JAKB 1SKVA 5KHIA 4I4TA 2JJ1G 4DR4B 2NNUA 4DV1O 5LHIA 3QG5A 5IYCO 4QE7A 4HNAB 4O4IB 3ZHUA 3L73H 1YITV 3K58A 4JI2B 1MG1A 1HP8A 3OTFA 1GM7A 4UCSA 5K1XA 4LFAB 4X62O 4I55A 5H5NA 2D2CB 4WFEA 3A2FA 4DR6B 1W2BU 5EK0A 3DXRA 5FNVB 4FM0A 3F7VC 2WSSG 5LP6B 2YIBA 2W6JG 2QSAA 3HKCB 2EJRA 3FB7C 1OCOB 2KB1A 3TCUA 4K0KB 3IFXA 2VQFB 3CCEV 1QLNA 4PELA 4LFAO 2HP8A 5EZYA 1L1FA 3BRCA 3Q4HA 3ETQA 2DYSC 2Y4UA 2DWEC 4YXWG 4J11A 4YJ3B 1M93A 2RN9A 3OE7G 4X1IB 4TQDA 3CEIA 4LF4O 1XNQO 3N2KB 3CYOA 3OGIB 2CE4A 1I5XA 2XAGA 3KCXA 4WCEV 1Q8IA 2VQFO 3E2EA 3APOA 1QQCA 3ABMC 4I5SA 1BT8A 1MSWD 4KL1A 1AJNA 4LNUB 1MZEA 1IBLB 3AG4B 3CC7V 4X1YB 2QWPB 4Q20A 2WLIA 1OCRB 1PM9A 5H6RA 4JI7B 1XMQB 3HKDB 1Q6UA 2JS5A 2FYUH 1FYJA 4I7ZB 4MTFA 5IWAO 2HVKC 4OXSA 1MA1A 4JI4B 1LUWA 4B3MO 4GLXA 3OD4A 3OAAG 2Q73A 1US6A 2QR4A 3H9VA 4O2AB 1WP8A 1DGSA 5L3DA 4F6RA 2YICA 2FB5A 4UB6Z 1IZ3A 1NVPD 3W7XA 2LGWA 3W7TA 5KUKA 5D5QA 4TT3G 2EIMC 4X8AA 4U3JB 2DYRB 4PD4F 3H01A 3HKBA 2Q68A 4WBNA 1JQ0A 3D36C 4FIPC 5IJ9B 3H1KH 5J2UA 4LWSA 2Y0PA 2ITCC 5DM6V 1I08A 3AG3B 2ILMA 4JI6B 1AJPA 3IJ4A 2KG7B 4LH6A 3F5WC 4ZHQA 4RWUA 1NT2B 1TVKB 1HNZB 2PY5A 4KHPO 3QO7A 4F6EA 3WG7C 2IJKA 1SQGA 3FYIB 1VMGA 5A9GA 2ZKOA 4LF7B 1GM9A 4R7CA 1K92A 4YJ2A 1KBHA 1XREA 4FJCC 1YSCA 2EIKB 1VF6A 4J41A 3AK3A 2Z0AA 1H2GA 3L72H 4K8XA 3JARB 1FAFA 2ZM6B 1YCIA 1QHTA 1D2DA 2WLLB 4A5UB 3HR0A 1M57B 1SETA 3RYCA 1S76D 3CD6V 5CB4B 1N0NA 1YXBA 4FLXA 2P4VA 1U96A 4QPKA 1S5JA 2F23A 4DK0A 2YS8A 4I9QA 2ZM6O 4FPPA 4X9QA 1JOYA 2UUBO 2H94A 3JD3A 5B3SC 5JQGA 1WB7A 3SJBC 4YIOA 3UO3A 4P9PA 4X1KB 1VP7A 4IYIA 4QPJA 5H6QA 2A0LA 3C3TA 3CB2A 5BXZA 2JGDA 1VQ7V 1HR0O 4GYCB 1BZKA 4CH3A 2DJVA 3UT5A 3JATB 3E8BA 1R3KC 5CBGA 3L74H 1Q7YW 5C8YB 1XQ8A 3SPGA 5EYPB 2Y4TA 3E22A 2VQEO 4DV6O 4PA9A 3WFVA 1WA8A 4B3RO 1XDCA 3K57A 2P22C 4PDVA 1Q86W 1B04A 1I0HA 1AI6A 2P7TC 3ZRWA 1BL8A 3NR7A 4B3TO 1YJNV 4DR1O 4IHJB 1K73W 2XAFA 3CCRV 2A79B 3LSUA 1KP2A 5L3BA 2QWNB 4B08A 3J7AU 2BCCH 2YIBD 1N34B 1HNWO 1IX9A 1VEWA 3T1CA 2DOSA 2V1DA 3H1HH 5LHGA 5KMGA 4RQFA 5JH7B 4ZI7B 1OV9A 4JI3O 4O2BB 4O4JA 3B09A 1GK9A 3THOA 4JI8O 1QCEA 1XILA 2RCVA 3I5DA 1BS3A 2XAQA 2F4VB 3ABLB 4GX5A 5BMVB 2DYSB 4PDRA 4NYKA 5KA5A 1VQOV 1M56C 4GKJO 2ZD9A 4JGSA 4AQYB 3RYHB 2ARHA 2WLNA 1K7DA 2YI9A 1Y4MA 3JD1A 2DMXA 3CCLV 5EBWC 1SQXH 3IGAC 5CA1A 2P6JA 4NVPA 3CSXA 2P5OA 4U3FH 3K5LA 2WLHA 3E8FA 5LA6A 5B66Z 2ZNJA 3AG1B 2FTKA 1P4RA 3K06A 2YSUB 4DV5B 1WB8A 5IYZB 1NBMG 4DO2A 3CCMV 3ICXA 4UVCA 1H8HG 4DV3B 4DV0O 5GONA 3N27A 2ZE5A 1AB3A 3FAVB 1Q43A 2YUAA 2LP7A 3BA8A 3OUFA 2JK5C 3OM3B 3B4SA 4OPAA 3L9DA 2ADQB 1ENVA 4FLVA 1Y76B 4X65B 3GVMA 4MTGA 2LFSA 4FLTA 4CH4A 1K5QA 1XMOO 3RW0A 2KSDA 1GO3F 3JAKA 4GKKB 3ZIAG 2X0LA 3U0ZA 1S3JA 5GW7A 1BSMA 4JYYA 1YZBA 4DV2O 4AHCA 4DR5O 3STLC 1NQTA 2QA4V 3ETGA 2R70A 4DUYB 2EILC 3JD4A 1B06A 1OCZB 1DTOA 1VF7A 1GN3A 2WPDG 5JJJB 1SQVH 1VQ4V 5KAFZ 2XUMA 2JRIA 3P3PA 2D3OW 4GKKO 4UCVA 3FB6C 3B40A 1VQ5V 4QJFB 3UKMA 3JSNA 4UV8A 1THZA 4KFMA 2E5LB 3R65A 3CCQV 3RN4A 5LMUO 4J9ZB 1DF4A 3HKCA 1VQNV 2BOCC 1JJ2U 1GRJA 4JI1O 3BVOA 2UUAB 2CTWA 1E1QG 4D7SA 3SYCA 2F43G 4E4EA 4GX1A 4JYAO 3O9OA 1FS0G 4DR2B 1AI7A 4FLWA 4UCRA 2UXBB 4X1IA 2EINC 4J7KA 1MMMA 4IIJB 3JALA 2JDIG 1KP3A 2P67A 1RM1C 4JI5B 4JV5B 2F95B 3SYOA 1LR1A 2X6BA 5E1AC 4FK5C 3OEEG 4LF8O 2YIAA 3C3SA 1F51A 2X6CA 5FPRA 4JPRA 5GTHZ 2UXBO 2Q7GA 4X1YA 4D7TA 2VS0A 3LDDA 4TV8B 4NXNO 1KYOF 4BW9A 4RQEA 2ZXWC 3HKDA 2H8PC 3PJSK 2PF4E 1RSOB 2ZE6A 4FLYA 3SPCA 3SPHA 3LDEA 1KUQA 2Q5ZA 3DGEA 2JIZG 4CBCA 1URFA 2Q7HA 5B1BB 2WLKA 5EIBD 2F93B 5CMUA 4O2AA 2QTSA 1BQZA 1D5AA 4GZRB 4LH7A 3SJAC 1P7GA 1FFXA 2K1EA 4HBNA 1EM1A 2UXXA 1BHBA 4WFFA 5IDJA 1L0NH 2N05A 1JPXA 3ABTA 1J95A 1P49A 3CCUV 1IURA 4JTCB 3ABKB 4U3JA 2HLDG 5IJ9A 4DV1B 3K79A 2HHHO 1HDJA 2ZIMA 2HJDA 4CZZA 4PA6A 2KG7A 3QNEA 2Z3YA 1ZL8B 5ITZB 2LFRA 1TVKA 4B3SO 3A0RA 4O4LA 1OCCC 3ZHTA 4X62B 4XDKA 1Z5VA 4UFZA 1P7BA 3RGBA 3MD0A 4J42A 2XTAA 1M56B 2NLJC 5E79Z 3JD0A 5CA0B 1IBKO 1FXVA 2JJ2G 3ZX6A 2CTRA 5DEDA 3T1HO 1BCCH 4PA7A 1FXKB 1KU9A 2PTMA 1R6TA 2WLLA 1WJZA 1TAEA 4O4HA 1AR4A 2EZPA 5BZBA 1XBLA 3JASA 1VQ9V 4G28B 1K97A 2F1MA 2GUZB 3RYIB 2RNBA 3UCSC 2BSKB 3CHXA 4FM2A 3T4ZA 1NKDA 4CS3A 4LF4B 1Y74B 1XNQB 3EFFK 4Z2WA 1MOFA 5JCOA 4G2KA 1DK1A 3H1LH 2X6AA 5KAIZ 4D6TH 3CJHB 1XI1A 1VQMV 2M7WA 4FFKA 1SESA 2IBZH 1VQ6V 1AR1B 4MVRA 5LBQA 5IJ0B 1IVSA 4E2LA 4QIWF 1YF2A 2IH1C 1H8EG 1VARA 2NR5A 3JATA 2AHZA 1R3IC 3EXAA 2HG5C 5IWAB 2Y0IA 5C8YA 1R3JC 5EYPA 4MS2A 3T1YO 4B3MB 2EULA 3AEIA 5A2QN 1IXBA 2AXTZ 4BAYA 2XAHA 5J2TA 1V55C 3AG7A 1EN5A 4OGQB 4XDLA 2CH7A 1D5NA 5LMNO 4DR3O 2Y69C 1Y67A 4RO2A 2VRZA 1SA0B 4RUEA 4IHJA 2IH3C 4U7NA 1L0LH 2EX3A 2YIDA 1VF6C 1F4MA 1KMIZ 3QVNA 2P4KA 2ZINA 2HR3A 5LYJA 1NI8A 3K03A 4GCZA 3F5TA 3FYEB 3P30A 2OTJV 4LF5B 4PDMA 1JFFB 4BWAA 3IC7A 1K5SA 1PD3A 1NH2B 1J5EO 1I7FA 1K3EA 1EFRG 1JA8A 4XDJA 1BQ0A 4C7UA 4DK1A 4KHPB 5L3GA 4ZI7A 4NTYA 1CPYA 1PNLA 2G38A 3P3NA 1Q6IA 5C93A 4O2BA 5BR8O 3BFRA 4PV1B 5EC1C 4LF5O 1QLEC 4RUFA 1LNQA 2DWDC 4QNHB 3CC2V 4H0LB 1EZJA 3U11A 3JSLA 2RDCA 1Y6XA 2LJ2A 1RM1B 3OMAB 4UCUA 3E35A 4K8ZA 4JAAA 2CTQA 2ZE8A 4FM1A 5B1AB 2YXHA 1G1XB 2Q67A 4DV7O 2M6YA 2HFEC 5DN6G 1L8DA 3RWRD 1GAXA 3TGUH 5H9CA 3VQWA 2UUBB 3OMNB 4LF9O 2HKOA 2ZXWB 3MDSA 5IYZA 4FLZA 4FFBB 1GTOA 1SQFA 4NXMO 2W0XA 3RFRA 1YJWV 1NH2D 1BE3H 3WB0A 1WPBA 3K5OA 2N04A 1HR0B 3FAVA 2WA3A 2OTLV 3N2GB 3L70H 2IJHA 2Y48A 1Y76A 4TUYB 4PA4A 3CPWU 2VQEB 4DV6B 4AILC 3FX7A 3OMIB 4B3RB 4IT5A 4P2ZA 3CMEV 3H1IH 2QEXV 4J9YB 1K4DC 2V4DA 3ZRSA 1CEZA 2JS3A 4B3TB 2QTOA 1VQKV 3QF7A 3Q4HB 3K0GA 1S72V 4DR1B 4BR6A 1MABG 1ZLZA 4W4KA 5L3FA 4I50B 2UXDO 1JVMA 4N23A 4QE9A 2LW7A 3OEHG 3CCJV 2XASA 2PI4A 1HNWB 4LC1A 4EFEA 5L3EA 1G4YB 5IT9N 3M7MX 2WWWA 3TJTA 1QBZA 3LUTB 2ATKC 3CX5F 1R3LC 4KP4A 4EB6A 1WLEA 2CAZC 5B1OA 3H1JH 3ZMZA 1YTFB 4JI3B 4JI8B 1XL4A 2NN4A 3G4SV 2JGUA 3QTCA 5CA3A 3TXSA 4ZBMA 1UJWB 1FXHA 2YC0A 4GKJB 3EHBB 4PI2A 2YEVA 5GTIZ 4RAIA 3STZC 5CBHA 2DW4A 1K34A 2XOKG 4NTXA 4YY3O 2YI8A 4WFBV 4IIJA 4F6RB 3FD9A 3MAQA 1QU7A 2UXCO 1R6KA 2QWRB 3RBZA 1EBOA 1AR5A 3RVYA 1Q5OA 1XUQA 3CC4V 3CXHF 3HKBB 4WBNB 3APQA 1NJIW 4H33A 1N32O 4R50A 4LR3A 4LWSB 5JVDB 3TK1A 4TV8A 2YXLA 1HNXO 2IM9A 1SC5B 3ABMB 3E83A 2AHYA 4DV0B 1RSOA 4JAVA 5LXTB 1Z5WA 3JAWA 4DV4B 5LOVB 4B7EA 1R1BA 1K33A 4J7ZA 1SZXA 4J10A 4G27B 1Q3EA 5KUMA 4PI0A 4TV9B 1QVGU 4OX9B 2Y69B 2H3OA 2LW1A 3RYFB 3CXCU 2V7QG 4DUZO 5IY5C 1KC8W 3VOUA 4X64O 4DV4O 1XMOB 1N8RW 1N0JA 2GHYA 4ZOLB 3LSSA 1OCOC 1SF9A 1ZUQA 4ZIBA 3RYCB 3PN1A 1S0VA 4OX9O 2E76B 4NR1A 4DV2B 4DR5B 3CCSV 3OTOO 4X66O 1VQPV 3ABUA 2EIMB 1K8AW 5IE9A 1B6QA 1XEQA 1ZL8A 4LF6O 5ITZA 2HVJC 4Z1VA 3T2MA 3HKEB 1IXMA 3L75H 4UVAA 1W0KG 4LFCO 4BW5A 2GSMB 2Q4PA 3ZRXA 4OPHA 3WB2A 5LMUB 5CA0A 5B5EZ 4HNAA 4O4IA 4ABMA 4DW1A 3WG7B 4JI1B 1OCRC 4EKWA 1H2SB 5KX5B 3G80A 2W0FC 2XT9A 1FXKA 2QKAA 1QR9A 1SQBH 3CRAA 4UXNA 4IL6Z 4JYAB 3ZN0A 2ZDIA 1FKAO 1RPOA 5FNVA 1H38A 3RYIA 5LP6A 1KD1W 3NXSA 2OIGA 4BIZA 1Y74A 1M90W 3K59A 1MZFA 4H13B 4JZGA 1JJOA 3T4DA 1X59A 3CJHA 2DQ0A 1ROPA 2ZCEA 4LF8B 2PGGA 1SZTA 1I5YA 1YDXA 5B1NA 1KKDA 2DYRC 4YJ3A 4JI0O 3ASOC 4UCOA 4NXNB 1W59A 4CH6A 5IJ0A 3N2KA 3OR6C 3AG2C 2BTQB 4FLUA 2KQXA 3D3QA 4ICGA 5KMGB 5B3SB 3IAYA 4TSFG 1YJ9V 4EFBA 3VBBA 1KKCA 4FZ0A 1COWG 4MVZA 5KLVH 4UB8Z 4FMTA 4EEQA 3OUSA 4J80A 5AG2A 4LNUA 4ZKIA 4O4JB 3BA9A 4X20B 3SJCC 3FB8C 2ZIOA 4DR7O 2HJFC 5JWPA 2WAMA 1WN7A 2B5UA 1PL4A 3AK2A 3SDLA 3JYCA 2UUCO 1EZVH 3LNNA 3BY6A 5H2FZ 1ZTEA 1SA0A 1M5IA 2ODMA 2EIKC 1YIJV 1GMGA 1QR8A 1I94O 1BMFG 4WFHA 1FJGB 2OCHA 2OIEA 4JTAB 2VWKA 4YHHO 1YHQV 2Q0OC 3SJQC 1M57C 2HHHB 1Q90D 5LA6B 2WLJA 1JFFA 1K4CC 2Q7EA 1NR7A 4UVBA 3ZHVA 3KZIZ 2CGOA 3ASNC 2ZE7A 4B3SB 5JCOC 3ZMUA 4NTWA 1FJGO 3W7WA 1XHXA 4GX2A 2IW5A 2DN9A 3UM7A 3BABA 5KA6A 2GTSA 3BPZA 2LO1A 4AI8A 5GONB 3ZEDA 1IBKB 2K9PA 1YEWA 3KCYA 4LFBO 1G8MA 2EZOA 4FVMA 1N36O 4K3AA 3T1HB 1JMKC 5EBMC 1XL6A 1N33O 2EBOA 3BCCH 1Y66A 4FZ1A 4LBEC 1OZ0A 4TQFA 3WB1A 1NTZH 1X4TA 4MTOA 1FD9A 5JJEB 2RJZA 1OJHA 2LQTA 3FB5C 3ETDA 1TGOA 3KKYA 1VIBA 3JARA 3ZN1A 3ETEA 2N74A 3CE2A 2AZ2A 2EJ7A 1XNRO 1PKXA 3CCVV 1AILA 1SQPH 5CB4A 3OGCC 1M9NA 1AI4A 2JVDA 4FFBA 1M4UA 3BAAA 4PHZA 3ZMTA 4DXWA 2E3CA 3N2GA 2PI5A 4DR4O 4CC5A 1VQ8V 1EN6A 3M99B 3T1YB 4P9OA 5IY5B 3UQ8A 4TUYA 2YDEA 4TOIA 4X1KA 4JF3A 2EIJC 3K5MA 3O65A 2GV9A 3EVKA 4JI2O 1S77D 2QWQB 3U10A 2OWOA 1NVPB 1W0JG 1NU1H 1R73A 4DR3B 5LMNB 2L6LA 3LSQA 3VQYA 5BY1A 3DC6A 1QNMA 2QKCA 2RMKB 2ZT9B 4JASA 3ABLC 2YXYA 1HWYA 3W7SA 2Z5UA 4DR6O 4I50A 1AJQA 1MSDA 3F7YC 4MT8A 3JALB 3M8AA 4BIUA 4I0XB 4K0KO 5CN0A 3E89A 2HEPA 3E86A 5F2VO 1J5EB 2AW9A 2EILB 3AG1C 4CS4A 3ZBHA 2ZQMA 1NTMH 2Q6AA 3CRCA 4DRXB 1R6NA 5BR8B 2XAJA 4XBFA 2GDSA 2QDOA 3E8HA 3G71V 5TISZ 5EC2C 3OT7A 3G6BA 1TUBB 5KHJA 1XHZA 1IBLO 3IC9A 1WPXA 1AP6A 5JH7A 4KUMA 3R66A 1FPOA 4JI7O 1XMQO 4PJ0Z 4LP8A 1WAZA 1FFXB 3X2QC 5LHHA 1E79G 2FMLA 2JEUA 1KECA 3FKSG 5BMVA 2ZR2A 2PZSA 4JI4O 4DV7B 3SR2C 4X89A 3ZJZA 1Q81W 3B2EE 3RYHA 3ASOB 3CRRA 4WFGA 2EINB 3S3WA 2OCCC 3D3IA 5EBLC 1IDSA 3K3WA 3AG2B 2W6IG 4LF9B 5JVDA 4W4LA 2O57A 1RP3B 3KG2A 1VQLV 4NXMB 5LL6Y 1SRYA 4F4LA 5LXTA 1DF5A 2IJJA 1OCZC 4O4LB 4UCTA 5LOVA 3JD2A 1MNGA 2AGAA 2CTPA 4I4TB 4CH5A 1GH6A 4JAUA 4TV9A
chains in the Genus database with same CATH topology
2BOBC 4UV9A 5EK0A 3TK1A 1W2BU 4R6ZA 4HZ3A 3F7VC 2EINC 2WSSG 2W6JG 2EJRA 2JDIG 3ABMB 1KP3A 2P67A 3FB7C 3E83A 2AHYA 1OCOB 2KB1A 1RM1C 3TCUA 4PA3A 3GWOA 3IFXA 4JAVA 3SYOA 1TUEB 2X6BA 3CCEV 4JTDB 1QLNA 3K08A 4PELA 5E1AC 4FK5C 1L1FA 3OEEG 1F51A 2X6CA 2DYSC 1K33A 4JPRA 4G27B 1JCHA 2DWEC 4MVUA 5KUMA 4YXWG 1QVGU 3K9AA 2Y69B 2IJIA 3CXCU 3OE7G 3LDDA 2V7QG 3ASNB 3CYOA 4RQEA 2ZXWC 5IY5C 1GM8A 2H8PC 3OFNG 1KC8W 3PJSK 1I5XA 2XAGA 4WCEV 3MHSC 3E2EA 3VOUA 3SPCA 3SPHA 3LDEA 4N21A 3ABMC 3D36A 4I5SA 1N8RW 2GHYA 3DGEA 3LSSA 1OCOC 2JIZG 4CBCA 1MSWD 5B1BB 1AJNA 1S0VA 2WLKA 5CMUA 3AG4B 3MHHC 3CC7V 2R9IA 3CCSV 4Q20A 3DTUB 2WLIA 1OCRB 5H6RA 3ABUA 1VQPV 2EIMB 1K8AW 4MTXA 2K1EA 3ZMVA 1BHBA 2UXXA 4WFFA 1B6QA 5IDJA 3SPIA 1OCCB 4HAMA 1JPXA 3ABTA 4MTFA 1J95A 3CCUV 2HVKC 4OXSA 4H37A 4JTCB 3ABKB 2HVJC 3OAAG 3ZMSA 3T2MA 1IXMA 4MW8A 4UVAA 1W0KG 5HFLA 3HB3B 2HLDG 4ASUG 4BW5A 4U7OA 2GSMB 2WLIB 3K79A 5B1BC 2R9RB 3ZRXA 2QE7G 2XNDG 5L3DA 4CZZA 2OT5A 4GX0A 4PA6A 3LNMB 1NVPD 3QNEA 5L3CA 3W7XA 1NR1A 3WG7B 3W7TA 1OCRC 4PDLA 4EKWA 5KUKA 2Z3YA 4TT3G 2EIMC 2LFRA 4X8AA 2DYRB 2W0FC 1FXKA 3H01A 1QR9A 3A0RA 3I56V 1OCCC 2Q68A 1JQ0A 4UXNA 4XDKA 3ABKC 4FIPC 3ZN0A 1P7BA 2ZDIA 3MD0A 1RPOA 3QO5A 5LGNA 2ITCC 1M56B 2NLJC 1H38A 5DM6V 3B8MA 3JD0A 3AG3B 1FXVA 2IU0A 1AJPA 2ITDC 1KD1W 2JJ2G 3NXSA 3P32A 1V54C 3F5WC 3K04A 4BIZA 1M90W 1FFTB 3SYQA 1PL0A 2WLMA 1M1KW 4MVMA 3T4DA 4P30A 4PA7A 1FXKB 2DQ0A 1ROPA 3QO7A 2EIJB 3WG7C 2IJKA 3FYIB 2WLLA 4JYBA 1SZTA 1I5YA 2EZPA 5BZBA 5B1NA 1KQSU 5IYDO 1KKDA 2DYRC 1GM9A 1VQ9V 4G28B 1K97A 4R7CA 3I55V 3ASOC 1K92A 4FJCC 3T4ZA 1NKDA 1YSCA 2EIKB 3OR6C 3AG2C 3EFFK 1MOFA 5B3SB 4G2KA 4TSFG 2X6AA 1H2GA 1YJ9V 5FL7G 3CMAV 3VBBA 1PNKA 1VQMV 1COWG 4MVZA 3JCZA 2WLLB 1V55B 2M7WA 1M57B 4FMTA 3OUSA 1SETA 1S76D 1OHHG 3CD6V 4ZKIA 1SESA 1YTFD 1FXKC 4WF9V 3FB8C 4QPKA 1VQ6V 1AR1B 2HJFC 4MVRA 5LBQA 2WAMA 4E2LA 4QIWF 2B5UA 2IH1C 2ZDIC 1F4NA 1H8EG 2X7RB 3JYCA 2AHZA 1R3IC 3BY6A 4FPPA 2HG5C 1JOYA 2EIKC 2H94A 1R3JC 3JD3A 4MS2A 1YIJV 1JX9A 5B3SC 1GMGA 3AEIA 1QR8A 1BMFG 4P9PA 4MW3A 4WFHA 4L87A 4JTAB 4QPJA 5H6QA 4BAYA 2XAHA 1YHQV 3RVZA 1V55C 2A0LA 3SJQC 1M57C 1SERA 4XDLA 2WLJA 1VQ7V 1GKFA 1K4CC 2Y69C 2Q69A 2B1GA 4RO2A 1NR7A 4UVBA 3E8GA 3E8BA 1R3KC 5CBGA 4TWKA 1Q7YW 4RUEA 2IH3C 4U7NA 3ASNC 3SPGA 1F4MA 3B8NA 3X2QB 3ZMUA 1QLEB 2DQ3A 4X88A 2HR3A 4PA9A 3W7WA 3SYPA 4GX2A 3WFVA 2IW5A 1QVFU 3UM7A 3K03A 4GCZA 2B1IA 3FYEB 5KA6A 3P30A 4PDVA 2OTJV 4PDMA 1Q86W 3IC7A 3AG4C 1AI6A 2P7TC 3ZRWA 1BL8A 1K5SA 1PD3A 2OCCB 5J9PC 1NH2B 1G8MA 2EZOA 1YJNV 4MSWC 4MVSA 1K3EA 1S5HC 1EFRG 4XDJA 1K73W 2XAFA 3CCRV 2A79B 5L3GA 1KP2A 5L3BA 5EBMC 1CPYA 1PNLA 1XL6A 1Q82W 2EBOA 5C93A 1QQHA 5EC1C 1Y66A 4LBEC 1QLEC 3OR7C 4I9WA 4R8CA 4RUFA 3TETA 1OZ0A 1LNQA 3T1CA 4MTOA 2DWDC 4QNHB 3ZRWB 2V1DA 3CC2V 5LHGA 3FB5C 3ETDA 4MVOA 1EZJA 3ZN1A 4RQFA 3ETEA 3LDCA 1RM1B 1PKXA 3CCVV 3OMAB 3OGCC 1M9NA 2IU3A 1AI4A 3OW2U 1BHAA 3E35A 1GK9A 1QCEA 3K0DA 1ORQC 2XAQA 5B1AB 3ABLB 4GX5A 2DYSB 4PDRA 2Q67A 5KA5A 1VQOV 2HFEC 1M56C 2ZD9A 4JGSA 3ZMTA 4DXWA 3AG3C 5DN6G 2PI5A 2YEVB 2WLNA 1VQ8V 5H9CA 3OMNB 3M99B 2HKOA 2ZXWB 4P9OA 1RPRA 1K7DA 1E1RG 5IY5B 1Y4MA 3JD1A 3CCLV 5EBWC 3IGAC 4JF3A 3CP1A 2P6JA 2EIJC 1GTOA 1S77D 2MK3A 2WLHA 3E8FA 1YJWV 1NH2D 2QKSA 1NVPB 1W0JG 2A9HA 2CK3G 1R73A 5IYBO 4GT1A 5HFMA 3AG1B 3LSQA 2OTLV 2FTKA 1P4RA 4JASA 1YI2V 5B1AC 3ABLC 2IJHA 3ML0A 1HWYA 3K06A 2Y48A 2C2AA 2YSUB 2ZR3A 2Z5UA 4UUJC 3W7SA 1NBMG 4DO2A 3CCMV 1AJQA 4PA4A 3CPWU 1K9MW 3F7YC 4MT8A 3OMIB 4BIUA 4P2ZA 4UVCA 1H8HG 3CMEV 3HPLC 2QM8A 1ZWIC 2QEXV 5CN0A 4J9YB 3E89A 1K4DC 3ZRSA 1CEZA 2QM7A 2JEXA 2QTOA 3SPJA 3E86A 1VQKV 3K0GA 2LP7A 1S72V 4WFAV 2JK5C 1MABG 2EILB 3OM3B 3OUFA 4HYOA 3AG1C 5L3FA 1ENVA 1JVMA 4N23A 3B77A 4QE9A 2ZQMA 3BEHA 2Q6AA 5LGTA 4MTGA 1R6NA 3OEHG 2XAJA 3GB7C 3CCJV 2LFSA 2XASA 4XBFA 4LCUC 2PI4A 1DLBA 4LC1A 3E8HA 2P90A 3ZRVA 1K5QA 4JYCA 5L3EA 1G4YB 3RW0A 3G71V 2UXNA 5EC2C 3ZCCA 1GO3F 2WWWA 1CP9A 1QBZA 3LUTB 3ZIAG 2X0LA 2ATKC 1R3LC 1S3JA 4KP4A 1WLEA 5GW7A 5B1OA 1WPXA 3G6EV 3STLC 3QO8A 4KUMA 1V54B 4Z1MG 1NQTA 2QA4V 3ETGA 1AROP 1AI5A 3ZMZA 1YTFB 2EILC 4LP8A 3JD4A 3X2QC 5CBFA 4MVQA 5LHHA 1E79G 1OCZB 1XL4A 1F23A 5LGUA 2JEUA 1DTOA 1KECA 3FKSG 3SYAA 1VQ4V 2WPDG 3G4SV 3W7UA 5CA3A 2ZR2A 2D3OW 4ZBMA 1PNMA 1UJWB 3FB6C 1FXHA 4X89A 3ZJZA 1Q81W 3ASOB 3EHBB 4WFGA 2EINB 2YEVA 2JJ1G 2NNUA 1VQ5V 2OCCC 3D3IA 4RAIA 3UKMA 4QJFB 5EBLC 5LHIA 4UV8A 1THZA 3K3WA 3AG2B 2W6IG 3STZC 5CBHA 2DW4A 4QE7A 1K34A 2XOKG 4KFMA 3R65A 3CCQV 4J9ZB 4WFBV 1DF4A 1VQNV 2BOCC 1JJ2U 5IYCO 1YITV 3KG2A 1VQLV 1SRYA 4F4LA 1MG1A 1R6KA 3RBZA 1GM7A 1EBOA 1DF5A 3RVYA 1E1QG 2IJJA 1OCZC 3SYCA 2F43G 3CC4V 3JD2A 4GX1A 1NJIW 4H33A 1FS0G 1AI7A 4JAUA 4R50A 4WFEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R6K A;  2JEX A;  1QQH A;  2JEU A;  2NNU A;  1DTO A;  1R6N A;  1TUE B; 
#chains in the Genus database with same CATH topology
 2WA4 A;  2BOB C;  4UV9 A;  1NS1 A;  3RYF A;  3ZS8 C;  4R6Z A;  1UFI A;  4HZ3 A;  1Q6H A;  4JI6 O;  3JCU Z;  1B3Q A;  5EIB C;  2PUS A;  4PA3 A;  3GWO A;  1TUE B;  1HNZ O;  3GWK C;  4JTD B;  3K08 A;  3JAM N;  4ZOL A;  1HW7 A;  2A7W A;  4I55 B;  4O4H B;  4LF7 O;  1JCH A;  2E75 B;  4MVU A;  3FFQ A;  3JAS B;  3K9A A;  1RFY A;  2IJI A;  4IGG A;  2XHB A;  1XOU A;  3DXR B;  1ZAU A;  2UXD B;  3ASN B;  1GM8 A;  2ZNI A;  3OFN G;  2QM4 A;  3MHS C;  4N21 A;  3D36 A;  5EZY B;  1PPJ H;  1H2K A;  3HKE A;  3MHH C;  2R9I A;  5KHG A;  3DTU B;  2QWO B;  5DEC A;  4MTX A;  4JZ2 A;  3ZMV A;  1Z2G A;  3SPI A;  1OCC B;  1GN6 A;  4HAM A;  4H37 A;  5KX5 A;  3ZMS A;  4MW8 A;  5HFL A;  1H2L A;  3HB3 B;  4YIP A;  2AZ0 A;  4ASU G;  3J81 N;  5J2T B;  1V9P A;  4U7O A;  2WLI B;  5B1B C;  2R9R B;  4CC6 A;  2QE7 G;  2XND G;  4YY3 B;  2CH7 B;  2OT5 A;  4GX0 A;  5D5P A;  3LNM B;  3BHP A;  5L3C A;  1NR1 A;  5KHK A;  4Q6G A;  4PDL A;  2KKW A;  2UXC B;  2Q8V A;  3S3X A;  2QGN A;  3ZHQ A;  3I56 V;  5LYJ B;  3K9S A;  1N32 B;  3ABK C;  1PV0 A;  3QO5 A;  5LGN A;  3VQV A;  3B8M A;  3J80 N;  1TA8 A;  1AP5 A;  2IU0 A;  2ITD C;  1AVM A;  1HNX B;  3P32 A;  1V54 C;  2GBO A;  3K04 A;  3ZHR A;  2BTQ A;  1FFT B;  3SYQ A;  1PL0 A;  2WLM A;  1M1K W;  4MVM A;  2VWJ A;  1JR9 A;  4P30 A;  1N4C A;  4KXR A;  2EIJ B;  2A06 H;  2E74 B;  4JYB A;  4L8J A;  2QJ1 A;  1KQS U;  5IYD O;  1N34 O;  5J2U B;  4X20 A;  3CRM A;  1WNS A;  3I55 V;  1H2N A;  4DUZ B;  1EN4 A;  4ZHQ B;  2Q0A A;  4K35 A;  4X64 B;  5FL7 G;  3CMA V;  1PNK A;  3JCZ A;  1V55 B;  2PYL A;  4NB5 A;  4NKG B;  1OHH G;  5KHH A;  1ZSP A;  1YTF D;  1FXK C;  4WF9 V;  4YJ2 B;  1P84 F;  2F4V O;  3OTO B;  4X66 B;  2ZDI C;  1F4N A;  2X7R B;  4BIO A;  4AQY O;  1VF5 B;  5LP6 C;  4DYL A;  4LF6 B;  3A8T A;  3A0H Z;  3K5N A;  1JX9 A;  1YVW A;  3G67 A;  4MW3 A;  4L87 A;  1NZ6 A;  2GTA A;  3WU2 Z;  3RVZ A;  4LFC B;  2A3Q A;  3SGI A;  1SER A;  1O9H A;  1CXZ B;  1GKF A;  2MW2 B;  2Q69 A;  2B1G A;  1UPG A;  3E8G A;  4TWK A;  4DV5 O;  1IBM B;  3B8N A;  5JQG B;  3X2Q B;  1QLE B;  1H2M A;  2DQ3 A;  3C90 A;  4X88 A;  3SYP A;  3ZHS A;  1QVF U;  2B1I A;  3VQX A;  4DV3 O;  3TXQ A;  1T5E A;  2JGD B;  3AG4 C;  3UT5 B;  5JJN B;  2OCC B;  5J9P C;  4QGP A;  4MSW C;  4MVS A;  1IBM O;  1S5H C;  3CS5 A;  1S5L Z;  3E22 B;  4X65 O;  1Q82 W;  1WA8 B;  1QQH A;  3OR7 C;  4I9W A;  4R8C A;  2GUZ A;  3TET A;  4JI0 B;  2BSK A;  3L71 H;  1WP7 A;  1NTK H;  3ZRW B;  4B7K A;  2RQ6 A;  1GN2 A;  4MVO A;  1U97 A;  4GUN A;  4EB6 B;  4H44 B;  2CGN A;  1SS3 A;  3LDC A;  4DUY O;  1LUV A;  2IU3 A;  3OW2 U;  1BHA A;  4CS2 A;  5FLX N;  3K0D A;  1GN4 A;  1ORQ C;  4DR7 B;  2BE3 A;  4DW0 A;  4IYH A;  5K1P A;  3CRQ A;  1F7Y A;  1KB9 F;  2UUC B;  3AG3 C;  2PYJ A;  2YEV B;  2FL4 A;  1RPR A;  1E1R G;  2E5L O;  1I94 B;  3AK1 A;  1SQQ H;  2R9A A;  3CP1 A;  4YHH B;  1G6U A;  4I0X A;  2MK3 A;  2UUA O;  2UU9 B;  2QKS A;  2A9H A;  2CK3 G;  5HFM A;  5IYB O;  4GT1 A;  2CDY A;  1YI2 V;  5B1A C;  4DR2 O;  3ML0 A;  2C2A A;  1O9G A;  2ZR3 A;  4UUJ C;  1K9M W;  5CA1 B;  4DRX A;  4J7J A;  3RT3 C;  4JI5 O;  3HPL C;  4JV5 O;  2QM8 A;  1ZWI C;  2UU9 O;  2Q9L A;  1BGY H;  1A32 A;  2LGQ A;  3JAW B;  2OYQ A;  2QM7 A;  2JEX A;  4LFB B;  3SPJ A;  2P06 A;  4WFA V;  2R72 A;  1TUB A;  3DSQ A;  1N36 B;  4HYO A;  3DC5 A;  3CWB H;  5FPO A;  3B77 A;  3BEH A;  2BTO A;  1N33 B;  5LGT A;  2ETN A;  3GB7 C;  4LCU C;  1DLB A;  1PP9 H;  2P90 A;  2B9Z A;  3ZRV A;  4JYC A;  2UXN A;  3ZCC A;  3A0B Z;  2ADP A;  1ZX3 A;  2DE0 X;  1CP9 A;  2F66 C;  3G6E V;  3QO8 A;  4Z1M G;  1V54 B;  1XNR B;  2FKX A;  1ARO P;  1AI5 A;  2CUG A;  5CBF A;  4MVQ A;  1F23 A;  5LGU A;  3SYA A;  3D8C A;  3UO2 A;  3W7U A;  2L35 A;  1PNM A;  3JAK B;  1SKV A;  5KHI A;  4I4T A;  2JJ1 G;  4DR4 B;  2NNU A;  4DV1 O;  5LHI A;  3QG5 A;  5IYC O;  4QE7 A;  4HNA B;  4O4I B;  3ZHU A;  3L73 H;  1YIT V;  3K58 A;  4JI2 B;  1MG1 A;  1HP8 A;  3OTF A;  1GM7 A;  4UCS A;  5K1X A;  4LFA B;  4X62 O;  4I55 A;  5H5N A;  2D2C B;  4WFE A;  3A2F A;  4DR6 B;  1W2B U;  5EK0 A;  3DXR A;  5FNV B;  4FM0 A;  3F7V C;  2WSS G;  5LP6 B;  2YIB A;  2W6J G;  2QSA A;  3HKC B;  2EJR A;  3FB7 C;  1OCO B;  2KB1 A;  3TCU A;  4K0K B;  3IFX A;  2VQF B;  3CCE V;  1QLN A;  4PEL A;  4LFA O;  2HP8 A;  5EZY A;  1L1F A;  3BRC A;  3Q4H A;  3ETQ A;  2DYS C;  2Y4U A;  2DWE C;  4YXW G;  4J11 A;  4YJ3 B;  1M93 A;  2RN9 A;  3OE7 G;  4X1I B;  4TQD A;  3CEI A;  4LF4 O;  1XNQ O;  3N2K B;  3CYO A;  3OGI B;  2CE4 A;  1I5X A;  2XAG A;  3KCX A;  4WCE V;  1Q8I A;  2VQF O;  3E2E A;  3APO A;  1QQC A;  3ABM C;  4I5S A;  1BT8 A;  1MSW D;  4KL1 A;  1AJN A;  4LNU B;  1MZE A;  1IBL B;  3AG4 B;  3CC7 V;  4X1Y B;  2QWP B;  4Q20 A;  2WLI A;  1OCR B;  1PM9 A;  5H6R A;  4JI7 B;  1XMQ B;  3HKD B;  1Q6U A;  2JS5 A;  2FYU H;  1FYJ A;  4I7Z B;  4MTF A;  5IWA O;  2HVK C;  4OXS A;  1MA1 A;  4JI4 B;  1LUW A;  4B3M O;  4GLX A;  3OD4 A;  3OAA G;  2Q73 A;  1US6 A;  2QR4 A;  3H9V A;  4O2A B;  1WP8 A;  1DGS A;  5L3D A;  4F6R A;  2YIC A;  2FB5 A;  4UB6 Z;  1IZ3 A;  1NVP D;  3W7X A;  2LGW A;  3W7T A;  5KUK A;  5D5Q A;  4TT3 G;  2EIM C;  4X8A A;  4U3J B;  2DYR B;  4PD4 F;  3H01 A;  3HKB A;  2Q68 A;  4WBN A;  1JQ0 A;  3D36 C;  4FIP C;  5IJ9 B;  3H1K H;  5J2U A;  4LWS A;  2Y0P A;  2ITC C;  5DM6 V;  1I08 A;  3AG3 B;  2ILM A;  4JI6 B;  1AJP A;  3IJ4 A;  2KG7 B;  4LH6 A;  3F5W C;  4ZHQ A;  4RWU A;  1NT2 B;  1TVK B;  1HNZ B;  2PY5 A;  4KHP O;  3QO7 A;  4F6E A;  3WG7 C;  2IJK A;  1SQG A;  3FYI B;  1VMG A;  5A9G A;  2ZKO A;  4LF7 B;  1GM9 A;  4R7C A;  1K92 A;  4YJ2 A;  1KBH A;  1XRE A;  4FJC C;  1YSC A;  2EIK B;  1VF6 A;  4J41 A;  3AK3 A;  2Z0A A;  1H2G A;  3L72 H;  4K8X A;  3JAR B;  1FAF A;  2ZM6 B;  1YCI A;  1QHT A;  1D2D A;  2WLL B;  4A5U B;  3HR0 A;  1M57 B;  1SET A;  3RYC A;  1S76 D;  3CD6 V;  5CB4 B;  1N0N A;  1YXB A;  4FLX A;  2P4V A;  1U96 A;  4QPK A;  1S5J A;  2F23 A;  4DK0 A;  2YS8 A;  4I9Q A;  2ZM6 O;  4FPP A;  4X9Q A;  1JOY A;  2UUB O;  2H94 A;  3JD3 A;  5B3S C;  5JQG A;  1WB7 A;  3SJB C;  4YIO A;  3UO3 A;  4P9P A;  4X1K B;  1VP7 A;  4IYI A;  4QPJ A;  5H6Q A;  2A0L A;  3C3T A;  3CB2 A;  5BXZ A;  2JGD A;  1VQ7 V;  1HR0 O;  4GYC B;  1BZK A;  4CH3 A;  2DJV A;  3UT5 A;  3JAT B;  3E8B A;  1R3K C;  5CBG A;  3L74 H;  1Q7Y W;  5C8Y B;  1XQ8 A;  3SPG A;  5EYP B;  2Y4T A;  3E22 A;  2VQE O;  4DV6 O;  4PA9 A;  3WFV A;  1WA8 A;  4B3R O;  1XDC A;  3K57 A;  2P22 C;  4PDV A;  1Q86 W;  1B04 A;  1I0H A;  1AI6 A;  2P7T C;  3ZRW A;  1BL8 A;  3NR7 A;  4B3T O;  1YJN V;  4DR1 O;  4IHJ B;  1K73 W;  2XAF A;  3CCR V;  2A79 B;  3LSU A;  1KP2 A;  5L3B A;  2QWN B;  4B08 A;  3J7A U;  2BCC H;  2YIB D;  1N34 B;  1HNW O;  1IX9 A;  1VEW A;  3T1C A;  2DOS A;  2V1D A;  3H1H H;  5LHG A;  5KMG A;  4RQF A;  5JH7 B;  4ZI7 B;  1OV9 A;  4JI3 O;  4O2B B;  4O4J A;  3B09 A;  1GK9 A;  3THO A;  4JI8 O;  1QCE A;  1XIL A;  2RCV A;  3I5D A;  1BS3 A;  2XAQ A;  2F4V B;  3ABL B;  4GX5 A;  5BMV B;  2DYS B;  4PDR A;  4NYK A;  5KA5 A;  1VQO V;  1M56 C;  4GKJ O;  2ZD9 A;  4JGS A;  4AQY B;  3RYH B;  2ARH A;  2WLN A;  1K7D A;  2YI9 A;  1Y4M A;  3JD1 A;  2DMX A;  3CCL V;  5EBW C;  1SQX H;  3IGA C;  5CA1 A;  2P6J A;  4NVP A;  3CSX A;  2P5O A;  4U3F H;  3K5L A;  2WLH A;  3E8F A;  5LA6 A;  5B66 Z;  2ZNJ A;  3AG1 B;  2FTK A;  1P4R A;  3K06 A;  2YSU B;  4DV5 B;  1WB8 A;  5IYZ B;  1NBM G;  4DO2 A;  3CCM V;  3ICX A;  4UVC A;  1H8H G;  4DV3 B;  4DV0 O;  5GON A;  3N27 A;  2ZE5 A;  1AB3 A;  3FAV B;  1Q43 A;  2YUA A;  2LP7 A;  3BA8 A;  3OUF A;  2JK5 C;  3OM3 B;  3B4S A;  4OPA A;  3L9D A;  2ADQ B;  1ENV A;  4FLV A;  1Y76 B;  4X65 B;  3GVM A;  4MTG A;  2LFS A;  4FLT A;  4CH4 A;  1K5Q A;  1XMO O;  3RW0 A;  2KSD A;  1GO3 F;  3JAK A;  4GKK B;  3ZIA G;  2X0L A;  3U0Z A;  1S3J A;  5GW7 A;  1BSM A;  4JYY A;  1YZB A;  4DV2 O;  4AHC A;  4DR5 O;  3STL C;  1NQT A;  2QA4 V;  3ETG A;  2R70 A;  4DUY B;  2EIL C;  3JD4 A;  1B06 A;  1OCZ B;  1DTO A;  1VF7 A;  1GN3 A;  2WPD G;  5JJJ B;  1SQV H;  1VQ4 V;  5KAF Z;  2XUM A;  2JRI A;  3P3P A;  2D3O W;  4GKK O;  4UCV A;  3FB6 C;  3B40 A;  1VQ5 V;  4QJF B;  3UKM A;  3JSN A;  4UV8 A;  1THZ A;  4KFM A;  2E5L B;  3R65 A;  3CCQ V;  3RN4 A;  5LMU O;  4J9Z B;  1DF4 A;  3HKC A;  1VQN V;  2BOC C;  1JJ2 U;  1GRJ A;  4JI1 O;  3BVO A;  2UUA B;  2CTW A;  1E1Q G;  4D7S A;  3SYC A;  2F43 G;  4E4E A;  4GX1 A;  4JYA O;  3O9O A;  1FS0 G;  4DR2 B;  1AI7 A;  4FLW A;  4UCR A;  2UXB B;  4X1I A;  2EIN C;  4J7K A;  1MMM A;  4IIJ B;  3JAL A;  2JDI G;  1KP3 A;  2P67 A;  1RM1 C;  4JI5 B;  4JV5 B;  2F95 B;  3SYO A;  1LR1 A;  2X6B A;  5E1A C;  4FK5 C;  3OEE G;  4LF8 O;  2YIA A;  3C3S A;  1F51 A;  2X6C A;  5FPR A;  4JPR A;  5GTH Z;  2UXB O;  2Q7G A;  4X1Y A;  4D7T A;  2VS0 A;  3LDD A;  4TV8 B;  4NXN O;  1KYO F;  4BW9 A;  4RQE A;  2ZXW C;  3HKD A;  2H8P C;  3PJS K;  2PF4 E;  1RSO B;  2ZE6 A;  4FLY A;  3SPC A;  3SPH A;  3LDE A;  1KUQ A;  2Q5Z A;  3DGE A;  2JIZ G;  4CBC A;  1URF A;  2Q7H A;  5B1B B;  2WLK A;  5EIB D;  2F93 B;  5CMU A;  4O2A A;  2QTS A;  1BQZ A;  1D5A A;  4GZR B;  4LH7 A;  3SJA C;  1P7G A;  1FFX A;  2K1E A;  4HBN A;  1EM1 A;  2UXX A;  1BHB A;  4WFF A;  5IDJ A;  1L0N H;  2N05 A;  1JPX A;  3ABT A;  1J95 A;  1P49 A;  3CCU V;  1IUR A;  4JTC B;  3ABK B;  4U3J A;  2HLD G;  5IJ9 A;  4DV1 B;  3K79 A;  2HHH O;  1HDJ A;  2ZIM A;  2HJD A;  4CZZ A;  4PA6 A;  2KG7 A;  3QNE A;  2Z3Y A;  1ZL8 B;  5ITZ B;  2LFR A;  1TVK A;  4B3S O;  3A0R A;  4O4L A;  1OCC C;  3ZHT A;  4X62 B;  4XDK A;  1Z5V A;  4UFZ A;  1P7B A;  3RGB A;  3MD0 A;  4J42 A;  2XTA A;  1M56 B;  2NLJ C;  5E79 Z;  3JD0 A;  5CA0 B;  1IBK O;  1FXV A;  2JJ2 G;  3ZX6 A;  2CTR A;  5DED A;  3T1H O;  1BCC H;  4PA7 A;  1FXK B;  1KU9 A;  2PTM A;  1R6T A;  2WLL A;  1WJZ A;  1TAE A;  4O4H A;  1AR4 A;  2EZP A;  5BZB A;  1XBL A;  3JAS A;  1VQ9 V;  4G28 B;  1K97 A;  2F1M A;  2GUZ B;  3RYI B;  2RNB A;  3UCS C;  2BSK B;  3CHX A;  4FM2 A;  3T4Z A;  1NKD A;  4CS3 A;  4LF4 B;  1Y74 B;  1XNQ B;  3EFF K;  4Z2W A;  1MOF A;  5JCO A;  4G2K A;  1DK1 A;  3H1L H;  2X6A A;  5KAI Z;  4D6T H;  3CJH B;  1XI1 A;  1VQM V;  2M7W A;  4FFK A;  1SES A;  2IBZ H;  1VQ6 V;  1AR1 B;  4MVR A;  5LBQ A;  5IJ0 B;  1IVS A;  4E2L A;  4QIW F;  1YF2 A;  2IH1 C;  1H8E G;  1VAR A;  2NR5 A;  3JAT A;  2AHZ A;  1R3I C;  3EXA A;  2HG5 C;  5IWA B;  2Y0I A;  5C8Y A;  1R3J C;  5EYP A;  4MS2 A;  3T1Y O;  4B3M B;  2EUL A;  3AEI A;  5A2Q N;  1IXB A;  2AXT Z;  4BAY A;  2XAH A;  5J2T A;  1V55 C;  3AG7 A;  1EN5 A;  4OGQ B;  4XDL A;  2CH7 A;  1D5N A;  5LMN O;  4DR3 O;  2Y69 C;  1Y67 A;  4RO2 A;  2VRZ A;  1SA0 B;  4RUE A;  4IHJ A;  2IH3 C;  4U7N A;  1L0L H;  2EX3 A;  2YID A;  1VF6 C;  1F4M A;  1KMI Z;  3QVN A;  2P4K A;  2ZIN A;  2HR3 A;  5LYJ A;  1NI8 A;  3K03 A;  4GCZ A;  3F5T A;  3FYE B;  3P30 A;  2OTJ V;  4LF5 B;  4PDM A;  1JFF B;  4BWA A;  3IC7 A;  1K5S A;  1PD3 A;  1NH2 B;  1J5E O;  1I7F A;  1K3E A;  1EFR G;  1JA8 A;  4XDJ A;  1BQ0 A;  4C7U A;  4DK1 A;  4KHP B;  5L3G A;  4ZI7 A;  4NTY A;  1CPY A;  1PNL A;  2G38 A;  3P3N A;  1Q6I A;  5C93 A;  4O2B A;  5BR8 O;  3BFR A;  4PV1 B;  5EC1 C;  4LF5 O;  1QLE C;  4RUF A;  1LNQ A;  2DWD C;  4QNH B;  3CC2 V;  4H0L B;  1EZJ A;  3U11 A;  3JSL A;  2RDC A;  1Y6X A;  2LJ2 A;  1RM1 B;  3OMA B;  4UCU A;  3E35 A;  4K8Z A;  4JAA A;  2CTQ A;  2ZE8 A;  4FM1 A;  5B1A B;  2YXH A;  1G1X B;  2Q67 A;  4DV7 O;  2M6Y A;  2HFE C;  5DN6 G;  1L8D A;  3RWR D;  1GAX A;  3TGU H;  5H9C A;  3VQW A;  2UUB B;  3OMN B;  4LF9 O;  2HKO A;  2ZXW B;  3MDS A;  5IYZ A;  4FLZ A;  4FFB B;  1GTO A;  1SQF A;  4NXM O;  2W0X A;  3RFR A;  1YJW V;  1NH2 D;  1BE3 H;  3WB0 A;  1WPB A;  3K5O A;  2N04 A;  1HR0 B;  3FAV A;  2WA3 A;  2OTL V;  3N2G B;  3L70 H;  2IJH A;  2Y48 A;  1Y76 A;  4TUY B;  4PA4 A;  3CPW U;  2VQE B;  4DV6 B;  4AIL C;  3FX7 A;  3OMI B;  4B3R B;  4IT5 A;  4P2Z A;  3CME V;  3H1I H;  2QEX V;  4J9Y B;  1K4D C;  2V4D A;  3ZRS A;  1CEZ A;  2JS3 A;  4B3T B;  2QTO A;  1VQK V;  3QF7 A;  3Q4H B;  3K0G A;  1S72 V;  4DR1 B;  4BR6 A;  1MAB G;  1ZLZ A;  4W4K A;  5L3F A;  4I50 B;  2UXD O;  1JVM A;  4N23 A;  4QE9 A;  2LW7 A;  3OEH G;  3CCJ V;  2XAS A;  2PI4 A;  1HNW B;  4LC1 A;  4EFE A;  5L3E A;  1G4Y B;  5IT9 N;  3M7M X;  2WWW A;  3TJT A;  1QBZ A;  3LUT B;  2ATK C;  3CX5 F;  1R3L C;  4KP4 A;  4EB6 A;  1WLE A;  2CAZ C;  5B1O A;  3H1J H;  3ZMZ A;  1YTF B;  4JI3 B;  4JI8 B;  1XL4 A;  2NN4 A;  3G4S V;  2JGU A;  3QTC A;  5CA3 A;  3TXS A;  4ZBM A;  1UJW B;  1FXH A;  2YC0 A;  4GKJ B;  3EHB B;  4PI2 A;  2YEV A;  5GTI Z;  4RAI A;  3STZ C;  5CBH A;  2DW4 A;  1K34 A;  2XOK G;  4NTX A;  4YY3 O;  2YI8 A;  4WFB V;  4IIJ A;  4F6R B;  3FD9 A;  3MAQ A;  1QU7 A;  2UXC O;  1R6K A;  2QWR B;  3RBZ A;  1EBO A;  1AR5 A;  3RVY A;  1Q5O A;  1XUQ A;  3CC4 V;  3CXH F;  3HKB B;  4WBN B;  3APQ A;  1NJI W;  4H33 A;  1N32 O;  4R50 A;  4LR3 A;  4LWS B;  5JVD B;  3TK1 A;  4TV8 A;  2YXL A;  1HNX O;  2IM9 A;  1SC5 B;  3ABM B;  3E83 A;  2AHY A;  4DV0 B;  1RSO A;  4JAV A;  5LXT B;  1Z5W A;  3JAW A;  4DV4 B;  5LOV B;  4B7E A;  1R1B A;  1K33 A;  4J7Z A;  1SZX A;  4J10 A;  4G27 B;  1Q3E A;  5KUM A;  4PI0 A;  4TV9 B;  1QVG U;  4OX9 B;  2Y69 B;  2H3O A;  2LW1 A;  3RYF B;  3CXC U;  2V7Q G;  4DUZ O;  5IY5 C;  1KC8 W;  3VOU A;  4X64 O;  4DV4 O;  1XMO B;  1N8R W;  1N0J A;  2GHY A;  4ZOL B;  3LSS A;  1OCO C;  1SF9 A;  1ZUQ A;  4ZIB A;  3RYC B;  3PN1 A;  1S0V A;  4OX9 O;  2E76 B;  4NR1 A;  4DV2 B;  4DR5 B;  3CCS V;  3OTO O;  4X66 O;  1VQP V;  3ABU A;  2EIM B;  1K8A W;  5IE9 A;  1B6Q A;  1XEQ A;  1ZL8 A;  4LF6 O;  5ITZ A;  2HVJ C;  4Z1V A;  3T2M A;  3HKE B;  1IXM A;  3L75 H;  4UVA A;  1W0K G;  4LFC O;  4BW5 A;  2GSM B;  2Q4P A;  3ZRX A;  4OPH A;  3WB2 A;  5LMU B;  5CA0 A;  5B5E Z;  4HNA A;  4O4I A;  4ABM A;  4DW1 A;  3WG7 B;  4JI1 B;  1OCR C;  4EKW A;  1H2S B;  5KX5 B;  3G80 A;  2W0F C;  2XT9 A;  1FXK A;  2QKA A;  1QR9 A;  1SQB H;  3CRA A;  4UXN A;  4IL6 Z;  4JYA B;  3ZN0 A;  2ZDI A;  1FKA O;  1RPO A;  5FNV A;  1H38 A;  3RYI A;  5LP6 A;  1KD1 W;  3NXS A;  2OIG A;  4BIZ A;  1Y74 A;  1M90 W;  3K59 A;  1MZF A;  4H13 B;  4JZG A;  1JJO A;  3T4D A;  1X59 A;  3CJH A;  2DQ0 A;  1ROP A;  2ZCE A;  4LF8 B;  2PGG A;  1SZT A;  1I5Y A;  1YDX A;  5B1N A;  1KKD A;  2DYR C;  4YJ3 A;  4JI0 O;  3ASO C;  4UCO A;  4NXN B;  1W59 A;  4CH6 A;  5IJ0 A;  3N2K A;  3OR6 C;  3AG2 C;  2BTQ B;  4FLU A;  2KQX A;  3D3Q A;  4ICG A;  5KMG B;  5B3S B;  3IAY A;  4TSF G;  1YJ9 V;  4EFB A;  3VBB A;  1KKC A;  4FZ0 A;  1COW G;  4MVZ A;  5KLV H;  4UB8 Z;  4FMT A;  4EEQ A;  3OUS A;  4J80 A;  5AG2 A;  4LNU A;  4ZKI A;  4O4J B;  3BA9 A;  4X20 B;  3SJC C;  3FB8 C;  2ZIO A;  4DR7 O;  2HJF C;  5JWP A;  2WAM A;  1WN7 A;  2B5U A;  1PL4 A;  3AK2 A;  3SDL A;  3JYC A;  2UUC O;  1EZV H;  3LNN A;  3BY6 A;  5H2F Z;  1ZTE A;  1SA0 A;  1M5I A;  2ODM A;  2EIK C;  1YIJ V;  1GMG A;  1QR8 A;  1I94 O;  1BMF G;  4WFH A;  1FJG B;  2OCH A;  2OIE A;  4JTA B;  2VWK A;  4YHH O;  1YHQ V;  2Q0O C;  3SJQ C;  1M57 C;  2HHH B;  1Q90 D;  5LA6 B;  2WLJ A;  1JFF A;  1K4C C;  2Q7E A;  1NR7 A;  4UVB A;  3ZHV A;  3KZI Z;  2CGO A;  3ASN C;  2ZE7 A;  4B3S B;  5JCO C;  3ZMU A;  4NTW A;  1FJG O;  3W7W A;  1XHX A;  4GX2 A;  2IW5 A;  2DN9 A;  3UM7 A;  3BAB A;  5KA6 A;  2GTS A;  3BPZ A;  2LO1 A;  4AI8 A;  5GON B;  3ZED A;  1IBK B;  2K9P A;  1YEW A;  3KCY A;  4LFB O;  1G8M A;  2EZO A;  4FVM A;  1N36 O;  4K3A A;  3T1H B;  1JMK C;  5EBM C;  1XL6 A;  1N33 O;  2EBO A;  3BCC H;  1Y66 A;  4FZ1 A;  4LBE C;  1OZ0 A;  4TQF A;  3WB1 A;  1NTZ H;  1X4T A;  4MTO A;  1FD9 A;  5JJE B;  2RJZ A;  1OJH A;  2LQT A;  3FB5 C;  3ETD A;  1TGO A;  3KKY A;  1VIB A;  3JAR A;  3ZN1 A;  3ETE A;  2N74 A;  3CE2 A;  2AZ2 A;  2EJ7 A;  1XNR O;  1PKX A;  3CCV V;  1AIL A;  1SQP H;  5CB4 A;  3OGC C;  1M9N A;  1AI4 A;  2JVD A;  4FFB A;  1M4U A;  3BAA A;  4PHZ A;  3ZMT A;  4DXW A;  2E3C A;  3N2G A;  2PI5 A;  4DR4 O;  4CC5 A;  1VQ8 V;  1EN6 A;  3M99 B;  3T1Y B;  4P9O A;  5IY5 B;  3UQ8 A;  4TUY A;  2YDE A;  4TOI A;  4X1K A;  4JF3 A;  2EIJ C;  3K5M A;  3O65 A;  2GV9 A;  3EVK A;  4JI2 O;  1S77 D;  2QWQ B;  3U10 A;  2OWO A;  1NVP B;  1W0J G;  1NU1 H;  1R73 A;  4DR3 B;  5LMN B;  2L6L A;  3LSQ A;  3VQY A;  5BY1 A;  3DC6 A;  1QNM A;  2QKC A;  2RMK B;  2ZT9 B;  4JAS A;  3ABL C;  2YXY A;  1HWY A;  3W7S A;  2Z5U A;  4DR6 O;  4I50 A;  1AJQ A;  1MSD A;  3F7Y C;  4MT8 A;  3JAL B;  3M8A A;  4BIU A;  4I0X B;  4K0K O;  5CN0 A;  3E89 A;  2HEP A;  3E86 A;  5F2V O;  1J5E B;  2AW9 A;  2EIL B;  3AG1 C;  4CS4 A;  3ZBH A;  2ZQM A;  1NTM H;  2Q6A A;  3CRC A;  4DRX B;  1R6N A;  5BR8 B;  2XAJ A;  4XBF A;  2GDS A;  2QDO A;  3E8H A;  3G71 V;  5TIS Z;  5EC2 C;  3OT7 A;  3G6B A;  1TUB B;  5KHJ A;  1XHZ A;  1IBL O;  3IC9 A;  1WPX A;  1AP6 A;  5JH7 A;  4KUM A;  3R66 A;  1FPO A;  4JI7 O;  1XMQ O;  4PJ0 Z;  4LP8 A;  1WAZ A;  1FFX B;  3X2Q C;  5LHH A;  1E79 G;  2FML A;  2JEU A;  1KEC A;  3FKS G;  5BMV A;  2ZR2 A;  2PZS A;  4JI4 O;  4DV7 B;  3SR2 C;  4X89 A;  3ZJZ A;  1Q81 W;  3B2E E;  3RYH A;  3ASO B;  3CRR A;  4WFG A;  2EIN B;  3S3W A;  2OCC C;  3D3I A;  5EBL C;  1IDS A;  3K3W A;  3AG2 B;  2W6I G;  4LF9 B;  5JVD A;  4W4L A;  2O57 A;  1RP3 B;  3KG2 A;  1VQL V;  4NXM B;  5LL6 Y;  1SRY A;  4F4L A;  5LXT A;  1DF5 A;  2IJJ A;  1OCZ C;  4O4L B;  4UCT A;  5LOV A;  3JD2 A;  1MNG A;  2AGA A;  2CTP A;  4I4T B;  4CH5 A;  1GH6 A;  4JAU A;  4TV9 A; 
#chains in the Genus database with same CATH homology
 2BOB C;  4UV9 A;  5EK0 A;  3TK1 A;  1W2B U;  4R6Z A;  4HZ3 A;  3F7V C;  2EIN C;  2WSS G;  2W6J G;  2EJR A;  2JDI G;  3ABM B;  1KP3 A;  2P67 A;  3FB7 C;  3E83 A;  2AHY A;  1OCO B;  2KB1 A;  1RM1 C;  3TCU A;  4PA3 A;  3GWO A;  3IFX A;  4JAV A;  3SYO A;  1TUE B;  2X6B A;  3CCE V;  4JTD B;  1QLN A;  3K08 A;  4PEL A;  5E1A C;  4FK5 C;  1L1F A;  3OEE G;  1F51 A;  2X6C A;  2DYS C;  1K33 A;  4JPR A;  4G27 B;  1JCH A;  2DWE C;  4MVU A;  5KUM A;  4YXW G;  1QVG U;  3K9A A;  2Y69 B;  2IJI A;  3CXC U;  3OE7 G;  3LDD A;  2V7Q G;  3ASN B;  3CYO A;  4RQE A;  2ZXW C;  5IY5 C;  1GM8 A;  2H8P C;  3OFN G;  1KC8 W;  3PJS K;  1I5X A;  2XAG A;  4WCE V;  3MHS C;  3E2E A;  3VOU A;  3SPC A;  3SPH A;  3LDE A;  4N21 A;  3ABM C;  3D36 A;  4I5S A;  1N8R W;  2GHY A;  3DGE A;  3LSS A;  1OCO C;  2JIZ G;  4CBC A;  1MSW D;  5B1B B;  1AJN A;  1S0V A;  2WLK A;  5CMU A;  3AG4 B;  3MHH C;  3CC7 V;  2R9I A;  3CCS V;  4Q20 A;  3DTU B;  2WLI A;  1OCR B;  5H6R A;  3ABU A;  1VQP V;  2EIM B;  1K8A W;  4MTX A;  2K1E A;  3ZMV A;  1BHB A;  2UXX A;  4WFF A;  1B6Q A;  5IDJ A;  3SPI A;  1OCC B;  4HAM A;  1JPX A;  3ABT A;  4MTF A;  1J95 A;  3CCU V;  2HVK C;  4OXS A;  4H37 A;  4JTC B;  3ABK B;  2HVJ C;  3OAA G;  3ZMS A;  3T2M A;  1IXM A;  4MW8 A;  4UVA A;  1W0K G;  5HFL A;  3HB3 B;  2HLD G;  4ASU G;  4BW5 A;  4U7O A;  2GSM B;  2WLI B;  3K79 A;  5B1B C;  2R9R B;  3ZRX A;  2QE7 G;  2XND G;  5L3D A;  4CZZ A;  2OT5 A;  4GX0 A;  4PA6 A;  3LNM B;  1NVP D;  3QNE A;  5L3C A;  3W7X A;  1NR1 A;  3WG7 B;  3W7T A;  1OCR C;  4PDL A;  4EKW A;  5KUK A;  2Z3Y A;  4TT3 G;  2EIM C;  2LFR A;  4X8A A;  2DYR B;  2W0F C;  1FXK A;  3H01 A;  1QR9 A;  3A0R A;  3I56 V;  1OCC C;  2Q68 A;  1JQ0 A;  4UXN A;  4XDK A;  3ABK C;  4FIP C;  3ZN0 A;  1P7B A;  2ZDI A;  3MD0 A;  1RPO A;  3QO5 A;  5LGN A;  2ITC C;  1M56 B;  2NLJ C;  1H38 A;  5DM6 V;  3B8M A;  3JD0 A;  3AG3 B;  1FXV A;  2IU0 A;  1AJP A;  2ITD C;  1KD1 W;  2JJ2 G;  3NXS A;  3P32 A;  1V54 C;  3F5W C;  3K04 A;  4BIZ A;  1M90 W;  1FFT B;  3SYQ A;  1PL0 A;  2WLM A;  1M1K W;  4MVM A;  3T4D A;  4P30 A;  4PA7 A;  1FXK B;  2DQ0 A;  1ROP A;  3QO7 A;  2EIJ B;  3WG7 C;  2IJK A;  3FYI B;  2WLL A;  4JYB A;  1SZT A;  1I5Y A;  2EZP A;  5BZB A;  5B1N A;  1KQS U;  5IYD O;  1KKD A;  2DYR C;  1GM9 A;  1VQ9 V;  4G28 B;  1K97 A;  4R7C A;  3I55 V;  3ASO C;  1K92 A;  4FJC C;  3T4Z A;  1NKD A;  1YSC A;  2EIK B;  3OR6 C;  3AG2 C;  3EFF K;  1MOF A;  5B3S B;  4G2K A;  4TSF G;  2X6A A;  1H2G A;  1YJ9 V;  5FL7 G;  3CMA V;  3VBB A;  1PNK A;  1VQM V;  1COW G;  4MVZ A;  3JCZ A;  2WLL B;  1V55 B;  2M7W A;  1M57 B;  4FMT A;  3OUS A;  1SET A;  1S76 D;  1OHH G;  3CD6 V;  4ZKI A;  1SES A;  1YTF D;  1FXK C;  4WF9 V;  3FB8 C;  4QPK A;  1VQ6 V;  1AR1 B;  2HJF C;  4MVR A;  5LBQ A;  2WAM A;  4E2L A;  4QIW F;  2B5U A;  2IH1 C;  2ZDI C;  1F4N A;  1H8E G;  2X7R B;  3JYC A;  2AHZ A;  1R3I C;  3BY6 A;  4FPP A;  2HG5 C;  1JOY A;  2EIK C;  2H94 A;  1R3J C;  3JD3 A;  4MS2 A;  1YIJ V;  1JX9 A;  5B3S C;  1GMG A;  3AEI A;  1QR8 A;  1BMF G;  4P9P A;  4MW3 A;  4WFH A;  4L87 A;  4JTA B;  4QPJ A;  5H6Q A;  4BAY A;  2XAH A;  1YHQ V;  3RVZ A;  1V55 C;  2A0L A;  3SJQ C;  1M57 C;  1SER A;  4XDL A;  2WLJ A;  1VQ7 V;  1GKF A;  1K4C C;  2Y69 C;  2Q69 A;  2B1G A;  4RO2 A;  1NR7 A;  4UVB A;  3E8G A;  3E8B A;  1R3K C;  5CBG A;  4TWK A;  1Q7Y W;  4RUE A;  2IH3 C;  4U7N A;  3ASN C;  3SPG A;  1F4M A;  3B8N A;  3X2Q B;  3ZMU A;  1QLE B;  2DQ3 A;  4X88 A;  2HR3 A;  4PA9 A;  3W7W A;  3SYP A;  4GX2 A;  3WFV A;  2IW5 A;  1QVF U;  3UM7 A;  3K03 A;  4GCZ A;  2B1I A;  3FYE B;  5KA6 A;  3P30 A;  4PDV A;  2OTJ V;  4PDM A;  1Q86 W;  3IC7 A;  3AG4 C;  1AI6 A;  2P7T C;  3ZRW A;  1BL8 A;  1K5S A;  1PD3 A;  2OCC B;  5J9P C;  1NH2 B;  1G8M A;  2EZO A;  1YJN V;  4MSW C;  4MVS A;  1K3E A;  1S5H C;  1EFR G;  4XDJ A;  1K73 W;  2XAF A;  3CCR V;  2A79 B;  5L3G A;  1KP2 A;  5L3B A;  5EBM C;  1CPY A;  1PNL A;  1XL6 A;  1Q82 W;  2EBO A;  5C93 A;  1QQH A;  5EC1 C;  1Y66 A;  4LBE C;  1QLE C;  3OR7 C;  4I9W A;  4R8C A;  4RUF A;  3TET A;  1OZ0 A;  1LNQ A;  3T1C A;  4MTO A;  2DWD C;  4QNH B;  3ZRW B;  2V1D A;  3CC2 V;  5LHG A;  3FB5 C;  3ETD A;  4MVO A;  1EZJ A;  3ZN1 A;  4RQF A;  3ETE A;  3LDC A;  1RM1 B;  1PKX A;  3CCV V;  3OMA B;  3OGC C;  1M9N A;  2IU3 A;  1AI4 A;  3OW2 U;  1BHA A;  3E35 A;  1GK9 A;  1QCE A;  3K0D A;  1ORQ C;  2XAQ A;  5B1A B;  3ABL B;  4GX5 A;  2DYS B;  4PDR A;  2Q67 A;  5KA5 A;  1VQO V;  2HFE C;  1M56 C;  2ZD9 A;  4JGS A;  3ZMT A;  4DXW A;  3AG3 C;  5DN6 G;  2PI5 A;  2YEV B;  2WLN A;  1VQ8 V;  5H9C A;  3OMN B;  3M99 B;  2HKO A;  2ZXW B;  4P9O A;  1RPR A;  1K7D A;  1E1R G;  5IY5 B;  1Y4M A;  3JD1 A;  3CCL V;  5EBW C;  3IGA C;  4JF3 A;  3CP1 A;  2P6J A;  2EIJ C;  1GTO A;  1S77 D;  2MK3 A;  2WLH A;  3E8F A;  1YJW V;  1NH2 D;  2QKS A;  1NVP B;  1W0J G;  2A9H A;  2CK3 G;  1R73 A;  5IYB O;  4GT1 A;  5HFM A;  3AG1 B;  3LSQ A;  2OTL V;  2FTK A;  1P4R A;  4JAS A;  1YI2 V;  5B1A C;  3ABL C;  2IJH A;  3ML0 A;  1HWY A;  3K06 A;  2Y48 A;  2C2A A;  2YSU B;  2ZR3 A;  2Z5U A;  4UUJ C;  3W7S A;  1NBM G;  4DO2 A;  3CCM V;  1AJQ A;  4PA4 A;  3CPW U;  1K9M W;  3F7Y C;  4MT8 A;  3OMI B;  4BIU A;  4P2Z A;  4UVC A;  1H8H G;  3CME V;  3HPL C;  2QM8 A;  1ZWI C;  2QEX V;  5CN0 A;  4J9Y B;  3E89 A;  1K4D C;  3ZRS A;  1CEZ A;  2QM7 A;  2JEX A;  2QTO A;  3SPJ A;  3E86 A;  1VQK V;  3K0G A;  2LP7 A;  1S72 V;  4WFA V;  2JK5 C;  1MAB G;  2EIL B;  3OM3 B;  3OUF A;  4HYO A;  3AG1 C;  5L3F A;  1ENV A;  1JVM A;  4N23 A;  3B77 A;  4QE9 A;  2ZQM A;  3BEH A;  2Q6A A;  5LGT A;  4MTG A;  1R6N A;  3OEH G;  2XAJ A;  3GB7 C;  3CCJ V;  2LFS A;  2XAS A;  4XBF A;  4LCU C;  2PI4 A;  1DLB A;  4LC1 A;  3E8H A;  2P90 A;  3ZRV A;  1K5Q A;  4JYC A;  5L3E A;  1G4Y B;  3RW0 A;  3G71 V;  2UXN A;  5EC2 C;  3ZCC A;  1GO3 F;  2WWW A;  1CP9 A;  1QBZ A;  3LUT B;  3ZIA G;  2X0L A;  2ATK C;  1R3L C;  1S3J A;  4KP4 A;  1WLE A;  5GW7 A;  5B1O A;  1WPX A;  3G6E V;  3STL C;  3QO8 A;  4KUM A;  1V54 B;  4Z1M G;  1NQT A;  2QA4 V;  3ETG A;  1ARO P;  1AI5 A;  3ZMZ A;  1YTF B;  2EIL C;  4LP8 A;  3JD4 A;  3X2Q C;  5CBF A;  4MVQ A;  5LHH A;  1E79 G;  1OCZ B;  1XL4 A;  1F23 A;  5LGU A;  2JEU A;  1DTO A;  1KEC A;  3FKS G;  3SYA A;  1VQ4 V;  2WPD G;  3G4S V;  3W7U A;  5CA3 A;  2ZR2 A;  2D3O W;  4ZBM A;  1PNM A;  1UJW B;  3FB6 C;  1FXH A;  4X89 A;  3ZJZ A;  1Q81 W;  3ASO B;  3EHB B;  4WFG A;  2EIN B;  2YEV A;  2JJ1 G;  2NNU A;  1VQ5 V;  2OCC C;  3D3I A;  4RAI A;  3UKM A;  4QJF B;  5EBL C;  5LHI A;  4UV8 A;  1THZ A;  3K3W A;  3AG2 B;  2W6I G;  3STZ C;  5CBH A;  2DW4 A;  4QE7 A;  1K34 A;  2XOK G;  4KFM A;  3R65 A;  3CCQ V;  4J9Z B;  4WFB V;  1DF4 A;  1VQN V;  2BOC C;  1JJ2 U;  5IYC O;  1YIT V;  3KG2 A;  1VQL V;  1SRY A;  4F4L A;  1MG1 A;  1R6K A;  3RBZ A;  1GM7 A;  1EBO A;  1DF5 A;  3RVY A;  1E1Q G;  2IJJ A;  1OCZ C;  3SYC A;  2F43 G;  3CC4 V;  3JD2 A;  4GX1 A;  1NJI W;  4H33 A;  1FS0 G;  1AI7 A;  4JAU A;  4R50 A;  4WFE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...