1TUEB

The x-ray structure of the papillomavirus helicase in complex with its molecular matchmaker e2
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
194
structure length
194
Chain Sequence
HMQTPKETLSERLSALQDKIIDHYENDSKDIDSQIQYWQLIRWENAIFFAAREHGIQTLNHQVVPAYNISKSKAHKAIELQMALQGLAQSAYKTEDWTLQDTCEELWNTEPTHCFKKGGQTVQVYFDGNKDNCMTYVAWDSVYYMTDAGTWDKTATCVSHRGLYYVKEGYNTFYIEFKSECEKYGNTGTWEVHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Replication
molecule keywords Replication protein E1
publication title The X-ray structure of the papillomavirus helicase in complex with its molecular matchmaker E2
pubmed doi rcsb
source organism Human papillomavirus type 18
total genus 62
structure length 194
sequence length 194
chains with identical sequence E, G, J, L, Q
ec nomenclature
pdb deposition date 2004-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00508 PPV_E2_N E2 (early) protein, N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.30 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1tueB01
2.170.200.10 Mainly Beta Beta Complex Regulatory Protein E2; Chain: A; Domain 2 Regulatory Protein E2; Chain: A; Domain 2 1tueB02
1QQHA 2NNUA 1R6KA 1R6NA 1TUEB 2JEXA 2JEUA 1DTOA
chains in the Genus database with same CATH superfamily
4LFAB 3HKEB 3IFXA 2EIJC 3CXCU 1JPXA 3QG5A 5IDJA 5GW7A 1SA0B 4WFGA 1B3QA 1J5EB 1XMQB 1IZ3A 1G6UA 4JI3B 2DE0X 3CP1A 2W6IG 4JI7O 5B1OA 1NVPD 3LNMB 4J9ZB 1XNQO 3A0RA 3AK2A 2XAFA 4B3TO 1EN4A 4F6EA 1T5EA 4KUMA 2YEVB 4O4HA 2PF4E 1RP3B 3JAMN 4UCTA 3APOA 1BGYH 5FLXN 4BIZA 5L3FA 1NTKH 3U10A 3AG1B 4DR2O 2Q67A 5EBWC 4DK1A 2KG7A 1Q7YW 1S0VA 5LP6A 1X4TA 1GO3F 4K3AA 3EHBB 1K8AW 5DM6V 4IYIA 2F4VO 3CMEV 4KL1A 1LUWA 1U96A 1EZJA 1JCHA 4F6RB 4NXNB 5B66Z 3B8NA 1FXVA 3FKSG 4XDKA 5L3BA 1N34O 1PP9H 1Y66A 3EVKA 2JS3A 2WAMA 3GVMA 3T1CA 3AEIA 4NTYA 1QHTA 2NN4A 2NR5A 3MD0A 3IGAC 2A7WA 3JAWA 3OR6C 5IY5B 2UXCO 1YZBA 3FB6C 3H1LH 5H6QA 4KFMA 1XNRB 3SPJA 3QNEA 4ZI7B 3BY6A 1R3JC 4DV4B 3KKYA 1N36B 2PYLA 3JYCA 2CGOA 3BVOA 3N2GB 1M56C 3ABLC 4ZOLA 3B09A 4DV2O 5KHJA 4X65O 2VQFO 1U97A 1Q43A 1QR8A 2OTLV 2DQ0A 3RVZA 4FFBA 3RWRD 2PTMA 1OZ0A 1NTMH 3WB2A 1HR0O 1VMGA 5CA3A 3IC9A 4DW1A 5E1AC 1AR5A 1EM1A 2VWKA 3LSUA 1NZ6A 3VBBA 4LFAO 1KMIZ 1R1BA 1SQXH 1KKCA 5HFMA 3W7XA 1K4DC 2E3CA 1XMQO 5IT9N 5B1NA 3N2KB 4QJFB 5BR8B 2FTKA 2CTPA 4JI3O 4LWSB 1S5JA 4TOIA 1O9GA 2HP8A 3OFNG 3STZC 5BY1A 2CDYA 1W2BU 2KSDA 2AW9A 4J10A 4ABMA 2WLLB 2QM7A 3LUTB 3DGEA 4O4LA 1PNMA 4WFAV 1GM9A 3W7WA 1QLNA 2YDEA 2EZOA 1GAXA 1MABG 5LXTA 3MDSA 2CK3G 5JQGA 1M57C 4YJ3B 2EILC 1FFXB 4I4TB 1VQNV 5EYPB 4FLYA 4MVUA 2BTQB 1LR1A 2VRZA 3PJSK 2YIDA 1Y74B 1JFFA 5EZYA 2B5UA 4JZ2A 2M7WA 3K0DA 1G8MA 5C8YA 2ZE6A 3K08A 1TUBA 1Y76B 4X88A 4JI5B 5FPOA 3OM3B 2QM4A 1AR4A 3OE7G 2EIMB 3JD1A 5IE9A 2EBOA 5IYZB 1D5AA 4DRXB 1GN2A 5GONA 4YIOA 5FNVA 1KP3A 2YXLA 4ZHQB 1OCRC 4MTOA 1FD9A 3FYEB 1V55B 5BMVB 4IHJB 1PD3A 4U7OA 3RYCB 4LFBB 5KHHA 3ABMC 3K03A 4LR3A 1N36O 3JD4A 3CXHF 1RM1C 3UT5A 3ZRVA 1DF5A 3AG3B 5LYJB 2XAJA 1PV0A 2EINB 4DR7O 1HP8A 2RMKB 3APQA 3RYHB 3STLC 5KX5A 1IBMB 1XBLA 3JCZA 4DUZB 4JYCA 4LF7O 2QWNB 3ZS8C 1YSCA 1HNWO 5J2TB 5LOVA 2PI5A 4ZBMA 2Q0OC 2WLNA 2ZQMA 1Q90D 2F95B 4HNAA 2NNUA 5AG2A 2ZDIA 4AQYB 3J81N 2QTSA 1KYOF 3TETA 5BR8O 1FXHA 3LDDA 4FLXA 2ZNIA 3JALA 4LF9O 1XL4A 3SYOA 2LP7A 3SR2C 3J7AU 1KECA 1WAZA 3T1HB 2JGDB 4MVQA 2LFSA 3JAKB 5IWAO 2UXNA 5F2VO 1DK1A 1BHBA 4MTFA 1OCOB 3ETQA 3GB7C 4BW5A 4CH4A 3A0HZ 4O2BB 4L8JA 4BR6A 2Q73A 3K57A 4JI4B 1SKVA 3G6EV 1L0NH 1VQ9V 4WBNA 3ABKC 3LSQA 4TUYA 2LGQA 1WPBA 3JCUZ 1IBKO 4B3RB 2QTOA 2HG5C 4DR5O 2B1GA 4UXNA 4FZ0A 2UXBB 3FFQA 1S76D 2OYQA 4UCRA 2BOCC 4GCZA 3D8CA 3SYAA 5JH7B 2X0LA 4GKKB 3H01A 2FB5A 2P6JA 2Y4TA 3OTOB 1BZKA 4I50B 1AI7A 2DWEC 3DSQA 2XT9A 4XDLA 2IJJA 3AK3A 3UCSC 3L72H 3ZRWB 1XILA 4J7KA 3G71V 2GBOA 1A32A 5J2UB 2MK3A 2ZM6B 1M1KW 1ZX3A 4LCUC 3FAVA 1VQ6V 4LFBO 5LMNB 4B3SO 3K06A 2QSAA 3C90A 4LF6B 4FLUA 1Y6XA 3JD3A 4G27B 2JDIG 1W0JG 1TGOA 3K9AA 4X1KA 3HKDA 3HKCB 4I5SA 2P67A 3BHPA 1OCZB 3SYQA 3RYFB 1P49A 2RNBA 2ZDIC 1ZTEA 3U11A 1JJ2U 3LDEA 4IGGA 4LF4O 3A8TA 4DUZO 3HB3B 5KAFZ 3ASNB 5BXZA 3ZHUA 3E8FA 2QWPB 3F5WC 5H6RA 1PKXA 4GKJO 4AQYO 2R9IA 1AP5A 1TVKB 3JARB 4PDRA 4PA6A 4TT3G 1XEQA 2QKAA 3BRCA 2BCCH 4EB6A 5JJNB 1SC5B 4LF8B 4K0KB 5EC2C 5EIBD 4NXMB 1VQ4V 3BPZA 4CC5A 2YICA 4X1IB 3CCEV 4N21A 1AJPA 4J42A 2KQXA 2EJ7A 4JI8B 1JOYA 1BQZA 4B3RO 3SPIA 4X1YB 4QE9A 5K1XA 2UXBO 1GN6A 2CH7A 3ZHQA 4UCVA 2Y48A 5CA0A 4DXWA 5IJ0B 1G4YB 3ASOB 3MHSC 1N0NA 4GKKO 3E8BA 5EBLC 4DV7B 1TA8A 2KKWA 1K97A 4FLTA 3SYPA 3KZIZ 4AILC 5CB4A 1M56B 1QBZA 3P30A 3TXQA 4C7UA 1Z5VA 1FAFA 3ZN1A 4DR1B 5L3CA 4R7CA 3H1KH 4BW9A 1H8EG 4Q20A 5IYBO 5KHKA 2Q8VA 4W4LA 1MSDA 4RQEA 3OMIB 4OPAA 3VQYA 2F43G 1B6QA 3BFRA 4LF6O 1SESA 1K4CC 1S3JA 3E86A 4B3MB 1SZXA 1SRYA 4D7SA 1IDSA 2HKOA 2K1EA 3CJHB 5L3EA 3VQXA 4DV0B 3OGIB 3F5TA 3E35A 1N0JA 1NS1A 2Q4PA 1AI5A 2YXHA 1VF5B 4K35A 3DXRA 2KG7B 5LA6A 4U3JA 1YCIA 2XAQA 1QVFU 4MVSA 3ZMZA 2AHZA 3JASB 2JGUA 4UB8Z 4DV5O 1M57B 2KB1A 1WA8A 2OCHA 3Q4HA 2B1IA 3SPCA 1FXKA 4JASA 5LHHA 2BSKB 4YY3O 3KCXA 3CRAA 3JAWB 1JMKC 5CA1A 5TISZ 1W0KG 1NI8A 4U7NA 3THOA 3G6BA 1HDJA 1NR7A 2EX3A 4JI8O 3FYIB 4P9PA 1NH2B 3FD9A 1XL6A 3E8HA 2YXYA 2RQ6A 4ZOLB 1QNMA 2BE3A 1HNXB 4ASUG 5CBFA 4WCEV 5IYCO 1I5YA 1JVMA 2QWRB 4FFBB 3CCQV 4CS2A 4UFZA 1BCCH 4YJ2A 5IJ9A 2UUAB 3ABMB 1H2KA 2ZE8A 3CCUV 1RM1B 1LNQA 5H5NA 5JCOA 3ABUA 3H9VA 4EEQA 1Y4MA 3K59A 4UVCA 5JJJB 2JEXA 3X2QC 3ZEDA 4BIUA 3CEIA 4DR1O 4D6TH 4LNUB 1RSOB 1IBLO 5E79Z 2JIZG 1AILA 1ZLZA 3AG4C 3T4DA 1OCCC 2MW2B 2WLIB 2UUCO 2BOBC 2WA3A 4TV8B 3HKEA 1VF7A 3TJTA 1V9PA 3CC2V 2H94A 4EFEA 1SA0A 5DEDA 3C3TA 4RUEA 4JI2B 1S72V 2YI8A 1YI2V 5CBHA 4UVBA 2GV9A 4JF3A 5EBMC 1VEWA 3RGBA 2OCCC 4JAUA 4QIWF 4NTXA 1KC8W 1K5QA 3BAAA 2QE7G 3VQWA 4G2KA 3KG2A 2FYUH 3WG7C 1D5NA 1FXKC 2A79B 4GX2A 3ETEA 3L71H 1Y67A 4UCSA 4CH6A 5GTIZ 1P7GA 2ARHA 2E74B 3OEEG 3L70H 3A0BZ 5L3GA 1YITV 2O57A 2UUBB 2N04A 5LHGA 1F51A 1SQQH 3CE2A 5B3SB 3CRRA 3ZMSA 3ABKB 3R66A 2PI4A 2HLDG 2E5LB 1J5EO 2VS0A 1VF6A 1K9MW 5LL6Y 2YC0A 4X20B 4F6RA 3D3IA 1THZA 2DYSC 5ITZB 5LP6C 2ADQB 4CS3A 1WN7A 5B1AB 4X66B 2P06A 2UXDB 5FPRA 3HKBA 3ETDA 4DR4B 1JJOA 2WLJA 3F7VC 2ZIMA 4UUJC 1BS3A 1UJWB 4DV1B 3E89A 4JYBA 2OWOA 2OTJV 2WPDG 4JI1B 2F1MA 1PPJH 4ZI7A 2ETNA 2R70A 3K5OA 4PI2A 3ZX6A 3CX5F 4JYAB 2UUAO 4R8CA 4JV5B 1YTFD 2LQTA 2XAHA 2EZPA 4NXNO 1BL8A 1SQGA 1XQ8A 4Z1MG 1I0HA 2K9PA 5A2QN 3B4SA 3FB5C 4H37A 1PNKA 3JALB 4FMTA 5KMGA 1K73W 2P5OA 1HNZB 3UKMA 2A9HA 1CPYA 3JD0A 5KLVH 1XNRO 3ZRXA 1QQHA 4J11A 2ILMA 4OPHA 4PDMA 4WFFA 3N2KA 3SDLA 3H1HH 3OUFA 4LWSA 4DV4O 1Q6UA 4R50A 4RAIA 3S3WA 2Y0PA 3ZHVA 1QQCA 4K8ZA 2QM8A 4WBNB 4UVAA 3CD6V 2WLLA 3CCJV 2N05A 4TUYB 4H44B 4O4JB 4MTGA 2A0LA 2ZD9A 3I55V 3A2FA 1IXBA 1VF6C 5KA5A 1S5LZ 2HR3A 3RBZA 1AI4A 1ENVA 4YJ3A 2Q5ZA 3CC4V 4F4LA 1FFXA 2E76B 4JTAB 4I4TA 4LFCB 2JEUA 1XMOB 2R9RB 5JVDB 5EYPA 3ZBHA 4PA7A 1GKFA 4IIJB 3B77A 1M9NA 1ZWIC 2LW1A 1Y74A 4MS2A 4I7ZB 5LGUA 3E22A 3L73H 4KP4A 3QF7A 2DYRB 1Q81W 1MOFA 2ZR3A 3T4ZA 5IY5C 4LP8A 3O9OA 1V54B 1BT8A 1Y76A 5H2FZ 1IXMA 4YHHB 1NVPB 2UXDO 1VP7A 1XI1A 3J80N 4DR4O 1GM7A 5IYZA 5LBQA 4DRXA 1N32B 4DV1O 1EZVH 5LGTA 2A06H 2Y69C 2V4DA 1VIBA 4JI1O 3VQVA 1M90W 4CZZA 3GWOA 4ZHQA 1Q6HA 2ZNJA 3ML0A 5BMVA 3D3QA 4IHJA 3RYCA 4JYAO 2VQEB 2ZINA 1H2NA 4LF5B 2EIKC 4TV9A 2AZ2A 4BAYA 1RPRA 5LYJA 4Q6GA 4MT8A 4JI5O 4I55B 3L74H 1K33A 4UV8A 1NT2B 5EIBC 3RN4A 3UO2A 4PV1B 4W4KA 2HJDA 3SGIA 1HNZO 1BMFG 2A3QA 3SPGA 4QNHB 2ZT9B 4LC1A 3TCUA 1AR1B 1WB7A 2ZE5A 3K79A 2DOSA 1VQ5V 2YIAA 3U0ZA 2IBZH 3CPWU 1I5XA 1GMGA 2D2CB 3OTFA 2EIJB 2JGDA 4P2ZA 1MG1A 3JAKA 3OD4A 3TXSA 2OT5A 3MAQA 3CMAV 4NB5A 2ITCC 4TWKA 3K58A 4UCUA 1UFIA 3OGCC 4O2BA 4DO2A 1IBMO 1COWG 2BTOA 3JATA 2OIEA 1H2LA 2QDOA 1J95A 2CTQA 4XBFA 3OMNB 2YS8A 2P22C 2V7QG 3ICXA 2R9AA 4I0XA 1PM9A 3OEHG 3CYOA 2X6AA 2WSSG 4DUYB 2DQ3A 3TK1A 1N33B 3JD2A 3N27A 4HBNA 3ABTA 3T1HO 3AK1A 2GSMB 3DC5A 3ETGA 1I7FA 3UM7A 5KA6A 3BCCH 1IVSA 1F4MA 4JAAA 1SQVH 2HHHB 1Z2GA 4YHHO 4FLZA 4X9QA 4I50A 4FPPA 4I9QA 2XHBA 3M7MX 3E8GA 5L3DA 4IYHA 4JI4O 4JYYA 3ZRWA 2ITDC 2Z3YA 3X2QB 4MVOA 3LDCA 2Q7GA 1N32O 1FYJA 1MNGA 4QPKA 4WFHA 1X59A 3ZN0A 2AXTZ 4X89A 3AG3C 3BA9A 3SPHA 1K7DA 4LH6A 5J2UA 2EINC 2WLMA 4FM2A 3AG4B 2GUZB 3CB2A 2VQEO 2WLHA 1XNQB 2QWOB 4B3TB 4LF5O 2W0FC 2Q6AA 2ZXWC 4O2AB 1AROP 4JI6B 3HKCA 4X62B 1ZL8B 2JVDA 3RYFA 1MZEA 1MSWD 4O4IB 2NLJC 3OTOO 1QCEA 1SERA 4DV6B 4B08A 3AG7A 3ABLB 3C3SA 1Q82W 3K0GA 4JAVA 4P30A 2IM9A 2IJHA 2RCVA 3T1YB 2ZR2A 2ZM6O 2F4VB 4WF9V 2GHYA 3RW0A 2IW5A 1KP2A 1TVKA 3O65A 3JARA 5LMNO 1NU1H 2AZ0A 1XREA 4NR1A 1ORQC 2W0XA 4AHCA 4O4HB 1NTZH 2M6YA 5CN0A 1F4NA 4PDVA 1VARA 2ZIOA 1NR1A 3L9DA 1SF9A 4FVMA 3G80A 3RYIA 2UXCB 3CCRV 1OHHG 4LBEC 3BABA 5EK0A 2DYSB 4X1IA 2WLKA 5LGNA 5LP6B 2DN9A 1K3EA 1N8RW 3P3PA 1QLEC 2H3OA 4RWUA 2QKCA 4DUYO 4X1YA 3IJ4A 1KUQA 3E2EA 3CRMA 4MVRA 4DV2B 2EILB 2XAGA 4X65B 2VQFB 3CC7V 3SJAC 5IJ0A 5D5PA 2JK5C 3B2EE 1YHQV 1HR0B 1WPXA 1MMMA 4LF8O 4K0KO 2Z0AA 3B40A 1JQ0A 4NXMO 5DN6G 1GH6A 2OIGA 2QGNA 3D36A 4CBCA 1SQPH 4Z1VA 1VQ7V 1OCZC 1OJHA 4DYLA 1UPGA 3CWBH 5CBGA 1SQFA 4FFKA 4AI8A 1B04A 3ASNC 4X64B 1AB3A 1JX9A 5GTHZ 5DECA 3CRCA 4JI6O 1OCRB 3EXAA 4X62O 3CJHA 4DV7O 4FIPC 4DV6O 2R72A 4MVMA 2FMLA 3T1YO 4OX9B 3M99B 4GX1A 1BSMA 3JASA 2IH3C 4JI0B 1SZTA 1XHXA 2RDCA 1URFA 1EBOA 4NKGB 2H8PC 1M4UA 3S3XA 1VQPV 4FM1A 4TQDA 4B3MO 2CE4A 4MW3A 1WJZA 3GWKC 1WB8A 4O4LB 4JTDB 1XOUA 5JJEB 2Y0IA 1IX9A 2BSKA 3LSSA 4DV0O 2HJFC 3HKBB 1ZSPA 1R73A 5LXTB 3CSXA 4NTWA 1E1QG 5JQGB 1M93A 1VQMV 2ZE7A 5CMUA 4J7ZA 2Q9LA 2YEVA 4JZGA 1XHZA 1H2GA 3ASOC 4XDJA 3MHHC 2QR4A 2UXXA 1FFTB 2YUAA 4P9OA 4FLWA 3AG2C 3K5MA 1JFFB 4N23A 5EZYB 1GRJA 2Y69B 3ZMVA 5C8YB 1R6KA 3OW2U 2CGNA 2HVJC 1TUBB 4EKWA 1DLBA 1WNSA 3ZIAG 3D36C 4TSFG 1H2SB 4DR7B 4K8XA 3SJBC 4PHZA 3WFVA 4QPJA 2HVKC 3W7UA 5KMGB 4LF7B 4PA4A 2EIKB 1HNWB 5B1BC 2LJ2A 3L75H 3SJQC 2XTAA 5GONB 3ZRSA 5FNVB 1S5HC 3ZJZA 5KHGA 4NYKA 4LNUA 1RSOA 1EN6A 2GTAA 3K5LA 4LF9B 1HW7A 3UT5B 2WLIA 1DTOA 1XDCA 1AI6A 3P3NA 2P90A 1NBMG 5JCOC 1YVWA 2EULA 1HNXO 4TV8A 5K1PA 5IWAB 2HEPA 2X6CA 3EFFK 4X64O 4FLVA 2QWQB 2JJ2G 2X6BA 2Q68A 2Q69A 2PY5A 3IAYA 4IT5A 1GK9A 4E4EA 4PDLA 1I08A 4HAMA 5KX5B 1R6NA 4HYOA 2XNDG 3N2GA 4MSWC 4H33A 2XUMA 3OUSA 2Q0AA 2E75B 5LOVB 1KU9A 3OR7C 1HWYA 2P4KA 4WFEA 1F7YA 4JPRA 4KXRA 1IBKB 4HNAB 1FKAO 4OX9O 3OMAB 3WB0A 2GTSA 1Q86W 4DR5B 1RPOA 4JI0O 2ADPA 3E22B 1QVGU 4PI0A 5J9PC 4GUNA 4X8AA 3BA8A 3RVYA 1K34A 4JI2O 2YIBA 3CCLV 1TUEB 2Z5UA 2VWJA 2CUGA 1FJGB 3FX7A 3QO8A 4LH7A 3AG1C 1EFRG 5H9CA 4X20A 3ZHTA 3ZMTA 3K5NA 3ZHRA 1FS0G 1MA1A 5ITZA 1LUVA 4PJ0Z 3NXSA 5KUKA 4GLXA 1NQTA 2N74A 1US6A 1VQKV 1XUQA 4YXWG 2QEXV 1Q6IA 4U3FH 4B3SB 2UUBO 2AHYA 1D2DA 1SQBH 1KBHA 4TV9B 4UCOA 3H1IH 1PL0A 2P7TC 2LW7A 4J41A 2E5LO 2WWWA 1B06A 1MZFA 2XOKG 1WP8A 4D7TA 2BTQA 3UO3A 1YDXA 3I56V 4LF4B 2V1DA 2IH1C 3SJCC 2DMXA 4CH3A 1QU7A 2ZXWB 2PYJA 4JTCB 4QE7A 5IYDO 1PL4A 2IU3A 4GKJB 4X66O 1BQ0A 3FAVB 3R65A 1YJNV 4GX5A 4Z2WA 2ODMA 4EFBA 2AGAA 1PNLA 1YIJV 3CRQA 1YJ9V 1Z5WA 2Q7EA 1QR9A 5D5QA 1GN4A 4X1KB 4OGQB 3HKDB 2YI9A 3G67A 4DR3B 3E83A 4PELA 2ZKOA 4I9WA 2PZSA 1NH2D 1ZAUA 1K92A 3JATB 2YSUB 4JV5O 3WB1A 2DW4A 5B3SC 4BWAA 2B9ZA 4FJCC 5A9GA 4PA9A 2F93B 1AJQA 1SETA 4I0XB 1Q5OA 3TGUH 4O4JA 4ZIBA 3LNNA 3RFRA 1YXBA 4R6ZA 5LMUB 3QTCA 3RYHA 4H13B 1L0LH 5LHIA 1KQSU 2JJ1G 2X7RB 1KD1W 1Q3EA 4B7KA 5J2TA 3KCYA 2PGGA 2FL4A 2EJRA 3QVNA 3B8MA 4E2LA 2LGWA 1I94B 1P84F 4DV3B 4G28B 5JVDA 4DW0A 2CAZC 4EB6B 1QLEB 4UV9A 1FJGO 1TAEA 1R3KC 5B1AC 2JS5A 2IJKA 1DGSA 5FL7G 3SYCA 4IIJA 1BHAA 4DR6B 3K04A 2CTWA 2P4VA 1KKDA 3JSNA 1NJIW 2F23A 1CEZA 1JR9A 4BIOA 1VQOV 1P7BA 1GTOA 4MTXA 2ZCEA 3CHXA 1VQLV 5EC1C 5HFLA 4J9YB 3QO7A 2ATKC 2RN9A 2CH7B 2RJZA 2Q7HA 2QA4V 4NVPA 3W7TA 5CA0B 1YJWV 1DF4A 3CCSV 2F66C 5JWPA 4LFCO 1YEWA 3HPLC 1XMOO 4RO2A 3CS5A 4A5UB 3I5DA 1AVMA 1YF2A 2FKXA 5CB4B 2EIMC 4DK0A 2HFEC 4GX0A 3K3WA 3OAAG 3G4SV 2UU9B 1SS3A 4PA3A 3M8AA 1L1FA 4CC6A 1VQ8V 1IURA 5JH7A 3DC6A 2W6JG 3RT3C 2YIBD 4I55A 1V55C 2PUSA 4PD4F 2Y4UA 4DV5B 4KHPB 1KB9F 4TQFA 3IC7A 3CCVV 4ZKIA 3WU2Z 4J80A 2IJIA 3T2MA 3K9SA 4L87A 4DR3O 1P4RA 4YY3B 3NR7A 4GZRB 1OCCB 4JI7B 4MW8A 1JA8A 4RUFA 3RYIB 1G1XB 3DXRB 4GT1A 5LA6B 4U3JB 4FZ1A 4YIPA 1Q8IA 3QO5A 1AP6A 1W59A 1F23A 4B7EA 4FK5C 1YTFB 4DR2B 1CP9A 3BEHA 5LMUO 2OCCB 1BE3H 4H0LB 1NKDA 3UQ8A 2DJVA 1WA8B 3Q4HB 3FB8C 2DYRC 3P32A 3WG7B 1FXKB 4CH5A 1K5SA 2L6LA 2WA4A 1V54C 2G38A 1I94O 5KAIZ 1R3LC 4DV3O 1FPOA 4OXSA 3DTUB 4ICGA 1WLEA 1OCOC 4QGPA 1WP7A 1S77D 3H1JH 2L35A 3AG2B 1EN5A 4IL6Z 4DR6O 3VOUA 5CA1B 4J7JA 1N34B 1RFYA 3JSLA 1AJNA 5KHIA 1IBLB 4RQFA 3F7YC 2CTRA 2XASA 2IU0A 2UUCB 1R3IC 1H38A 2DWDC 2QKSA 1CXZB 2QJ1A 5B1BB 1H8HG 3ZCCA 1GM8A 2C2AA 2GDSA 3PN1A 2JRIA 5BZBA 1ZUQA 4YJ2B 2D3OW 3ZMUA 4FM0A 5IJ9B 4GYCB 5KUMA 2LO1A 2GUZA 1E79G 1N33O 2LFRA 1OV9A 3W7SA 1R6TA 2UU9O 4MVZA 1M5IA 3ZHSA 4O2AA 1O9HA 3FB7C 4CS4A 3OT7A 5C93A 4WFBV 1L8DA 4UB6Z 1ZL8A 3HR0A 4JGSA 4HZ3A 2HHHO 4O4IA 3CCMV 1GN3A 1N4CA 5B5EZ 1E1RG 1H2MA 1ROPA 4KHPO
chains in the Genus database with same CATH topology
2DYRB 5B1BC 1Q81W 3IFXA 1MOFA 2EIJC 4TT3G 3CXCU 2ZR3A 1JPXA 3SJQC 3T4ZA 5IDJA 5IY5C 4LP8A 5GW7A 3ZRSA 1V54B 4WFGA 1S5HC 3ZJZA 1IXMA 1NVPB 3CP1A 2W6IG 5EC2C 5B1OA 1NVPD 2WLIA 3LNMB 1DTOA 1AI6A 1GM7A 4J9ZB 2P90A 1NBMG 3A0RA 5LBQA 1VQ4V 2XAFA 5LGTA 2X6CA 3EFFK 4KUMA 2Y69C 2JJ2G 3CCEV 2X6BA 4N21A 2Q68A 2Q69A 2YEVB 1AJPA 1M90W 1GK9A 4CZZA 3GWOA 4PDLA 3ML0A 1JOYA 3SPIA 4HAMA 4BIZA 5L3FA 3AG1B 4QE9A 1R6NA 4HYOA 2XNDG 4MSWC 4H33A 2Q67A 3OUSA 2EIKC 5EBWC 2Y48A 4DXWA 1G4YB 4BAYA 1Q7YW 3ASOB 1S0VA 1RPRA 3OR7C 1HWYA 3MHSC 4WFEA 4JPRA 4MT8A 1GO3F 3EHBB 1K8AW 3E8BA 5EBLC 5DM6V 3OMAB 3CMEV 1K97A 3SYPA 1Q86W 1K33A 4UV8A 1EZJA 1RPOA 1JCHA 1M56B 1QBZA 1QVGU 1BMFG 3B8NA 1FXVA 3P30A 5J9PC 3FKSG 4XDKA 4X8AA 3ZN1A 3RVYA 3SPGA 5L3CA 5L3BA 4QNHB 1K34A 4R7CA 1Y66A 3CCLV 4LC1A 3TCUA 1H8EG 4Q20A 1TUEB 2WAMA 5IYBO 1AR1B 2Z5UA 3QO8A 3K79A 3T1CA 3AEIA 1VQ5V 4RQEA 3CPWU 3OMIB 3AG1C 1I5XA 3MD0A 1GMGA 3IGAC 1EFRG 2F43G 5H9CA 2EIJB 1B6QA 3OR6C 4P2ZA 3ZMTA 5IY5B 3FB6C 1SESA 1MG1A 5H6QA 4KFMA 1K4CC 1S3JA 1FS0G 2OT5A 3E86A 3SPJA 1SRYA 3QNEA 3CMAV 3NXSA 2HKOA 2K1EA 3BY6A 2ITCC 4TWKA 5KUKA 1NQTA 5L3EA 1VQKV 1R3JC 4YXWG 3E35A 3OGCC 2QEXV 4DO2A 1COWG 2AHYA 3JYCA 1M56C 1J95A 3ABLC 1AI5A 4XBFA 3OMNB 2V7QG 1QR8A 2OTLV 2DQ0A 3RVZA 1PL0A 2XAQA 1OZ0A 2P7TC 3OEHG 2WWWA 1QVFU 4MVSA 3ZMZA 3CYOA 5CA3A 2AHZA 2X6AA 2XOKG 2WSSG 2DQ3A 3TK1A 3I56V 3JD2A 2V1DA 5E1AC 1M57B 3ABTA 2KB1A 2IH1C 2B1IA 2GSMB 3VBBA 3SPCA 3ETGA 2ZXWB 3UM7A 1FXKA 5HFMA 4JASA 4JTCB 4QE7A 5KA6A 1K4DC 3W7XA 1F4MA 5IYDO 2IU3A 5B1NA 5LHHA 4QJFB 2FTKA 3R65A 1YJNV 4FPPA 4GX5A 3E8GA 5L3DA 3OFNG 1PNLA 3STZC 3ZRWA 1YIJV 2ITDC 1W2BU 2Z3YA 3X2QB 4MVOA 3LDCA 1YJ9V 1QR9A 1W0KG 4QPKA 4WFHA 3ZN0A 4X89A 2WLLB 3AG3C 4U7NA 3SPHA 2QM7A 1K7DA 3LUTB 3DGEA 1NR7A 2EINC 2WLMA 1PNMA 3E83A 4PELA 4WFAV 4I9WA 1GM9A 3FYIB 4P9PA 3W7WA 1NH2B 3AG4B 1QLNA 2EZOA 1XL6A 3E8HA 1MABG 2WLHA 1NH2D 1K92A 2YSUB 2CK3G 1M57C 2DW4A 2W0FC 2EILC 5B3SC 4ASUG 5CBFA 2Q6AA 4FJCC 2ZXWC 4WCEV 1AROP 4PA9A 5IYCO 1I5YA 1JVMA 3CCQV 1AJQA 1SETA 1VQNV 1MSWD 2NLJC 3ABMB 4R6ZA 4MVUA 3CCUV 1QCEA 1RM1B 1SERA 5LHIA 1LNQA 3PJSK 3ABLB 1KQSU 2JJ1G 2X7RB 3ABUA 1Q82W 1Y4MA 3K0GA 4JAVA 2B5UA 4P30A 4UVCA 2JEXA 2IJHA 2M7WA 1KD1W 3X2QC 3K0DA 1G8MA 2EJRA 3K08A 4BIUA 3B8MA 4E2LA 4X88A 4G28B 2ZR2A 3OM3B 1QLEB 4UV9A 1R3KC 5B1AC 4WF9V 2JIZG 2GHYA 3OE7G 2IJKA 3RW0A 5FL7G 2EIMB 3SYCA 2IW5A 3AG4C 3JD1A 3T4DA 1KP2A 1OCCC 2EBOA 2WLIB 1BHAA 2BOBC 3K04A 1ORQC 1KKDA 3CC2V 2H94A 1NJIW 1CEZA 4RUEA 1KP3A 1S72V 1OCRC 1YI2V 4MTOA 5CBHA 1VQOV 1P7BA 3FYEB 1GTOA 1V55B 4UVBA 4JF3A 4MTXA 5CN0A 1F4NA 5EBMC 1VQLV 1PD3A 4PDVA 4U7OA 3ABMC 3K03A 5EC1C 3JD4A 1RM1C 5HFLA 2OCCC 1NR1A 4J9YB 3QO7A 4JAUA 2ATKC 4QIWF 1KC8W 3ZRVA 1K5QA 3CCRV 2QA4V 2QE7G 1OHHG 1DF5A 3W7TA 4LBEC 4G2KA 5EK0A 1DF4A 1YJWV 3KG2A 2DYSB 3AG3B 2WLKA 3WG7C 5LGNA 1FXKC 2A79B 3CCSV 4GX2A 3ETEA 2XAJA 2EINB 1K3EA 3HPLC 1N8RW 3OEEG 4RO2A 1QLEC 3STLC 5L3GA 1YITV 2EIMC 3JCZA 4JYCA 5LHGA 3E2EA 2HFEC 4GX0A 1F51A 4MVRA 3K3WA 2EILB 5B3SB 2XAGA 1YSCA 3OAAG 3G4SV 3CC7V 4PA3A 3ZMSA 2PI5A 3ABKB 4ZBMA 1L1FA 2WLNA 2ZQMA 1VQ8V 2PI4A 2JK5C 2HLDG 1YHQV 2W6JG 2NNUA 2ZDIA 1V55C 3TETA 1WPXA 1FXHA 3LDDA 1XL4A 3SYOA 2LP7A 1K9MW 1KECA 3IC7A 1JQ0A 4MVQA 2LFSA 3D3IA 1THZA 3CCVV 4ZKIA 5DN6G 2UXNA 2DYSC 1BHBA 2IJIA 4MTFA 3T2MA 3D36A 4CBCA 1VQ7V 5B1AB 1OCZC 1OCOB 3GB7C 4L87A 1P4RA 4BW5A 1OCCB 4MW8A 3ETDA 5CBGA 4RUFA 2WLJA 3F7VC 3G6EV 1UJWB 4UUJC 3E89A 4JYBA 3ASNC 4GT1A 1VQ9V 2OTJV 2WPDG 1JX9A 3ABKC 1OCRB 3LSQA 3QO5A 4PA6A 1F23A 2QTOA 4FK5C 1YTFB 1CP9A 3BEHA 4FIPC 2HG5C 2OCCB 4R8CA 1NKDA 2B1GA 4UXNA 1YTFD 2XAHA 4MVMA 1S76D 2EZPA 3FB8C 2BOCC 1BL8A 2DYRC 3P32A 4GCZA 4Z1MG 3WG7B 1FXKB 1K5SA 3SYAA 1V54C 2X0LA 3H01A 1R3LC 3M99B 3DTUB 4OXSA 3FB5C 4H37A 1WLEA 4GX1A 2P6JA 1PNKA 1OCOC 2IH3C 4FMTA 1AI7A 2DWEC 1S77D 4XDLA 2IJJA 1K73W 3AG2B 1SZTA 3ZRWB 3UKMA 1EBOA 3VOUA 2A9HA 2H8PC 1CPYA 3G71V 3JD0A 1VQPV 3ZRXA 1QQHA 2MK3A 1AJNA 4MW3A 4PDMA 4WFFA 4LCUC 3F7YC 4RQFA 1M1KW 4JTDB 2XASA 2IU0A 3LSSA 1VQ6V 3OUFA 2HJFC 1R3IC 1R73A 4R50A 1H38A 2DWDC 3K06A 2QKSA 1E1QG 4RAIA 5B1BB 1VQMV 1H8HG 5CMUA 3JD3A 4G27B 2JDIG 2QM8A 1GM8A 1W0JG 3K9AA 3ZCCA 4UVAA 2C2AA 3CD6V 2YEVA 2WLLA 4I5SA 2P67A 3CCJV 1H2GA 3ASOC 4XDJA 3MHHC 1OCZB 5BZBA 3SYQA 4MTGA 2D3OW 2A0LA 5LGUA 3ZMUA 2ZD9A 2ZDIC 3I55V 5KUMA 2UXXA 1JJ2U 3LDEA 5KA5A 1E79G 1FFTB 2LFRA 4P9OA 2HR3A 3RBZA 3HB3B 1AI4A 3AG2C 3ASNB 1ENVA 4N23A 2Y69B 3W7SA 3CC4V 3ZMVA 4F4LA 4MVZA 1R6KA 4JTAB 3OW2U 2HVJC 3FB7C 5C93A 4EKWA 3E8FA 1DLBA 4WFBV 2JEUA 3ZIAG 2R9RB 3F5WC 4TSFG 4JGSA 4HZ3A 5H6RA 1PKXA 3WFVA 2R9IA 4QPJA 2HVKC 3W7UA 3CCMV 4PA7A 1GKFA 3B77A 1E1RG 1M9NA 1ZWIC 4PDRA 1ROPA 4MS2A 4PA4A 2EIKB 4KP4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QQH A;  2NNU A;  1R6K A;  1R6N A;  1TUE B;  2JEX A;  2JEU A;  1DTO A; 
#chains in the Genus database with same CATH topology
 4LFA B;  3HKE B;  3IFX A;  2EIJ C;  3CXC U;  1JPX A;  3QG5 A;  5IDJ A;  5GW7 A;  1SA0 B;  4WFG A;  1B3Q A;  1J5E B;  1XMQ B;  1IZ3 A;  1G6U A;  4JI3 B;  2DE0 X;  3CP1 A;  2W6I G;  4JI7 O;  5B1O A;  1NVP D;  3LNM B;  4J9Z B;  1XNQ O;  3A0R A;  3AK2 A;  2XAF A;  4B3T O;  1EN4 A;  4F6E A;  1T5E A;  4KUM A;  2YEV B;  4O4H A;  2PF4 E;  1RP3 B;  3JAM N;  4UCT A;  3APO A;  1BGY H;  5FLX N;  4BIZ A;  5L3F A;  1NTK H;  3U10 A;  3AG1 B;  4DR2 O;  2Q67 A;  5EBW C;  4DK1 A;  2KG7 A;  1Q7Y W;  1S0V A;  5LP6 A;  1X4T A;  1GO3 F;  4K3A A;  3EHB B;  1K8A W;  5DM6 V;  4IYI A;  2F4V O;  3CME V;  4KL1 A;  1LUW A;  1U96 A;  1EZJ A;  1JCH A;  4F6R B;  4NXN B;  5B66 Z;  3B8N A;  1FXV A;  3FKS G;  4XDK A;  5L3B A;  1N34 O;  1PP9 H;  1Y66 A;  3EVK A;  2JS3 A;  2WAM A;  3GVM A;  3T1C A;  3AEI A;  4NTY A;  1QHT A;  2NN4 A;  2NR5 A;  3MD0 A;  3IGA C;  2A7W A;  3JAW A;  3OR6 C;  5IY5 B;  2UXC O;  1YZB A;  3FB6 C;  3H1L H;  5H6Q A;  4KFM A;  1XNR B;  3SPJ A;  3QNE A;  4ZI7 B;  3BY6 A;  1R3J C;  4DV4 B;  3KKY A;  1N36 B;  2PYL A;  3JYC A;  2CGO A;  3BVO A;  3N2G B;  1M56 C;  3ABL C;  4ZOL A;  3B09 A;  4DV2 O;  5KHJ A;  4X65 O;  2VQF O;  1U97 A;  1Q43 A;  1QR8 A;  2OTL V;  2DQ0 A;  3RVZ A;  4FFB A;  3RWR D;  2PTM A;  1OZ0 A;  1NTM H;  3WB2 A;  1HR0 O;  1VMG A;  5CA3 A;  3IC9 A;  4DW1 A;  5E1A C;  1AR5 A;  1EM1 A;  2VWK A;  3LSU A;  1NZ6 A;  3VBB A;  4LFA O;  1KMI Z;  1R1B A;  1SQX H;  1KKC A;  5HFM A;  3W7X A;  1K4D C;  2E3C A;  1XMQ O;  5IT9 N;  5B1N A;  3N2K B;  4QJF B;  5BR8 B;  2FTK A;  2CTP A;  4JI3 O;  4LWS B;  1S5J A;  4TOI A;  1O9G A;  2HP8 A;  3OFN G;  3STZ C;  5BY1 A;  2CDY A;  1W2B U;  2KSD A;  2AW9 A;  4J10 A;  4ABM A;  2WLL B;  2QM7 A;  3LUT B;  3DGE A;  4O4L A;  1PNM A;  4WFA V;  1GM9 A;  3W7W A;  1QLN A;  2YDE A;  2EZO A;  1GAX A;  1MAB G;  5LXT A;  3MDS A;  2CK3 G;  5JQG A;  1M57 C;  4YJ3 B;  2EIL C;  1FFX B;  4I4T B;  1VQN V;  5EYP B;  4FLY A;  4MVU A;  2BTQ B;  1LR1 A;  2VRZ A;  3PJS K;  2YID A;  1Y74 B;  1JFF A;  5EZY A;  2B5U A;  4JZ2 A;  2M7W A;  3K0D A;  1G8M A;  5C8Y A;  2ZE6 A;  3K08 A;  1TUB A;  1Y76 B;  4X88 A;  4JI5 B;  5FPO A;  3OM3 B;  2QM4 A;  1AR4 A;  3OE7 G;  2EIM B;  3JD1 A;  5IE9 A;  2EBO A;  5IYZ B;  1D5A A;  4DRX B;  1GN2 A;  5GON A;  4YIO A;  5FNV A;  1KP3 A;  2YXL A;  4ZHQ B;  1OCR C;  4MTO A;  1FD9 A;  3FYE B;  1V55 B;  5BMV B;  4IHJ B;  1PD3 A;  4U7O A;  3RYC B;  4LFB B;  5KHH A;  3ABM C;  3K03 A;  4LR3 A;  1N36 O;  3JD4 A;  3CXH F;  1RM1 C;  3UT5 A;  3ZRV A;  1DF5 A;  3AG3 B;  5LYJ B;  2XAJ A;  1PV0 A;  2EIN B;  4DR7 O;  1HP8 A;  2RMK B;  3APQ A;  3RYH B;  3STL C;  5KX5 A;  1IBM B;  1XBL A;  3JCZ A;  4DUZ B;  4JYC A;  4LF7 O;  2QWN B;  3ZS8 C;  1YSC A;  1HNW O;  5J2T B;  5LOV A;  2PI5 A;  4ZBM A;  2Q0O C;  2WLN A;  2ZQM A;  1Q90 D;  2F95 B;  4HNA A;  2NNU A;  5AG2 A;  2ZDI A;  4AQY B;  3J81 N;  2QTS A;  1KYO F;  3TET A;  5BR8 O;  1FXH A;  3LDD A;  4FLX A;  2ZNI A;  3JAL A;  4LF9 O;  1XL4 A;  3SYO A;  2LP7 A;  3SR2 C;  3J7A U;  1KEC A;  1WAZ A;  3T1H B;  2JGD B;  4MVQ A;  2LFS A;  3JAK B;  5IWA O;  2UXN A;  5F2V O;  1DK1 A;  1BHB A;  4MTF A;  1OCO B;  3ETQ A;  3GB7 C;  4BW5 A;  4CH4 A;  3A0H Z;  4O2B B;  4L8J A;  4BR6 A;  2Q73 A;  3K57 A;  4JI4 B;  1SKV A;  3G6E V;  1L0N H;  1VQ9 V;  4WBN A;  3ABK C;  3LSQ A;  4TUY A;  2LGQ A;  1WPB A;  3JCU Z;  1IBK O;  4B3R B;  2QTO A;  2HG5 C;  4DR5 O;  2B1G A;  4UXN A;  4FZ0 A;  2UXB B;  3FFQ A;  1S76 D;  2OYQ A;  4UCR A;  2BOC C;  4GCZ A;  3D8C A;  3SYA A;  5JH7 B;  2X0L A;  4GKK B;  3H01 A;  2FB5 A;  2P6J A;  2Y4T A;  3OTO B;  1BZK A;  4I50 B;  1AI7 A;  2DWE C;  3DSQ A;  2XT9 A;  4XDL A;  2IJJ A;  3AK3 A;  3UCS C;  3L72 H;  3ZRW B;  1XIL A;  4J7K A;  3G71 V;  2GBO A;  1A32 A;  5J2U B;  2MK3 A;  2ZM6 B;  1M1K W;  1ZX3 A;  4LCU C;  3FAV A;  1VQ6 V;  4LFB O;  5LMN B;  4B3S O;  3K06 A;  2QSA A;  3C90 A;  4LF6 B;  4FLU A;  1Y6X A;  3JD3 A;  4G27 B;  2JDI G;  1W0J G;  1TGO A;  3K9A A;  4X1K A;  3HKD A;  3HKC B;  4I5S A;  2P67 A;  3BHP A;  1OCZ B;  3SYQ A;  3RYF B;  1P49 A;  2RNB A;  2ZDI C;  1ZTE A;  3U11 A;  1JJ2 U;  3LDE A;  4IGG A;  4LF4 O;  3A8T A;  4DUZ O;  3HB3 B;  5KAF Z;  3ASN B;  5BXZ A;  3ZHU A;  3E8F A;  2QWP B;  3F5W C;  5H6R A;  1PKX A;  4GKJ O;  4AQY O;  2R9I A;  1AP5 A;  1TVK B;  3JAR B;  4PDR A;  4PA6 A;  4TT3 G;  1XEQ A;  2QKA A;  3BRC A;  2BCC H;  4EB6 A;  5JJN B;  1SC5 B;  4LF8 B;  4K0K B;  5EC2 C;  5EIB D;  4NXM B;  1VQ4 V;  3BPZ A;  4CC5 A;  2YIC A;  4X1I B;  3CCE V;  4N21 A;  1AJP A;  4J42 A;  2KQX A;  2EJ7 A;  4JI8 B;  1JOY A;  1BQZ A;  4B3R O;  3SPI A;  4X1Y B;  4QE9 A;  5K1X A;  2UXB O;  1GN6 A;  2CH7 A;  3ZHQ A;  4UCV A;  2Y48 A;  5CA0 A;  4DXW A;  5IJ0 B;  1G4Y B;  3ASO B;  3MHS C;  1N0N A;  4GKK O;  3E8B A;  5EBL C;  4DV7 B;  1TA8 A;  2KKW A;  1K97 A;  4FLT A;  3SYP A;  3KZI Z;  4AIL C;  5CB4 A;  1M56 B;  1QBZ A;  3P30 A;  3TXQ A;  4C7U A;  1Z5V A;  1FAF A;  3ZN1 A;  4DR1 B;  5L3C A;  4R7C A;  3H1K H;  4BW9 A;  1H8E G;  4Q20 A;  5IYB O;  5KHK A;  2Q8V A;  4W4L A;  1MSD A;  4RQE A;  3OMI B;  4OPA A;  3VQY A;  2F43 G;  1B6Q A;  3BFR A;  4LF6 O;  1SES A;  1K4C C;  1S3J A;  3E86 A;  4B3M B;  1SZX A;  1SRY A;  4D7S A;  1IDS A;  2HKO A;  2K1E A;  3CJH B;  5L3E A;  3VQX A;  4DV0 B;  3OGI B;  3F5T A;  3E35 A;  1N0J A;  1NS1 A;  2Q4P A;  1AI5 A;  2YXH A;  1VF5 B;  4K35 A;  3DXR A;  2KG7 B;  5LA6 A;  4U3J A;  1YCI A;  2XAQ A;  1QVF U;  4MVS A;  3ZMZ A;  2AHZ A;  3JAS B;  2JGU A;  4UB8 Z;  4DV5 O;  1M57 B;  2KB1 A;  1WA8 A;  2OCH A;  3Q4H A;  2B1I A;  3SPC A;  1FXK A;  4JAS A;  5LHH A;  2BSK B;  4YY3 O;  3KCX A;  3CRA A;  3JAW B;  1JMK C;  5CA1 A;  5TIS Z;  1W0K G;  1NI8 A;  4U7N A;  3THO A;  3G6B A;  1HDJ A;  1NR7 A;  2EX3 A;  4JI8 O;  3FYI B;  4P9P A;  1NH2 B;  3FD9 A;  1XL6 A;  3E8H A;  2YXY A;  2RQ6 A;  4ZOL B;  1QNM A;  2BE3 A;  1HNX B;  4ASU G;  5CBF A;  4WCE V;  5IYC O;  1I5Y A;  1JVM A;  2QWR B;  4FFB B;  3CCQ V;  4CS2 A;  4UFZ A;  1BCC H;  4YJ2 A;  5IJ9 A;  2UUA B;  3ABM B;  1H2K A;  2ZE8 A;  3CCU V;  1RM1 B;  1LNQ A;  5H5N A;  5JCO A;  3ABU A;  3H9V A;  4EEQ A;  1Y4M A;  3K59 A;  4UVC A;  5JJJ B;  2JEX A;  3X2Q C;  3ZED A;  4BIU A;  3CEI A;  4DR1 O;  4D6T H;  4LNU B;  1RSO B;  1IBL O;  5E79 Z;  2JIZ G;  1AIL A;  1ZLZ A;  3AG4 C;  3T4D A;  1OCC C;  2MW2 B;  2WLI B;  2UUC O;  2BOB C;  2WA3 A;  4TV8 B;  3HKE A;  1VF7 A;  3TJT A;  1V9P A;  3CC2 V;  2H94 A;  4EFE A;  1SA0 A;  5DED A;  3C3T A;  4RUE A;  4JI2 B;  1S72 V;  2YI8 A;  1YI2 V;  5CBH A;  4UVB A;  2GV9 A;  4JF3 A;  5EBM C;  1VEW A;  3RGB A;  2OCC C;  4JAU A;  4QIW F;  4NTX A;  1KC8 W;  1K5Q A;  3BAA A;  2QE7 G;  3VQW A;  4G2K A;  3KG2 A;  2FYU H;  3WG7 C;  1D5N A;  1FXK C;  2A79 B;  4GX2 A;  3ETE A;  3L71 H;  1Y67 A;  4UCS A;  4CH6 A;  5GTI Z;  1P7G A;  2ARH A;  2E74 B;  3OEE G;  3L70 H;  3A0B Z;  5L3G A;  1YIT V;  2O57 A;  2UUB B;  2N04 A;  5LHG A;  1F51 A;  1SQQ H;  3CE2 A;  5B3S B;  3CRR A;  3ZMS A;  3ABK B;  3R66 A;  2PI4 A;  2HLD G;  2E5L B;  1J5E O;  2VS0 A;  1VF6 A;  1K9M W;  5LL6 Y;  2YC0 A;  4X20 B;  4F6R A;  3D3I A;  1THZ A;  2DYS C;  5ITZ B;  5LP6 C;  2ADQ B;  4CS3 A;  1WN7 A;  5B1A B;  4X66 B;  2P06 A;  2UXD B;  5FPR A;  3HKB A;  3ETD A;  4DR4 B;  1JJO A;  2WLJ A;  3F7V C;  2ZIM A;  4UUJ C;  1BS3 A;  1UJW B;  4DV1 B;  3E89 A;  4JYB A;  2OWO A;  2OTJ V;  2WPD G;  4JI1 B;  2F1M A;  1PPJ H;  4ZI7 A;  2ETN A;  2R70 A;  3K5O A;  4PI2 A;  3ZX6 A;  3CX5 F;  4JYA B;  2UUA O;  4R8C A;  4JV5 B;  1YTF D;  2LQT A;  2XAH A;  2EZP A;  4NXN O;  1BL8 A;  1SQG A;  1XQ8 A;  4Z1M G;  1I0H A;  2K9P A;  5A2Q N;  3B4S A;  3FB5 C;  4H37 A;  1PNK A;  3JAL B;  4FMT A;  5KMG A;  1K73 W;  2P5O A;  1HNZ B;  3UKM A;  2A9H A;  1CPY A;  3JD0 A;  5KLV H;  1XNR O;  3ZRX A;  1QQH A;  4J11 A;  2ILM A;  4OPH A;  4PDM A;  4WFF A;  3N2K A;  3SDL A;  3H1H H;  3OUF A;  4LWS A;  4DV4 O;  1Q6U A;  4R50 A;  4RAI A;  3S3W A;  2Y0P A;  3ZHV A;  1QQC A;  4K8Z A;  2QM8 A;  4WBN B;  4UVA A;  3CD6 V;  2WLL A;  3CCJ V;  2N05 A;  4TUY B;  4H44 B;  4O4J B;  4MTG A;  2A0L A;  2ZD9 A;  3I55 V;  3A2F A;  1IXB A;  1VF6 C;  5KA5 A;  1S5L Z;  2HR3 A;  3RBZ A;  1AI4 A;  1ENV A;  4YJ3 A;  2Q5Z A;  3CC4 V;  4F4L A;  1FFX A;  2E76 B;  4JTA B;  4I4T A;  4LFC B;  2JEU A;  1XMO B;  2R9R B;  5JVD B;  5EYP A;  3ZBH A;  4PA7 A;  1GKF A;  4IIJ B;  3B77 A;  1M9N A;  1ZWI C;  2LW1 A;  1Y74 A;  4MS2 A;  4I7Z B;  5LGU A;  3E22 A;  3L73 H;  4KP4 A;  3QF7 A;  2DYR B;  1Q81 W;  1MOF A;  2ZR3 A;  3T4Z A;  5IY5 C;  4LP8 A;  3O9O A;  1V54 B;  1BT8 A;  1Y76 A;  5H2F Z;  1IXM A;  4YHH B;  1NVP B;  2UXD O;  1VP7 A;  1XI1 A;  3J80 N;  4DR4 O;  1GM7 A;  5IYZ A;  5LBQ A;  4DRX A;  1N32 B;  4DV1 O;  1EZV H;  5LGT A;  2A06 H;  2Y69 C;  2V4D A;  1VIB A;  4JI1 O;  3VQV A;  1M90 W;  4CZZ A;  3GWO A;  4ZHQ A;  1Q6H A;  2ZNJ A;  3ML0 A;  5BMV A;  3D3Q A;  4IHJ A;  3RYC A;  4JYA O;  2VQE B;  2ZIN A;  1H2N A;  4LF5 B;  2EIK C;  4TV9 A;  2AZ2 A;  4BAY A;  1RPR A;  5LYJ A;  4Q6G A;  4MT8 A;  4JI5 O;  4I55 B;  3L74 H;  1K33 A;  4UV8 A;  1NT2 B;  5EIB C;  3RN4 A;  3UO2 A;  4PV1 B;  4W4K A;  2HJD A;  3SGI A;  1HNZ O;  1BMF G;  2A3Q A;  3SPG A;  4QNH B;  2ZT9 B;  4LC1 A;  3TCU A;  1AR1 B;  1WB7 A;  2ZE5 A;  3K79 A;  2DOS A;  1VQ5 V;  2YIA A;  3U0Z A;  2IBZ H;  3CPW U;  1I5X A;  1GMG A;  2D2C B;  3OTF A;  2EIJ B;  2JGD A;  4P2Z A;  1MG1 A;  3JAK A;  3OD4 A;  3TXS A;  2OT5 A;  3MAQ A;  3CMA V;  4NB5 A;  2ITC C;  4TWK A;  3K58 A;  4UCU A;  1UFI A;  3OGC C;  4O2B A;  4DO2 A;  1IBM O;  1COW G;  2BTO A;  3JAT A;  2OIE A;  1H2L A;  2QDO A;  1J95 A;  2CTQ A;  4XBF A;  3OMN B;  2YS8 A;  2P22 C;  2V7Q G;  3ICX A;  2R9A A;  4I0X A;  1PM9 A;  3OEH G;  3CYO A;  2X6A A;  2WSS G;  4DUY B;  2DQ3 A;  3TK1 A;  1N33 B;  3JD2 A;  3N27 A;  4HBN A;  3ABT A;  3T1H O;  3AK1 A;  2GSM B;  3DC5 A;  3ETG A;  1I7F A;  3UM7 A;  5KA6 A;  3BCC H;  1IVS A;  1F4M A;  4JAA A;  1SQV H;  2HHH B;  1Z2G A;  4YHH O;  4FLZ A;  4X9Q A;  4I50 A;  4FPP A;  4I9Q A;  2XHB A;  3M7M X;  3E8G A;  5L3D A;  4IYH A;  4JI4 O;  4JYY A;  3ZRW A;  2ITD C;  2Z3Y A;  3X2Q B;  4MVO A;  3LDC A;  2Q7G A;  1N32 O;  1FYJ A;  1MNG A;  4QPK A;  4WFH A;  1X59 A;  3ZN0 A;  2AXT Z;  4X89 A;  3AG3 C;  3BA9 A;  3SPH A;  1K7D A;  4LH6 A;  5J2U A;  2EIN C;  2WLM A;  4FM2 A;  3AG4 B;  2GUZ B;  3CB2 A;  2VQE O;  2WLH A;  1XNQ B;  2QWO B;  4B3T B;  4LF5 O;  2W0F C;  2Q6A A;  2ZXW C;  4O2A B;  1ARO P;  4JI6 B;  3HKC A;  4X62 B;  1ZL8 B;  2JVD A;  3RYF A;  1MZE A;  1MSW D;  4O4I B;  2NLJ C;  3OTO O;  1QCE A;  1SER A;  4DV6 B;  4B08 A;  3AG7 A;  3ABL B;  3C3S A;  1Q82 W;  3K0G A;  4JAV A;  4P30 A;  2IM9 A;  2IJH A;  2RCV A;  3T1Y B;  2ZR2 A;  2ZM6 O;  2F4V B;  4WF9 V;  2GHY A;  3RW0 A;  2IW5 A;  1KP2 A;  1TVK A;  3O65 A;  3JAR A;  5LMN O;  1NU1 H;  2AZ0 A;  1XRE A;  4NR1 A;  1ORQ C;  2W0X A;  4AHC A;  4O4H B;  1NTZ H;  2M6Y A;  5CN0 A;  1F4N A;  4PDV A;  1VAR A;  2ZIO A;  1NR1 A;  3L9D A;  1SF9 A;  4FVM A;  3G80 A;  3RYI A;  2UXC B;  3CCR V;  1OHH G;  4LBE C;  3BAB A;  5EK0 A;  2DYS B;  4X1I A;  2WLK A;  5LGN A;  5LP6 B;  2DN9 A;  1K3E A;  1N8R W;  3P3P A;  1QLE C;  2H3O A;  4RWU A;  2QKC A;  4DUY O;  4X1Y A;  3IJ4 A;  1KUQ A;  3E2E A;  3CRM A;  4MVR A;  4DV2 B;  2EIL B;  2XAG A;  4X65 B;  2VQF B;  3CC7 V;  3SJA C;  5IJ0 A;  5D5P A;  2JK5 C;  3B2E E;  1YHQ V;  1HR0 B;  1WPX A;  1MMM A;  4LF8 O;  4K0K O;  2Z0A A;  3B40 A;  1JQ0 A;  4NXM O;  5DN6 G;  1GH6 A;  2OIG A;  2QGN A;  3D36 A;  4CBC A;  1SQP H;  4Z1V A;  1VQ7 V;  1OCZ C;  1OJH A;  4DYL A;  1UPG A;  3CWB H;  5CBG A;  1SQF A;  4FFK A;  4AI8 A;  1B04 A;  3ASN C;  4X64 B;  1AB3 A;  1JX9 A;  5GTH Z;  5DEC A;  3CRC A;  4JI6 O;  1OCR B;  3EXA A;  4X62 O;  3CJH A;  4DV7 O;  4FIP C;  4DV6 O;  2R72 A;  4MVM A;  2FML A;  3T1Y O;  4OX9 B;  3M99 B;  4GX1 A;  1BSM A;  3JAS A;  2IH3 C;  4JI0 B;  1SZT A;  1XHX A;  2RDC A;  1URF A;  1EBO A;  4NKG B;  2H8P C;  1M4U A;  3S3X A;  1VQP V;  4FM1 A;  4TQD A;  4B3M O;  2CE4 A;  4MW3 A;  1WJZ A;  3GWK C;  1WB8 A;  4O4L B;  4JTD B;  1XOU A;  5JJE B;  2Y0I A;  1IX9 A;  2BSK A;  3LSS A;  4DV0 O;  2HJF C;  3HKB B;  1ZSP A;  1R73 A;  5LXT B;  3CSX A;  4NTW A;  1E1Q G;  5JQG B;  1M93 A;  1VQM V;  2ZE7 A;  5CMU A;  4J7Z A;  2Q9L A;  2YEV A;  4JZG A;  1XHZ A;  1H2G A;  3ASO C;  4XDJ A;  3MHH C;  2QR4 A;  2UXX A;  1FFT B;  2YUA A;  4P9O A;  4FLW A;  3AG2 C;  3K5M A;  1JFF B;  4N23 A;  5EZY B;  1GRJ A;  2Y69 B;  3ZMV A;  5C8Y B;  1R6K A;  3OW2 U;  2CGN A;  2HVJ C;  1TUB B;  4EKW A;  1DLB A;  1WNS A;  3ZIA G;  3D36 C;  4TSF G;  1H2S B;  4DR7 B;  4K8X A;  3SJB C;  4PHZ A;  3WFV A;  4QPJ A;  2HVK C;  3W7U A;  5KMG B;  4LF7 B;  4PA4 A;  2EIK B;  1HNW B;  5B1B C;  2LJ2 A;  3L75 H;  3SJQ C;  2XTA A;  5GON B;  3ZRS A;  5FNV B;  1S5H C;  3ZJZ A;  5KHG A;  4NYK A;  4LNU A;  1RSO A;  1EN6 A;  2GTA A;  3K5L A;  4LF9 B;  1HW7 A;  3UT5 B;  2WLI A;  1DTO A;  1XDC A;  1AI6 A;  3P3N A;  2P90 A;  1NBM G;  5JCO C;  1YVW A;  2EUL A;  1HNX O;  4TV8 A;  5K1P A;  5IWA B;  2HEP A;  2X6C A;  3EFF K;  4X64 O;  4FLV A;  2QWQ B;  2JJ2 G;  2X6B A;  2Q68 A;  2Q69 A;  2PY5 A;  3IAY A;  4IT5 A;  1GK9 A;  4E4E A;  4PDL A;  1I08 A;  4HAM A;  5KX5 B;  1R6N A;  4HYO A;  2XND G;  3N2G A;  4MSW C;  4H33 A;  2XUM A;  3OUS A;  2Q0A A;  2E75 B;  5LOV B;  1KU9 A;  3OR7 C;  1HWY A;  2P4K A;  4WFE A;  1F7Y A;  4JPR A;  4KXR A;  1IBK B;  4HNA B;  1FKA O;  4OX9 O;  3OMA B;  3WB0 A;  2GTS A;  1Q86 W;  4DR5 B;  1RPO A;  4JI0 O;  2ADP A;  3E22 B;  1QVG U;  4PI0 A;  5J9P C;  4GUN A;  4X8A A;  3BA8 A;  3RVY A;  1K34 A;  4JI2 O;  2YIB A;  3CCL V;  1TUE B;  2Z5U A;  2VWJ A;  2CUG A;  1FJG B;  3FX7 A;  3QO8 A;  4LH7 A;  3AG1 C;  1EFR G;  5H9C A;  4X20 A;  3ZHT A;  3ZMT A;  3K5N A;  3ZHR A;  1FS0 G;  1MA1 A;  5ITZ A;  1LUV A;  4PJ0 Z;  3NXS A;  5KUK A;  4GLX A;  1NQT A;  2N74 A;  1US6 A;  1VQK V;  1XUQ A;  4YXW G;  2QEX V;  1Q6I A;  4U3F H;  4B3S B;  2UUB O;  2AHY A;  1D2D A;  1SQB H;  1KBH A;  4TV9 B;  4UCO A;  3H1I H;  1PL0 A;  2P7T C;  2LW7 A;  4J41 A;  2E5L O;  2WWW A;  1B06 A;  1MZF A;  2XOK G;  1WP8 A;  4D7T A;  2BTQ A;  3UO3 A;  1YDX A;  3I56 V;  4LF4 B;  2V1D A;  2IH1 C;  3SJC C;  2DMX A;  4CH3 A;  1QU7 A;  2ZXW B;  2PYJ A;  4JTC B;  4QE7 A;  5IYD O;  1PL4 A;  2IU3 A;  4GKJ B;  4X66 O;  1BQ0 A;  3FAV B;  3R65 A;  1YJN V;  4GX5 A;  4Z2W A;  2ODM A;  4EFB A;  2AGA A;  1PNL A;  1YIJ V;  3CRQ A;  1YJ9 V;  1Z5W A;  2Q7E A;  1QR9 A;  5D5Q A;  1GN4 A;  4X1K B;  4OGQ B;  3HKD B;  2YI9 A;  3G67 A;  4DR3 B;  3E83 A;  4PEL A;  2ZKO A;  4I9W A;  2PZS A;  1NH2 D;  1ZAU A;  1K92 A;  3JAT B;  2YSU B;  4JV5 O;  3WB1 A;  2DW4 A;  5B3S C;  4BWA A;  2B9Z A;  4FJC C;  5A9G A;  4PA9 A;  2F93 B;  1AJQ A;  1SET A;  4I0X B;  1Q5O A;  3TGU H;  4O4J A;  4ZIB A;  3LNN A;  3RFR A;  1YXB A;  4R6Z A;  5LMU B;  3QTC A;  3RYH A;  4H13 B;  1L0L H;  5LHI A;  1KQS U;  2JJ1 G;  2X7R B;  1KD1 W;  1Q3E A;  4B7K A;  5J2T A;  3KCY A;  2PGG A;  2FL4 A;  2EJR A;  3QVN A;  3B8M A;  4E2L A;  2LGW A;  1I94 B;  1P84 F;  4DV3 B;  4G28 B;  5JVD A;  4DW0 A;  2CAZ C;  4EB6 B;  1QLE B;  4UV9 A;  1FJG O;  1TAE A;  1R3K C;  5B1A C;  2JS5 A;  2IJK A;  1DGS A;  5FL7 G;  3SYC A;  4IIJ A;  1BHA A;  4DR6 B;  3K04 A;  2CTW A;  2P4V A;  1KKD A;  3JSN A;  1NJI W;  2F23 A;  1CEZ A;  1JR9 A;  4BIO A;  1VQO V;  1P7B A;  1GTO A;  4MTX A;  2ZCE A;  3CHX A;  1VQL V;  5EC1 C;  5HFL A;  4J9Y B;  3QO7 A;  2ATK C;  2RN9 A;  2CH7 B;  2RJZ A;  2Q7H A;  2QA4 V;  4NVP A;  3W7T A;  5CA0 B;  1YJW V;  1DF4 A;  3CCS V;  2F66 C;  5JWP A;  4LFC O;  1YEW A;  3HPL C;  1XMO O;  4RO2 A;  3CS5 A;  4A5U B;  3I5D A;  1AVM A;  1YF2 A;  2FKX A;  5CB4 B;  2EIM C;  4DK0 A;  2HFE C;  4GX0 A;  3K3W A;  3OAA G;  3G4S V;  2UU9 B;  1SS3 A;  4PA3 A;  3M8A A;  1L1F A;  4CC6 A;  1VQ8 V;  1IUR A;  5JH7 A;  3DC6 A;  2W6J G;  3RT3 C;  2YIB D;  4I55 A;  1V55 C;  2PUS A;  4PD4 F;  2Y4U A;  4DV5 B;  4KHP B;  1KB9 F;  4TQF A;  3IC7 A;  3CCV V;  4ZKI A;  3WU2 Z;  4J80 A;  2IJI A;  3T2M A;  3K9S A;  4L87 A;  4DR3 O;  1P4R A;  4YY3 B;  3NR7 A;  4GZR B;  1OCC B;  4JI7 B;  4MW8 A;  1JA8 A;  4RUF A;  3RYI B;  1G1X B;  3DXR B;  4GT1 A;  5LA6 B;  4U3J B;  4FZ1 A;  4YIP A;  1Q8I A;  3QO5 A;  1AP6 A;  1W59 A;  1F23 A;  4B7E A;  4FK5 C;  1YTF B;  4DR2 B;  1CP9 A;  3BEH A;  5LMU O;  2OCC B;  1BE3 H;  4H0L B;  1NKD A;  3UQ8 A;  2DJV A;  1WA8 B;  3Q4H B;  3FB8 C;  2DYR C;  3P32 A;  3WG7 B;  1FXK B;  4CH5 A;  1K5S A;  2L6L A;  2WA4 A;  1V54 C;  2G38 A;  1I94 O;  5KAI Z;  1R3L C;  4DV3 O;  1FPO A;  4OXS A;  3DTU B;  4ICG A;  1WLE A;  1OCO C;  4QGP A;  1WP7 A;  1S77 D;  3H1J H;  2L35 A;  3AG2 B;  1EN5 A;  4IL6 Z;  4DR6 O;  3VOU A;  5CA1 B;  4J7J A;  1N34 B;  1RFY A;  3JSL A;  1AJN A;  5KHI A;  1IBL B;  4RQF A;  3F7Y C;  2CTR A;  2XAS A;  2IU0 A;  2UUC B;  1R3I C;  1H38 A;  2DWD C;  2QKS A;  1CXZ B;  2QJ1 A;  5B1B B;  1H8H G;  3ZCC A;  1GM8 A;  2C2A A;  2GDS A;  3PN1 A;  2JRI A;  5BZB A;  1ZUQ A;  4YJ2 B;  2D3O W;  3ZMU A;  4FM0 A;  5IJ9 B;  4GYC B;  5KUM A;  2LO1 A;  2GUZ A;  1E79 G;  1N33 O;  2LFR A;  1OV9 A;  3W7S A;  1R6T A;  2UU9 O;  4MVZ A;  1M5I A;  3ZHS A;  4O2A A;  1O9H A;  3FB7 C;  4CS4 A;  3OT7 A;  5C93 A;  4WFB V;  1L8D A;  4UB6 Z;  1ZL8 A;  3HR0 A;  4JGS A;  4HZ3 A;  2HHH O;  4O4I A;  3CCM V;  1GN3 A;  1N4C A;  5B5E Z;  1E1R G;  1H2M A;  1ROP A;  4KHP O; 
#chains in the Genus database with same CATH homology
 2DYR B;  5B1B C;  1Q81 W;  3IFX A;  1MOF A;  2EIJ C;  4TT3 G;  3CXC U;  2ZR3 A;  1JPX A;  3SJQ C;  3T4Z A;  5IDJ A;  5IY5 C;  4LP8 A;  5GW7 A;  3ZRS A;  1V54 B;  4WFG A;  1S5H C;  3ZJZ A;  1IXM A;  1NVP B;  3CP1 A;  2W6I G;  5EC2 C;  5B1O A;  1NVP D;  2WLI A;  3LNM B;  1DTO A;  1AI6 A;  1GM7 A;  4J9Z B;  2P90 A;  1NBM G;  3A0R A;  5LBQ A;  1VQ4 V;  2XAF A;  5LGT A;  2X6C A;  3EFF K;  4KUM A;  2Y69 C;  2JJ2 G;  3CCE V;  2X6B A;  4N21 A;  2Q68 A;  2Q69 A;  2YEV B;  1AJP A;  1M90 W;  1GK9 A;  4CZZ A;  3GWO A;  4PDL A;  3ML0 A;  1JOY A;  3SPI A;  4HAM A;  4BIZ A;  5L3F A;  3AG1 B;  4QE9 A;  1R6N A;  4HYO A;  2XND G;  4MSW C;  4H33 A;  2Q67 A;  3OUS A;  2EIK C;  5EBW C;  2Y48 A;  4DXW A;  1G4Y B;  4BAY A;  1Q7Y W;  3ASO B;  1S0V A;  1RPR A;  3OR7 C;  1HWY A;  3MHS C;  4WFE A;  4JPR A;  4MT8 A;  1GO3 F;  3EHB B;  1K8A W;  3E8B A;  5EBL C;  5DM6 V;  3OMA B;  3CME V;  1K97 A;  3SYP A;  1Q86 W;  1K33 A;  4UV8 A;  1EZJ A;  1RPO A;  1JCH A;  1M56 B;  1QBZ A;  1QVG U;  1BMF G;  3B8N A;  1FXV A;  3P30 A;  5J9P C;  3FKS G;  4XDK A;  4X8A A;  3ZN1 A;  3RVY A;  3SPG A;  5L3C A;  5L3B A;  4QNH B;  1K34 A;  4R7C A;  1Y66 A;  3CCL V;  4LC1 A;  3TCU A;  1H8E G;  4Q20 A;  1TUE B;  2WAM A;  5IYB O;  1AR1 B;  2Z5U A;  3QO8 A;  3K79 A;  3T1C A;  3AEI A;  1VQ5 V;  4RQE A;  3CPW U;  3OMI B;  3AG1 C;  1I5X A;  3MD0 A;  1GMG A;  3IGA C;  1EFR G;  2F43 G;  5H9C A;  2EIJ B;  1B6Q A;  3OR6 C;  4P2Z A;  3ZMT A;  5IY5 B;  3FB6 C;  1SES A;  1MG1 A;  5H6Q A;  4KFM A;  1K4C C;  1S3J A;  1FS0 G;  2OT5 A;  3E86 A;  3SPJ A;  1SRY A;  3QNE A;  3CMA V;  3NXS A;  2HKO A;  2K1E A;  3BY6 A;  2ITC C;  4TWK A;  5KUK A;  1NQT A;  5L3E A;  1VQK V;  1R3J C;  4YXW G;  3E35 A;  3OGC C;  2QEX V;  4DO2 A;  1COW G;  2AHY A;  3JYC A;  1M56 C;  1J95 A;  3ABL C;  1AI5 A;  4XBF A;  3OMN B;  2V7Q G;  1QR8 A;  2OTL V;  2DQ0 A;  3RVZ A;  1PL0 A;  2XAQ A;  1OZ0 A;  2P7T C;  3OEH G;  2WWW A;  1QVF U;  4MVS A;  3ZMZ A;  3CYO A;  5CA3 A;  2AHZ A;  2X6A A;  2XOK G;  2WSS G;  2DQ3 A;  3TK1 A;  3I56 V;  3JD2 A;  2V1D A;  5E1A C;  1M57 B;  3ABT A;  2KB1 A;  2IH1 C;  2B1I A;  2GSM B;  3VBB A;  3SPC A;  3ETG A;  2ZXW B;  3UM7 A;  1FXK A;  5HFM A;  4JAS A;  4JTC B;  4QE7 A;  5KA6 A;  1K4D C;  3W7X A;  1F4M A;  5IYD O;  2IU3 A;  5B1N A;  5LHH A;  4QJF B;  2FTK A;  3R65 A;  1YJN V;  4FPP A;  4GX5 A;  3E8G A;  5L3D A;  3OFN G;  1PNL A;  3STZ C;  3ZRW A;  1YIJ V;  2ITD C;  1W2B U;  2Z3Y A;  3X2Q B;  4MVO A;  3LDC A;  1YJ9 V;  1QR9 A;  1W0K G;  4QPK A;  4WFH A;  3ZN0 A;  4X89 A;  2WLL B;  3AG3 C;  4U7N A;  3SPH A;  2QM7 A;  1K7D A;  3LUT B;  3DGE A;  1NR7 A;  2EIN C;  2WLM A;  1PNM A;  3E83 A;  4PEL A;  4WFA V;  4I9W A;  1GM9 A;  3FYI B;  4P9P A;  3W7W A;  1NH2 B;  3AG4 B;  1QLN A;  2EZO A;  1XL6 A;  3E8H A;  1MAB G;  2WLH A;  1NH2 D;  1K92 A;  2YSU B;  2CK3 G;  1M57 C;  2DW4 A;  2W0F C;  2EIL C;  5B3S C;  4ASU G;  5CBF A;  2Q6A A;  4FJC C;  2ZXW C;  4WCE V;  1ARO P;  4PA9 A;  5IYC O;  1I5Y A;  1JVM A;  3CCQ V;  1AJQ A;  1SET A;  1VQN V;  1MSW D;  2NLJ C;  3ABM B;  4R6Z A;  4MVU A;  3CCU V;  1QCE A;  1RM1 B;  1SER A;  5LHI A;  1LNQ A;  3PJS K;  3ABL B;  1KQS U;  2JJ1 G;  2X7R B;  3ABU A;  1Q82 W;  1Y4M A;  3K0G A;  4JAV A;  2B5U A;  4P30 A;  4UVC A;  2JEX A;  2IJH A;  2M7W A;  1KD1 W;  3X2Q C;  3K0D A;  1G8M A;  2EJR A;  3K08 A;  4BIU A;  3B8M A;  4E2L A;  4X88 A;  4G28 B;  2ZR2 A;  3OM3 B;  1QLE B;  4UV9 A;  1R3K C;  5B1A C;  4WF9 V;  2JIZ G;  2GHY A;  3OE7 G;  2IJK A;  3RW0 A;  5FL7 G;  2EIM B;  3SYC A;  2IW5 A;  3AG4 C;  3JD1 A;  3T4D A;  1KP2 A;  1OCC C;  2EBO A;  2WLI B;  1BHA A;  2BOB C;  3K04 A;  1ORQ C;  1KKD A;  3CC2 V;  2H94 A;  1NJI W;  1CEZ A;  4RUE A;  1KP3 A;  1S72 V;  1OCR C;  1YI2 V;  4MTO A;  5CBH A;  1VQO V;  1P7B A;  3FYE B;  1GTO A;  1V55 B;  4UVB A;  4JF3 A;  4MTX A;  5CN0 A;  1F4N A;  5EBM C;  1VQL V;  1PD3 A;  4PDV A;  4U7O A;  3ABM C;  3K03 A;  5EC1 C;  3JD4 A;  1RM1 C;  5HFL A;  2OCC C;  1NR1 A;  4J9Y B;  3QO7 A;  4JAU A;  2ATK C;  4QIW F;  1KC8 W;  3ZRV A;  1K5Q A;  3CCR V;  2QA4 V;  2QE7 G;  1OHH G;  1DF5 A;  3W7T A;  4LBE C;  4G2K A;  5EK0 A;  1DF4 A;  1YJW V;  3KG2 A;  2DYS B;  3AG3 B;  2WLK A;  3WG7 C;  5LGN A;  1FXK C;  2A79 B;  3CCS V;  4GX2 A;  3ETE A;  2XAJ A;  2EIN B;  1K3E A;  3HPL C;  1N8R W;  3OEE G;  4RO2 A;  1QLE C;  3STL C;  5L3G A;  1YIT V;  2EIM C;  3JCZ A;  4JYC A;  5LHG A;  3E2E A;  2HFE C;  4GX0 A;  1F51 A;  4MVR A;  3K3W A;  2EIL B;  5B3S B;  2XAG A;  1YSC A;  3OAA G;  3G4S V;  3CC7 V;  4PA3 A;  3ZMS A;  2PI5 A;  3ABK B;  4ZBM A;  1L1F A;  2WLN A;  2ZQM A;  1VQ8 V;  2PI4 A;  2JK5 C;  2HLD G;  1YHQ V;  2W6J G;  2NNU A;  2ZDI A;  1V55 C;  3TET A;  1WPX A;  1FXH A;  3LDD A;  1XL4 A;  3SYO A;  2LP7 A;  1K9M W;  1KEC A;  3IC7 A;  1JQ0 A;  4MVQ A;  2LFS A;  3D3I A;  1THZ A;  3CCV V;  4ZKI A;  5DN6 G;  2UXN A;  2DYS C;  1BHB A;  2IJI A;  4MTF A;  3T2M A;  3D36 A;  4CBC A;  1VQ7 V;  5B1A B;  1OCZ C;  1OCO B;  3GB7 C;  4L87 A;  1P4R A;  4BW5 A;  1OCC B;  4MW8 A;  3ETD A;  5CBG A;  4RUF A;  2WLJ A;  3F7V C;  3G6E V;  1UJW B;  4UUJ C;  3E89 A;  4JYB A;  3ASN C;  4GT1 A;  1VQ9 V;  2OTJ V;  2WPD G;  1JX9 A;  3ABK C;  1OCR B;  3LSQ A;  3QO5 A;  4PA6 A;  1F23 A;  2QTO A;  4FK5 C;  1YTF B;  1CP9 A;  3BEH A;  4FIP C;  2HG5 C;  2OCC B;  4R8C A;  1NKD A;  2B1G A;  4UXN A;  1YTF D;  2XAH A;  4MVM A;  1S76 D;  2EZP A;  3FB8 C;  2BOC C;  1BL8 A;  2DYR C;  3P32 A;  4GCZ A;  4Z1M G;  3WG7 B;  1FXK B;  1K5S A;  3SYA A;  1V54 C;  2X0L A;  3H01 A;  1R3L C;  3M99 B;  3DTU B;  4OXS A;  3FB5 C;  4H37 A;  1WLE A;  4GX1 A;  2P6J A;  1PNK A;  1OCO C;  2IH3 C;  4FMT A;  1AI7 A;  2DWE C;  1S77 D;  4XDL A;  2IJJ A;  1K73 W;  3AG2 B;  1SZT A;  3ZRW B;  3UKM A;  1EBO A;  3VOU A;  2A9H A;  2H8P C;  1CPY A;  3G71 V;  3JD0 A;  1VQP V;  3ZRX A;  1QQH A;  2MK3 A;  1AJN A;  4MW3 A;  4PDM A;  4WFF A;  4LCU C;  3F7Y C;  4RQF A;  1M1K W;  4JTD B;  2XAS A;  2IU0 A;  3LSS A;  1VQ6 V;  3OUF A;  2HJF C;  1R3I C;  1R73 A;  4R50 A;  1H38 A;  2DWD C;  3K06 A;  2QKS A;  1E1Q G;  4RAI A;  5B1B B;  1VQM V;  1H8H G;  5CMU A;  3JD3 A;  4G27 B;  2JDI G;  2QM8 A;  1GM8 A;  1W0J G;  3K9A A;  3ZCC A;  4UVA A;  2C2A A;  3CD6 V;  2YEV A;  2WLL A;  4I5S A;  2P67 A;  3CCJ V;  1H2G A;  3ASO C;  4XDJ A;  3MHH C;  1OCZ B;  5BZB A;  3SYQ A;  4MTG A;  2D3O W;  2A0L A;  5LGU A;  3ZMU A;  2ZD9 A;  2ZDI C;  3I55 V;  5KUM A;  2UXX A;  1JJ2 U;  3LDE A;  5KA5 A;  1E79 G;  1FFT B;  2LFR A;  4P9O A;  2HR3 A;  3RBZ A;  3HB3 B;  1AI4 A;  3AG2 C;  3ASN B;  1ENV A;  4N23 A;  2Y69 B;  3W7S A;  3CC4 V;  3ZMV A;  4F4L A;  4MVZ A;  1R6K A;  4JTA B;  3OW2 U;  2HVJ C;  3FB7 C;  5C93 A;  4EKW A;  3E8F A;  1DLB A;  4WFB V;  2JEU A;  3ZIA G;  2R9R B;  3F5W C;  4TSF G;  4JGS A;  4HZ3 A;  5H6R A;  1PKX A;  3WFV A;  2R9I A;  4QPJ A;  2HVK C;  3W7U A;  3CCM V;  4PA7 A;  1GKF A;  3B77 A;  1E1R G;  1M9N A;  1ZWI C;  4PDR A;  1ROP A;  4MS2 A;  4PA4 A;  2EIK B;  4KP4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...