The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
18
|
sequence length |
103
|
structure length |
102
|
Chain Sequence |
VRIFAGNDPAHTATGSSGISSPTPALTPLMLDEATGKLVVWDGQKAGSAVGILVLPLEGTETALTYYKSGTFATEAIHWPEVDEHKKANAFAGSALSHAALP
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Kinetic Stability and Crystal Structure of the Viral Capsid Protein SHP.
pubmed doi rcsb |
| molecule keywords |
Head decoration protein
|
| molecule tags |
Viral protein
|
| source organism |
Enterobacteria phage p21
|
| total genus |
18
|
| structure length |
102
|
| sequence length |
103
|
| ec nomenclature | |
| pdb deposition date | 2004-05-21 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF02924 | HDPD | Bacteriophage lambda head decoration protein D |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Beta Barrel | Virus Head Decoration Protein; Chain: A, | Head decoration protein D |
#chains in the Genus database with same CATH superfamily 1TCZ A; 3GQK A; 3GQH A; 1TD4 A; 1VD0 A; 1TD3 A; 3SUC A; 1TD0 A; 1C5E A; #chains in the Genus database with same CATH topology 1TCZ A; 3GQK A; 3GQH A; 1TD4 A; 1VD0 A; 1TD3 A; 3SUC A; 1TD0 A; 1C5E A; #chains in the Genus database with same CATH homology 1TCZ A; 3GQK A; 3GQH A; 1TD4 A; 1VD0 A; 1TD3 A; 3SUC A; 1TD0 A; 1C5E A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...