The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
31
|
sequence length |
76
|
structure length |
76
|
Chain Sequence |
GSTTLKLLRKEIDKIDNQIISLLKKRLEIAQAIGKIKKELNLPIEDRKREEEVLRRAGEFREIFEKILEVSKDVQR
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Conserved hypothetical protein from Pyrococcus furiosus Pfu-1581948-001
rcsb |
| molecule keywords |
chorismate mutase
|
| molecule tags |
Isomerase
|
| source organism |
Pyrococcus furiosus
|
| total genus |
31
|
| structure length |
76
|
| sequence length |
76
|
| ec nomenclature |
ec
5.4.99.5: Chorismate mutase. |
| pdb deposition date | 2004-12-21 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF01817 | CM_2 | Chorismate mutase type II |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Up-down Bundle | Chorismate Mutase Domain, subunit A | Chorismate mutase |
#chains in the Genus database with same CATH superfamily 2W19 C; 3NVT A; 2VKL A; 2GTV X; 3TFC A; 2W1A C; 3HGX A; 3HGW A; 1ECM A; 3RET A; 3RMI A; 2D8E A; 2H9C A; 3REM A; 1YBZ A; 2QBV A; 2D8D A; 5CKX C; 2H9D A; #chains in the Genus database with same CATH topology 2E89 A; 2W19 C; 1WY5 A; 3NVT A; 1NI5 A; 3A2K A; 2VKL A; 2GTV X; 3TFC A; 2E21 A; 2W1A C; 3HGX A; 3HGW A; 1ECM A; 3RET A; 3RMI A; 2D8E A; 2H9C A; 1YBZ A; 3REM A; 2QBV A; 2D8D A; 5CKX C; 2H9D A; #chains in the Genus database with same CATH homology 2W19 C; 3NVT A; 2VKL A; 2GTV X; 3TFC A; 2W1A C; 3HGX A; 3HGW A; 1ECM A; 3RET A; 3RMI A; 2D8E A; 2H9C A; 3REM A; 1YBZ A; 2QBV A; 2D8D A; 5CKX C; 2H9D A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...