1GHHA

Solution structure of dini
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
81
structure length
81
Chain Sequence
b'MRIEVTIAKTSPLPAGAIDALAGELSRRIQYAFPDNEGHVSVRYAAANNLSVIGATKEDKQRISEILQETWESADDWFVSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DAMAGE-INDUCIBLE PROTEIN I
publication title Solution structure of DinI provides insight into its mode of RecA inactivation.
pubmed rcsb
source organism Escherichia coli
molecule tags Protein binding
total genus 22
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2000-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06183 DinI DinI-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.910.10 Alpha Beta 2-Layer Sandwich Protein Binding, DinI Protein; Chain A DinI-like 1ghhA00
1GHHA
chains in the Genus database with same CATH superfamily
4KQTA 4EVXA 3BB7A 1PVJA 1SG2A 1GHHA 1DKIA 1U2MA
chains in the Genus database with same CATH topology
1GHHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GHH A; 
#chains in the Genus database with same CATH topology
 4KQT A;  4EVX A;  3BB7 A;  1PVJ A;  1SG2 A;  1GHH A;  1DKI A;  1U2M A; 
#chains in the Genus database with same CATH homology
 1GHH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...