3BB7A

Structure of prevotella intermedia prointerpain a fragment 39-359 (mutant c154a)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
321
structure length
314
Chain Sequence
ANQLRELKQTHTYTVFGYTDGGFAVISADDLAPELLGVSESNFVETDNPSFKWWLKAIDEVITNAVKSNKPLNVIKPDPSKYAAEVSTLLTTTWGQQMPYNKLLPKTKKGRLITGAVATATAQVLNYFKYPVRGIGSHTVHYPANDPSGVAISADFGNTTYDWANMKDNYSGNYTEAEANAVATLMLHCGVASEMQYGGPNEGSGAYMTDCAAGLRTYFGFTDAEYITRANYTDEQWMDIVFSELTKGHPLIYGGVDAGHAFVIDGYNKAGLVSVNWGWNGDVDGYYKIDLLNPGNMYSFTAEQDMVRGVYGKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords interpain A
publication title A New Autocatalytic Activation Mechanism for Cysteine Proteases Revealed by Prevotella intermedia Interpain A
pubmed doi rcsb
source organism Prevotella intermedia
total genus 89
structure length 314
sequence length 321
ec nomenclature
pdb deposition date 2007-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01640 Peptidase_C10 Peptidase C10 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.910.30 Alpha Beta 2-Layer Sandwich Protein Binding, DinI Protein; Chain A Protein Binding, DinI Protein; Chain A 3bb7A02
3.90.70.50 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 3bb7A01
1DKIA 1PVJA 3BBAA 2JTCA 4D8IA 4D8EA 2UZJA 4D8BA 3BB7A 4RKXA
chains in the Genus database with same CATH superfamily
2P0RA 3AI8A 2CB5A 1TLOA 2ATOA 3CH3X 4MM3B 3V6CA 5KO3A 3QSDA 2BTWA 4N8WA 7PCKA 2DZZA 3H89A 1F29A 1CV8A 4WA6A 4K7CA 1F2AA 3OQCA 2HXZA 3RVVA 1F2CA 4P6GA 1CSBB 1AYUA 4XZXA 2R9MA 3MP2A 3TRKA 1F2BA 3KWZA 1UKFA 1NPZA 3S3RA 3BB7A 4DMYA 3RNVA 2E02A 3BBAA 3H8CA 2J7QA 1QMYA 1POPA 2G8JA 4YV8A 3N3GA 2GFOA 2HWKA 3E1ZB 1PADA 3P5UA 1AECA 3BPMA 4CDDB 1YZBA 1BP4A 3PRMA 3B21A 4G54A 2BU3A 1PIPA 1TU6A 1ME3A 2NQGA 1EWMA 4OVZB 3MORA 3KWBX 2DZYA 2G8EA 3KSEA 4QH6A 3LXSA 4RKXA 4MZOA 2FQ9A 3PHXA 2Y5BA 1EWLA 2DC8A 4X6HA 1GMYA 2OZ2A 2OULA 1GECE 2XU4A 4I04A 1YVBA 3OVXA 2GHUA 5E6JA 1KHPA 2JTCA 1AU4A 4RNAA 1MHWA 1CPJA 2P7UA 3CH2X 3MHSA 5CHTA 1ICFA 4BOZA 1YK8A 4YYRA 1AIMA 2NQIA 4CDFB 1CQDA 1ZCMA 2AYNA 4OVZA 1CJLA 3IV2A 1EF7A 4XUIA 3WXGA 4PP2E 4AXMA 4QRGA 2JRIA 2DCBA 2YJ9A 1VJVA 4IUMA 4YYUA 2AYOA 1U9XA 3MTVA 2YJ2A 1BY8A 2FE8A 2HD5A 2PREA 4P16A 2DC9A 5EZQA 2H7JA 1YT7A 2G6DA 4D8EA 4X6JA 1CB5A 2UZJA 4W4UA 8PCHA 1DEUA 1STFE 3KW9A 5CVNB 3O1GA 1S4VA 2NQAA 1BQIA 4A5UA 1QDQA 2Z84A 1AU3A 2AUZA 3PNRA 3PRPA 2PADA 1KHQA 2C0YA 4Q8GA 1ME4A 2XU3A 4I05A 4PT5A 2FO5A 1PE6A 5J94A 3H7DA 4CZWA 2E00A 2DCAA 1FH0A 3MHHA 3OF8A 3KFQA 4D8BA 2DC6A 3U8EA 1U9QX 2AVWA 2FT2A 3OVZA 1PBHA 3IOQA 4CDCB 4BS6A 4REZA 4P6EA 5EGWA 2PBHA 3ZNHA 4BOQA 2AU1A 4HXDB 3I3TA 3OF9A 2FYEA 1Q6KA 1KXRA 3BOWA 3IHPA 3K9MA 4BQVA 3KKUA 2B1MA 3MTNA 3B79A 1XKGA 4KLBA 2G7YA 4PI3A 4BPVA 4IP3A 2WBFX 1ITOA 3IFUA 4N79A 3N3KA 2VHSA 1NQCA 4W5CA 3P5XA 4XR7A 5A24A 4YVAA 4MZSA 2AS8A 2JQGR 1ZIVA 4ZUXU 2FTDA 3CBKA 3ERVA 1U2MA 4FIPA 3MJ5A 2NQDB 4BOUA 5F02A 3HWNA 2YJ8A 3K24A 1X9YA 1M6DA 3RVWA 4OW0A 5JA7A 1VSNA 2Y6EA 4HWYA 3TMPA 3PT2A 3LFYA 2P86A 1ATKA 3IMAA 4D8IA 2OP3A 1MS6A 1GHHA 5CVMA 2O6XA 1NB5A 4BSQA 1MDWA 4KQTA 1YK7A 5EF4A 1BGOA 3USVA 3P5WA 1PVJA 2PNSA 1EWPA 2YJCA 4R3DA 4OEMA 2DCDA 4QRVA 1JQPA 3PW3A 3ZUAA 5CHVA 1PPPA 4YYQA 5FPWA 3P5VA 2FRQA 1QXPA 2AUXA 1KFUL 4MI7A 4N4ZA 3HHIA 2HHNA 1U9WA 3H6SA 3N4CA 3QT4A 2FUDA 1CVZA 1U9VA 2BDLA 1Y4HA 3KX1A 3BPFA 3PHWA 2E03A 1PCIA 1A6RA 1EWOA 6PADA 4W5BA 2ARYA 4AXLA 1AYVA 2VHFA 3F75A 3E9SA 3DF0A 1HUCB 3M99A 1K3BB 3WXFA 4YYWA 1GLOA 1MEGA 2R6NA 2R9FA 2F1GA 1THEA 1PPNA 2JQFR 3RVXA 1AU0A 1TL9A 5CVOB 1AYWA 2R9NA 5EZSA 2YJBA 3PDFA 3CBJA 2IBIA 1PXVA 3PBHA 4MSXA 3H8BA 3NHEA 1PPOA 3O0UA 5K16A 1DF0A 3HHAA 4I07A 3OISA 3IUTA 3V6EA 1GCBA 3C0RA 2ACTA 3I06A 2DJGB 1NLJA 4EVXA 3W30A 2HH5A 3IEJA 3HD3A 3K8UA 4X6IA 4YYSA 4CDEB 3QJ3A 4DMXA 1MEMA 1MIRA 3WXEA 4BS5A 2F7DA 4PP1A 3W31A 1PPDA 2BDZA 4BOPA 1SNKA 2AGAA 1NL6A 1KFXL 2IPPB 4PADA 2AIMA 2DCCA 3BY4A 4Q8HA 1IWDA 5JZEA 1NB3A 4GUAA 3TNXA 1CTEA 1DKIA 2R9OA 2DC7A 4WURA 2E01A 3PHUA 4RF0A 3F5VA 1CS8A 2R9CA 2DJFB 1YALA 3BC3A 4M0WA 4QRXA 9PAPA 2BTWB 3D6SA 2CIOA 1O0EA 4RY2A 2B1NA 1U5IA 4OELA 2XU5A 3GCBA 3BCNA 4FK5A 3BWKA 1Y08A 5JH3A 3O65A 1SG2A 4ZTBA 2FRAA 2J7QC 1AU2A 5PADA 3S3QA 1QOLA 4FJCA 4RF1A 4BOSA 2DOSA 4YYVA 1SP4B 3PSEA 4QBBA 2XU1A 3C9EA
chains in the Genus database with same CATH topology
4IP3A 4OVZA 3IFUA 5EZSA 4MM3B 5KO3A 2BTWA 2JRIA 4IUMA 3MTVA 2FE8A 3OQCA 3MJ5A 4BOUA 3C0RA 4P16A 4XZXA 4EVXA 5EZQA 3W30A 4OW0A 3MP2A 3TMPA 3TRKA 3PT2A 1UKFA 3BB7A 3RNVA 3W31A 3BBAA 4D8IA 4D8EA 2UZJA 2J7QA 4BOPA 2AGAA 1PVJA 3BY4A 4R3DA 2HWKA 4A5UA 5JZEA 4GUAA 1DKIA 2Z84A 4WURA 3PHUA 4RF0A 1YZBA 3PRPA 3PRMA 3B21A 2BU3A 4PT5A 4MI7A 4M0WA 4OVZB 4D8BA 4RKXA 2BTWB 3PHXA 4REZA 3ZNHA 3PHWA 4BOQA 3O65A 5E6JA 4HXDB 4ZTBA 2JTCA 2J7QC 4RNAA 4RF1A 3E9SA 4BOSA 2DOSA 3PSEA 4BOZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DKI A;  1PVJ A;  3BBA A;  2JTC A;  4D8I A;  4D8E A;  2UZJ A;  4D8B A;  3BB7 A;  4RKX A; 
#chains in the Genus database with same CATH topology
 2P0R A;  3AI8 A;  2CB5 A;  1TLO A;  2ATO A;  3CH3 X;  4MM3 B;  3V6C A;  5KO3 A;  3QSD A;  2BTW A;  4N8W A;  7PCK A;  2DZZ A;  3H89 A;  1F29 A;  1CV8 A;  4WA6 A;  4K7C A;  1F2A A;  3OQC A;  2HXZ A;  3RVV A;  1F2C A;  4P6G A;  1CSB B;  1AYU A;  4XZX A;  2R9M A;  3MP2 A;  3TRK A;  1F2B A;  3KWZ A;  1UKF A;  1NPZ A;  3S3R A;  3BB7 A;  4DMY A;  3RNV A;  2E02 A;  3BBA A;  3H8C A;  2J7Q A;  1QMY A;  1POP A;  2G8J A;  4YV8 A;  3N3G A;  2GFO A;  2HWK A;  3E1Z B;  1PAD A;  3P5U A;  1AEC A;  3BPM A;  4CDD B;  1YZB A;  1BP4 A;  3PRM A;  3B21 A;  4G54 A;  2BU3 A;  1PIP A;  1TU6 A;  1ME3 A;  2NQG A;  1EWM A;  4OVZ B;  3MOR A;  3KWB X;  2DZY A;  2G8E A;  3KSE A;  4QH6 A;  3LXS A;  4RKX A;  4MZO A;  2FQ9 A;  3PHX A;  2Y5B A;  1EWL A;  2DC8 A;  4X6H A;  1GMY A;  2OZ2 A;  2OUL A;  1GEC E;  2XU4 A;  4I04 A;  1YVB A;  3OVX A;  2GHU A;  5E6J A;  1KHP A;  2JTC A;  1AU4 A;  4RNA A;  1MHW A;  1CPJ A;  2P7U A;  3CH2 X;  3MHS A;  5CHT A;  1ICF A;  4BOZ A;  1YK8 A;  4YYR A;  1AIM A;  2NQI A;  4CDF B;  1CQD A;  1ZCM A;  2AYN A;  4OVZ A;  1CJL A;  3IV2 A;  1EF7 A;  4XUI A;  3WXG A;  4PP2 E;  4AXM A;  4QRG A;  2JRI A;  2DCB A;  2YJ9 A;  1VJV A;  4IUM A;  4YYU A;  2AYO A;  1U9X A;  3MTV A;  2YJ2 A;  1BY8 A;  2FE8 A;  2HD5 A;  2PRE A;  4P16 A;  2DC9 A;  5EZQ A;  2H7J A;  1YT7 A;  2G6D A;  4D8E A;  4X6J A;  1CB5 A;  2UZJ A;  4W4U A;  8PCH A;  1DEU A;  1STF E;  3KW9 A;  5CVN B;  3O1G A;  1S4V A;  2NQA A;  1BQI A;  4A5U A;  1QDQ A;  2Z84 A;  1AU3 A;  2AUZ A;  3PNR A;  3PRP A;  2PAD A;  1KHQ A;  2C0Y A;  4Q8G A;  1ME4 A;  2XU3 A;  4I05 A;  4PT5 A;  2FO5 A;  1PE6 A;  5J94 A;  3H7D A;  4CZW A;  2E00 A;  2DCA A;  1FH0 A;  3MHH A;  3OF8 A;  3KFQ A;  4D8B A;  2DC6 A;  3U8E A;  1U9Q X;  2AVW A;  2FT2 A;  3OVZ A;  1PBH A;  3IOQ A;  4CDC B;  4BS6 A;  4REZ A;  4P6E A;  5EGW A;  2PBH A;  3ZNH A;  4BOQ A;  2AU1 A;  4HXD B;  3I3T A;  3OF9 A;  2FYE A;  1Q6K A;  1KXR A;  3BOW A;  3IHP A;  3K9M A;  4BQV A;  3KKU A;  2B1M A;  3MTN A;  3B79 A;  1XKG A;  4KLB A;  2G7Y A;  4PI3 A;  4BPV A;  4IP3 A;  2WBF X;  1ITO A;  3IFU A;  4N79 A;  3N3K A;  2VHS A;  1NQC A;  4W5C A;  3P5X A;  4XR7 A;  5A24 A;  4YVA A;  4MZS A;  2AS8 A;  2JQG R;  1ZIV A;  4ZUX U;  2FTD A;  3CBK A;  3ERV A;  1U2M A;  4FIP A;  3MJ5 A;  2NQD B;  4BOU A;  5F02 A;  3HWN A;  2YJ8 A;  3K24 A;  1X9Y A;  1M6D A;  3RVW A;  4OW0 A;  5JA7 A;  1VSN A;  2Y6E A;  4HWY A;  3TMP A;  3PT2 A;  3LFY A;  2P86 A;  1ATK A;  3IMA A;  4D8I A;  2OP3 A;  1MS6 A;  1GHH A;  5CVM A;  2O6X A;  1NB5 A;  4BSQ A;  1MDW A;  4KQT A;  1YK7 A;  5EF4 A;  1BGO A;  3USV A;  3P5W A;  1PVJ A;  2PNS A;  1EWP A;  2YJC A;  4R3D A;  4OEM A;  2DCD A;  4QRV A;  1JQP A;  3PW3 A;  3ZUA A;  5CHV A;  1PPP A;  4YYQ A;  5FPW A;  3P5V A;  2FRQ A;  1QXP A;  2AUX A;  1KFU L;  4MI7 A;  4N4Z A;  3HHI A;  2HHN A;  1U9W A;  3H6S A;  3N4C A;  3QT4 A;  2FUD A;  1CVZ A;  1U9V A;  2BDL A;  1Y4H A;  3KX1 A;  3BPF A;  3PHW A;  2E03 A;  1PCI A;  1A6R A;  1EWO A;  6PAD A;  4W5B A;  2ARY A;  4AXL A;  1AYV A;  2VHF A;  3F75 A;  3E9S A;  3DF0 A;  1HUC B;  3M99 A;  1K3B B;  3WXF A;  4YYW A;  1GLO A;  1MEG A;  2R6N A;  2R9F A;  2F1G A;  1THE A;  1PPN A;  2JQF R;  3RVX A;  1AU0 A;  1TL9 A;  5CVO B;  1AYW A;  2R9N A;  5EZS A;  2YJB A;  3PDF A;  3CBJ A;  2IBI A;  1PXV A;  3PBH A;  4MSX A;  3H8B A;  3NHE A;  1PPO A;  3O0U A;  5K16 A;  1DF0 A;  3HHA A;  4I07 A;  3OIS A;  3IUT A;  3V6E A;  1GCB A;  3C0R A;  2ACT A;  3I06 A;  2DJG B;  1NLJ A;  4EVX A;  3W30 A;  2HH5 A;  3IEJ A;  3HD3 A;  3K8U A;  4X6I A;  4YYS A;  4CDE B;  3QJ3 A;  4DMX A;  1MEM A;  1MIR A;  3WXE A;  4BS5 A;  2F7D A;  4PP1 A;  3W31 A;  1PPD A;  2BDZ A;  4BOP A;  1SNK A;  2AGA A;  1NL6 A;  1KFX L;  2IPP B;  4PAD A;  2AIM A;  2DCC A;  3BY4 A;  4Q8H A;  1IWD A;  5JZE A;  1NB3 A;  4GUA A;  3TNX A;  1CTE A;  1DKI A;  2R9O A;  2DC7 A;  4WUR A;  2E01 A;  3PHU A;  4RF0 A;  3F5V A;  1CS8 A;  2R9C A;  2DJF B;  1YAL A;  3BC3 A;  4M0W A;  4QRX A;  9PAP A;  2BTW B;  3D6S A;  2CIO A;  1O0E A;  4RY2 A;  2B1N A;  1U5I A;  4OEL A;  2XU5 A;  3GCB A;  3BCN A;  4FK5 A;  3BWK A;  1Y08 A;  5JH3 A;  3O65 A;  1SG2 A;  4ZTB A;  2FRA A;  2J7Q C;  1AU2 A;  5PAD A;  3S3Q A;  1QOL A;  4FJC A;  4RF1 A;  4BOS A;  2DOS A;  4YYV A;  1SP4 B;  3PSE A;  4QBB A;  2XU1 A;  3C9E A; 
#chains in the Genus database with same CATH homology
 4IP3 A;  4OVZ A;  3IFU A;  5EZS A;  4MM3 B;  5KO3 A;  2BTW A;  2JRI A;  4IUM A;  3MTV A;  2FE8 A;  3OQC A;  3MJ5 A;  4BOU A;  3C0R A;  4P16 A;  4XZX A;  4EVX A;  5EZQ A;  3W30 A;  4OW0 A;  3MP2 A;  3TMP A;  3TRK A;  3PT2 A;  1UKF A;  3BB7 A;  3RNV A;  3W31 A;  3BBA A;  4D8I A;  4D8E A;  2UZJ A;  2J7Q A;  4BOP A;  2AGA A;  1PVJ A;  3BY4 A;  4R3D A;  2HWK A;  4A5U A;  5JZE A;  4GUA A;  1DKI A;  2Z84 A;  4WUR A;  3PHU A;  4RF0 A;  1YZB A;  3PRP A;  3PRM A;  3B21 A;  2BU3 A;  4PT5 A;  4MI7 A;  4M0W A;  4OVZ B;  4D8B A;  4RKX A;  2BTW B;  3PHX A;  4REZ A;  3ZNH A;  3PHW A;  4BOQ A;  3O65 A;  5E6J A;  4HXD B;  4ZTB A;  2JTC A;  2J7Q C;  4RNA A;  4RF1 A;  3E9S A;  4BOS A;  2DOS A;  3PSE A;  4BOZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...