3BB7A

Structure of prevotella intermedia prointerpain a fragment 39-359 (mutant c154a)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
321
structure length
314
Chain Sequence
ANQLRELKQTHTYTVFGYTDGGFAVISADDLAPELLGVSESNFVETDNPSFKWWLKAIDEVITNAVKSNKPLNVIKPDPSKYAAEVSTLLTTTWGQQMPYNKLLPKTKKGRLITGAVATATAQVLNYFKYPVRGIGSHTVHYPANDPSGVAISADFGNTTYDWANMKDNYSGNYTEAEANAVATLMLHCGVASEMQYGGPNEGSGAYMTDCAAGLRTYFGFTDAEYITRANYTDEQWMDIVFSELTKGHPLIYGGVDAGHAFVIDGYNKAGLVSVNWGWNGDVDGYYKIDLLNPGNMYSFTAEQDMVRGVYGKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A New Autocatalytic Activation Mechanism for Cysteine Proteases Revealed by Prevotella intermedia Interpain A
pubmed doi rcsb
source organism Prevotella intermedia
molecule tags Hydrolase
molecule keywords interpain A
total genus 89
structure length 314
sequence length 321
ec nomenclature
pdb deposition date 2007-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01640 Peptidase_C10 Peptidase C10 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.910.30 Alpha Beta 2-Layer Sandwich Protein Binding, DinI Protein; Chain A Protein Binding, DinI Protein; Chain A 3bb7A02
3.90.70.50 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 3bb7A01
4D8IA 1PVJA 3BB7A 2JTCA 4RKXA 1DKIA 2UZJA 4D8EA 4D8BA 3BBAA
chains in the Genus database with same CATH superfamily
3C0RA 3TRKA 1TU6A 1KXRA 2JQGR 1U5IA 1ITOA 2DOSA 4CDDB 1PPNA 4KQTA 2R9CA 2BTWB 5JA7A 1GLOA 4YYSA 4CDFB 1QDQA 2NQIA 4RF1A 3RVWA 4RF0A 4MI7A 3BOWA 5J94A 1NPZA 4FK5A 4K7CA 3W30A 2AYOA 4PT5A 7PCKA 2PBHA 4IP3A 4AXLA 1F2AA 3BC3A 3PSEA 4WA6A 3PHWA 4MM3B 3PRMA 1F2BA 2YJBA 1M6DA 4PP2E 1EWLA 2ACTA 2DJFB 1HUCB 3WXEA 1AU0A 3N4CA 2F7DA 5PADA 2YJ9A 4D8EA 3MTVA 3M99A 3NHEA 2GFOA 2PREA 4YYVA 4P6EA 4Q8GA 2O6XA 4RY2A 4AXMA 2H7JA 4ZTBA 1DF0A 2AVWA 3BBAA 2BDZA 5CHVA 2DCAA 4BSQA 3OF9A 4CZWA 1PADA 1ATKA 4OVZB 2FE8A 4BS5A 1KHQA 3P5XA 4QBBA 5EF4A 1O0EA 3P5VA 4HWYA 4XUIA 2DCBA 1YT7A 1PIPA 1CV8A 2VHSA 1AIMA 1AYVA 3TMPA 3BCNA 1BP4A 3ERVA 3PBHA 1GMYA 3IHPA 3W31A 3IUTA 3E1ZB 3PHUA 2DZZA 3HHIA 1CJLA 1SNKA 4D8IA 2CB5A 2FT2A 1U2MA 2FYEA 1BQIA 1F29A 2R9MA 1DKIA 2E00A 3RNVA 4YVAA 3V6EA 4BOPA 1PBHA 1PPDA 2AUXA 1ME3A 1EWOA 4QRGA 5CVNB 2DC8A 9PAPA 2G8JA 4BOUA 1YK8A 2OZ2A 4BPVA 3CBKA 2B1NA 2BTWA 2FRQA 4D8BA 5F02A 4QH6A 3V6CA 1CVZA 1K3BB 1ZCMA 2G7YA 2AGAA 2AS8A 3MTNA 3MHHA 1CB5A 1QOLA 3O1GA 1X9YA 1MIRA 1U9XA 1YK7A 3F75A 4MZOA 3OQCA 4N8WA 4X6IA 3H89A 1MEMA 5CVOB 3HHAA 2BDLA 4M0WA 1NB3A 3LXSA 3IV2A 2DCDA 2AYNA 5E6JA 1CSBB 2P86A 3QJ3A 3AI8A 4N79A 3CH2X 3GCBA 2NQDB 3LFYA 1A6RA 1PE6A 3C9EA 3HWNA 2G8EA 3QSDA 3BY4A 1POPA 4FJCA 4IUMA 1UKFA 4XZXA 5K16A 1QXPA 2OULA 4MZSA 3DF0A 4I05A 2IPPB 3OISA 1PPOA 2J7QA 4W4UA 3OF8A 1EWPA 1GECE 3O0UA 1F2CA 5CHTA 3USVA 1JQPA 5EZQA 3F5VA 2WBFX 1MEGA 1AU2A 2UZJA 2JQFR 3RVXA 1YVBA 4ZUXU 1PVJA 2NQAA 4DMYA 1YZBA 4PI3A 4BOSA 3PT2A 1TL9A 2YJ2A 2E03A 3I3TA 3BB7A 4YV8A 3BWKA 2ATOA 1MS6A 2FRAA 3B79A 5A24A 4DMXA 2DC6A 4QRVA 4OVZA 1KHPA 2Y5BA 1FH0A 4I04A 1AU4A 2G6DA 2FQ9A 1DEUA 1Q6KA 3PRPA 3BPFA 2AU1A 3PDFA 2CIOA 2HD5A 4FIPA 4P16A 3CH3X 2FO5A 4BS6A 2DJGB 1Y4HA 2AIMA 3BPMA 3PHXA 2XU1A 4PP1A 3WXGA 4PADA 2NQGA 2R9OA 2JRIA 3PNRA 3KKUA 3N3KA 2Z84A 1PPPA 3ZNHA 2DCCA 3I06A 3ZUAA 2P0RA 3D6SA 4CDCB 4YYQA 4YYRA 4CDEB 4XR7A 1MDWA 2AUZA 3S3RA 1THEA 3K8UA 1XKGA 1ZIVA 3MHSA 2DC7A 2PADA 1U9QX 4OEMA 3N3GA 3E9SA 1QMYA 4N4ZA 1NLJA 4KLBA 2R6NA 1AYUA 2YJ8A 2HWKA 1MHWA 3P5UA 5CVMA 3S3QA 4X6JA 3CBJA 5EZSA 1S4VA 4BQVA 5KO3A 3B21A 1ME4A 3K9MA 3H6SA 4YYUA 2DC9A 3IFUA 1BY8A 3WXFA 1EWMA 4HXDB 2GHUA 2XU4A 2HHNA 4X6HA 1AECA 1GCBA 3P5WA 1NL6A 3MJ5A 3PW3A 4RNAA 1KFUL 4BOQA 2YJCA 3OVXA 3KWZA 4R3DA 1VSNA 4EVXA 3O65A 8PCHA 5EGWA 1STFE 2C0YA 1CS8A 4P6GA 4GUAA 4A5UA 3MORA 3H8CA 1U9WA 1PCIA 5JZEA 2ARYA 3H7DA 2OP3A 1ICFA 3U8EA 4YYWA 2FUDA 1SG2A 2PNSA 5FPWA 2Y6EA 3KSEA 1Y08A 2B1MA 2VHFA 2XU3A 3OVZA 1SP4B 4I07A 4W5CA 3K24A 4BOZA 4MSXA 1KFXL 2HXZA 2JTCA 1PXVA 2DZYA 1EF7A 1CTEA 1CPJA 1TLOA 3TNXA 1IWDA 3RVVA 2BU3A 4OW0A 2IBIA 2FTDA 4W5BA 4WURA 1BGOA 4Q8HA 2E02A 3H8BA 1NB5A 1AYWA 2P7UA 4REZA 2XU5A 3KW9A 3KX1A 1AU3A 1U9VA 3IOQA 4QRXA 3IMAA 4OELA 5JH3A 2J7QC 1GHHA 4RKXA 2E01A 2R9FA 2R9NA 3MP2A 3QT4A 1NQCA 3KFQA 2F1GA 1VJVA 4G54A 2HH5A 3IEJA 6PADA 3HD3A 1CQDA 3KWBX 1YALA
chains in the Genus database with same CATH topology
5E6JA 5JZEA 2J7QA 2HWKA 2JRIA 3C0RA 4RF1A 2JTCA 2Z84A 3TRKA 4OVZB 3MJ5A 2FE8A 3W31A 3ZNHA 4RF0A 4MI7A 2J7QC 4RNAA 4BOQA 5EZSA 4OVZA 5EZQA 4RKXA 3PHUA 4M0WA 2BU3A 4OW0A 4R3DA 3PRMA 5KO3A 3B21A 2UZJA 4BOUA 4D8EA 3MTVA 3W30A 3MP2A 4PT5A 4EVXA 2DOSA 4WURA 1PVJA 3O65A 3BY4A 3IFUA 3OQCA 4D8IA 1YZBA 4IUMA 1DKIA 4IP3A 1UKFA 2BTWA 3PRPA 4XZXA 3RNVA 4BOSA 4D8BA 3PT2A 4P16A 4HXDB 4MM3B 2BTWB 3BB7A 3E9SA 3PSEA 4GUAA 4BOPA 4A5UA 4REZA 4ZTBA 3TMPA 3PHWA 2AGAA 3PHXA 3BBAA 4BOZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D8I A;  1PVJ A;  3BB7 A;  2JTC A;  4RKX A;  1DKI A;  2UZJ A;  4D8E A;  4D8B A;  3BBA A; 
#chains in the Genus database with same CATH topology
 3C0R A;  3TRK A;  1TU6 A;  1KXR A;  2JQG R;  1U5I A;  1ITO A;  2DOS A;  4CDD B;  1PPN A;  4KQT A;  2R9C A;  2BTW B;  5JA7 A;  1GLO A;  4YYS A;  4CDF B;  1QDQ A;  2NQI A;  4RF1 A;  3RVW A;  4RF0 A;  4MI7 A;  3BOW A;  5J94 A;  1NPZ A;  4FK5 A;  4K7C A;  3W30 A;  2AYO A;  4PT5 A;  7PCK A;  2PBH A;  4IP3 A;  4AXL A;  1F2A A;  3BC3 A;  3PSE A;  4WA6 A;  3PHW A;  4MM3 B;  3PRM A;  1F2B A;  2YJB A;  1M6D A;  4PP2 E;  1EWL A;  2ACT A;  2DJF B;  1HUC B;  3WXE A;  1AU0 A;  3N4C A;  2F7D A;  5PAD A;  2YJ9 A;  4D8E A;  3MTV A;  3M99 A;  3NHE A;  2GFO A;  2PRE A;  4YYV A;  4P6E A;  4Q8G A;  2O6X A;  4RY2 A;  4AXM A;  2H7J A;  4ZTB A;  1DF0 A;  2AVW A;  3BBA A;  2BDZ A;  5CHV A;  2DCA A;  4BSQ A;  3OF9 A;  4CZW A;  1PAD A;  1ATK A;  4OVZ B;  2FE8 A;  4BS5 A;  1KHQ A;  3P5X A;  4QBB A;  5EF4 A;  1O0E A;  3P5V A;  4HWY A;  4XUI A;  2DCB A;  1YT7 A;  1PIP A;  1CV8 A;  2VHS A;  1AIM A;  1AYV A;  3TMP A;  3BCN A;  1BP4 A;  3ERV A;  3PBH A;  1GMY A;  3IHP A;  3W31 A;  3IUT A;  3E1Z B;  3PHU A;  2DZZ A;  3HHI A;  1CJL A;  1SNK A;  4D8I A;  2CB5 A;  2FT2 A;  1U2M A;  2FYE A;  1BQI A;  1F29 A;  2R9M A;  1DKI A;  2E00 A;  3RNV A;  4YVA A;  3V6E A;  4BOP A;  1PBH A;  1PPD A;  2AUX A;  1ME3 A;  1EWO A;  4QRG A;  5CVN B;  2DC8 A;  9PAP A;  2G8J A;  4BOU A;  1YK8 A;  2OZ2 A;  4BPV A;  3CBK A;  2B1N A;  2BTW A;  2FRQ A;  4D8B A;  5F02 A;  4QH6 A;  3V6C A;  1CVZ A;  1K3B B;  1ZCM A;  2G7Y A;  2AGA A;  2AS8 A;  3MTN A;  3MHH A;  1CB5 A;  1QOL A;  3O1G A;  1X9Y A;  1MIR A;  1U9X A;  1YK7 A;  3F75 A;  4MZO A;  3OQC A;  4N8W A;  4X6I A;  3H89 A;  1MEM A;  5CVO B;  3HHA A;  2BDL A;  4M0W A;  1NB3 A;  3LXS A;  3IV2 A;  2DCD A;  2AYN A;  5E6J A;  1CSB B;  2P86 A;  3QJ3 A;  3AI8 A;  4N79 A;  3CH2 X;  3GCB A;  2NQD B;  3LFY A;  1A6R A;  1PE6 A;  3C9E A;  3HWN A;  2G8E A;  3QSD A;  3BY4 A;  1POP A;  4FJC A;  4IUM A;  1UKF A;  4XZX A;  5K16 A;  1QXP A;  2OUL A;  4MZS A;  3DF0 A;  4I05 A;  2IPP B;  3OIS A;  1PPO A;  2J7Q A;  4W4U A;  3OF8 A;  1EWP A;  1GEC E;  3O0U A;  1F2C A;  5CHT A;  3USV A;  1JQP A;  5EZQ A;  3F5V A;  2WBF X;  1MEG A;  1AU2 A;  2UZJ A;  2JQF R;  3RVX A;  1YVB A;  4ZUX U;  1PVJ A;  2NQA A;  4DMY A;  1YZB A;  4PI3 A;  4BOS A;  3PT2 A;  1TL9 A;  2YJ2 A;  2E03 A;  3I3T A;  3BB7 A;  4YV8 A;  3BWK A;  2ATO A;  1MS6 A;  2FRA A;  3B79 A;  5A24 A;  4DMX A;  2DC6 A;  4QRV A;  4OVZ A;  1KHP A;  2Y5B A;  1FH0 A;  4I04 A;  1AU4 A;  2G6D A;  2FQ9 A;  1DEU A;  1Q6K A;  3PRP A;  3BPF A;  2AU1 A;  3PDF A;  2CIO A;  2HD5 A;  4FIP A;  4P16 A;  3CH3 X;  2FO5 A;  4BS6 A;  2DJG B;  1Y4H A;  2AIM A;  3BPM A;  3PHX A;  2XU1 A;  4PP1 A;  3WXG A;  4PAD A;  2NQG A;  2R9O A;  2JRI A;  3PNR A;  3KKU A;  3N3K A;  2Z84 A;  1PPP A;  3ZNH A;  2DCC A;  3I06 A;  3ZUA A;  2P0R A;  3D6S A;  4CDC B;  4YYQ A;  4YYR A;  4CDE B;  4XR7 A;  1MDW A;  2AUZ A;  3S3R A;  1THE A;  3K8U A;  1XKG A;  1ZIV A;  3MHS A;  2DC7 A;  2PAD A;  1U9Q X;  4OEM A;  3N3G A;  3E9S A;  1QMY A;  4N4Z A;  1NLJ A;  4KLB A;  2R6N A;  1AYU A;  2YJ8 A;  2HWK A;  1MHW A;  3P5U A;  5CVM A;  3S3Q A;  4X6J A;  3CBJ A;  5EZS A;  1S4V A;  4BQV A;  5KO3 A;  3B21 A;  1ME4 A;  3K9M A;  3H6S A;  4YYU A;  2DC9 A;  3IFU A;  1BY8 A;  3WXF A;  1EWM A;  4HXD B;  2GHU A;  2XU4 A;  2HHN A;  4X6H A;  1AEC A;  1GCB A;  3P5W A;  1NL6 A;  3MJ5 A;  3PW3 A;  4RNA A;  1KFU L;  4BOQ A;  2YJC A;  3OVX A;  3KWZ A;  4R3D A;  1VSN A;  4EVX A;  3O65 A;  8PCH A;  5EGW A;  1STF E;  2C0Y A;  1CS8 A;  4P6G A;  4GUA A;  4A5U A;  3MOR A;  3H8C A;  1U9W A;  1PCI A;  5JZE A;  2ARY A;  3H7D A;  2OP3 A;  1ICF A;  3U8E A;  4YYW A;  2FUD A;  1SG2 A;  2PNS A;  5FPW A;  2Y6E A;  3KSE A;  1Y08 A;  2B1M A;  2VHF A;  2XU3 A;  3OVZ A;  1SP4 B;  4I07 A;  4W5C A;  3K24 A;  4BOZ A;  4MSX A;  1KFX L;  2HXZ A;  2JTC A;  1PXV A;  2DZY A;  1EF7 A;  1CTE A;  1CPJ A;  1TLO A;  3TNX A;  1IWD A;  3RVV A;  2BU3 A;  4OW0 A;  2IBI A;  2FTD A;  4W5B A;  4WUR A;  1BGO A;  4Q8H A;  2E02 A;  3H8B A;  1NB5 A;  1AYW A;  2P7U A;  4REZ A;  2XU5 A;  3KW9 A;  3KX1 A;  1AU3 A;  1U9V A;  3IOQ A;  4QRX A;  3IMA A;  4OEL A;  5JH3 A;  2J7Q C;  1GHH A;  4RKX A;  2E01 A;  2R9F A;  2R9N A;  3MP2 A;  3QT4 A;  1NQC A;  3KFQ A;  2F1G A;  1VJV A;  4G54 A;  2HH5 A;  3IEJ A;  6PAD A;  3HD3 A;  1CQD A;  3KWB X;  1YAL A; 
#chains in the Genus database with same CATH homology
 5E6J A;  5JZE A;  2J7Q A;  2HWK A;  2JRI A;  3C0R A;  4RF1 A;  2JTC A;  2Z84 A;  3TRK A;  4OVZ B;  3MJ5 A;  2FE8 A;  3W31 A;  3ZNH A;  4RF0 A;  4MI7 A;  2J7Q C;  4RNA A;  4BOQ A;  5EZS A;  4OVZ A;  5EZQ A;  4RKX A;  3PHU A;  4M0W A;  2BU3 A;  4OW0 A;  4R3D A;  3PRM A;  5KO3 A;  3B21 A;  2UZJ A;  4BOU A;  4D8E A;  3MTV A;  3W30 A;  3MP2 A;  4PT5 A;  4EVX A;  2DOS A;  4WUR A;  1PVJ A;  3O65 A;  3BY4 A;  3IFU A;  3OQC A;  4D8I A;  1YZB A;  4IUM A;  1DKI A;  4IP3 A;  1UKF A;  2BTW A;  3PRP A;  4XZX A;  3RNV A;  4BOS A;  4D8B A;  3PT2 A;  4P16 A;  4HXD B;  4MM3 B;  2BTW B;  3BB7 A;  3E9S A;  3PSE A;  4GUA A;  4BOP A;  4A5U A;  4REZ A;  4ZTB A;  3TMP A;  3PHW A;  2AGA A;  3PHX A;  3BBA A;  4BOZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...