3BB7A

Structure of prevotella intermedia prointerpain a fragment 39-359 (mutant c154a)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
321
structure length
314
Chain Sequence
ANQLRELKQTHTYTVFGYTDGGFAVISADDLAPELLGVSESNFVETDNPSFKWWLKAIDEVITNAVKSNKPLNVIKPDPSKYAAEVSTLLTTTWGQQMPYNKLLPKTKKGRLITGAVATATAQVLNYFKYPVRGIGSHTVHYPANDPSGVAISADFGNTTYDWANMKDNYSGNYTEAEANAVATLMLHCGVASEMQYGGPNEGSGAYMTDCAAGLRTYFGFTDAEYITRANYTDEQWMDIVFSELTKGHPLIYGGVDAGHAFVIDGYNKAGLVSVNWGWNGDVDGYYKIDLLNPGNMYSFTAEQDMVRGVYGKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A New Autocatalytic Activation Mechanism for Cysteine Proteases Revealed by Prevotella intermedia Interpain A
pubmed doi rcsb
source organism Prevotella intermedia
molecule tags Hydrolase
molecule keywords interpain A
total genus 89
structure length 314
sequence length 321
ec nomenclature
pdb deposition date 2007-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01640 Peptidase_C10 Peptidase C10 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.910.30 Alpha Beta 2-Layer Sandwich Protein Binding, DinI Protein; Chain A Protein Binding, DinI Protein; Chain A 3bb7A02
3.90.70.50 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 3bb7A01
2JTCA 4D8IA 3BB7A 1PVJA 2UZJA 4D8EA 4RKXA 1DKIA 3BBAA 4D8BA
chains in the Genus database with same CATH superfamily
2FO5A 4D8IA 2DCCA 1F2AA 1CTEA 3OVZA 1AU2A 3AI8A 2E00A 3ZUAA 4BS5A 2AGAA 3IUTA 4HXDB 4X6JA 2F1GA 3V6CA 2JQGR 1AECA 1Q6KA 4YYUA 2BTWB 4A5UA 1IWDA 1ICFA 1QMYA 1YT7A 2Y6EA 1ME4A 1KHQA 1STFE 3H7DA 1QXPA 3MHSA 3KWBX 1KFUL 1O0EA 2CB5A 1ME3A 1BP4A 3GCBA 3BCNA 3OVXA 2IBIA 4M0WA 3BPMA 2H7JA 1ZCMA 2AU1A 5EZSA 3ERVA 1NB3A 4X6IA 3I06A 2FYEA 3F5VA 1S4VA 2DCAA 3KX1A 1AYVA 3CH3X 2E02A 3BY4A 1GHHA 2HH5A 2PADA 3PSEA 2AYOA 4X6HA 4YYQA 1CS8A 3HD3A 2NQDB 4DMXA 3B79A 4PI3A 4FJCA 2HD5A 4RKXA 1Y4HA 3P5UA 4IP3A 2B1MA 3PW3A 2DCBA 1CQDA 3O0UA 3HWNA 2DC9A 4QRGA 3TNXA 5A24A 1PPOA 3U8EA 2R9NA 4YYWA 2R6NA 1EWPA 1BY8A 1TL9A 4BPVA 2ATOA 2J7QA 2P86A 2BDZA 2DZYA 3BOWA 1U2MA 4RY2A 1CJLA 3OISA 2FE8A 2J7QC 3IEJA 4BOQA 3BBAA 3PRPA 4D8BA 1Y08A 5EZQA 1CVZA 1CV8A 4EVXA 3DF0A 1ATKA 7PCKA 3H6SA 2ARYA 5CVNB 4P16A 1YZBA 2E03A 4ZTBA 1SG2A 1AIMA 4Q8HA 4BS6A 2FTDA 1U9QX 4G54A 4OELA 1PXVA 3PRMA 4CDFB 2DZZA 1UKFA 5E6JA 3E1ZB 5CHTA 1GECE 3KWZA 5F02A 3PBHA 3LXSA 1NL6A 3IOQA 3PT2A 3KW9A 2DC8A 1MDWA 1XKGA 5J94A 3BPFA 2XU1A 4XR7A 1MIRA 4RF1A 4QRXA 1PE6A 1YVBA 3W30A 3S3RA 4YYSA 4BSQA 3MHHA 2AS8A 1CPJA 2E01A 5FPWA 4P6GA 4I05A 2DCDA 1AU4A 3O1GA 1PIPA 3PHWA 3IV2A 2XU4A 4BOUA 2FRQA 4GUAA 3MTNA 1PPDA 2UZJA 4QH6A 3NHEA 3PDFA 1KHPA 3RVVA 2HHNA 3KFQA 1YALA 5EF4A 2YJCA 2PREA 2WBFX 4PT5A 4FK5A 1SP4B 3BWKA 3QSDA 1TLOA 1EWLA 2B1NA 4MI7A 3IFUA 4I07A 4R3DA 2R9OA 2DJFB 5CVMA 3CBKA 4YVAA 2DOSA 4I04A 1KXRA 3USVA 4CDEB 3IHPA 2YJ9A 3QT4A 1AYWA 1AYUA 3OQCA 2JQFR 4AXMA 4BOSA 3E9SA 3F75A 4W5BA 2HWKA 2AYNA 2JTCA 1NLJA 3N3KA 2PBHA 3I3TA 4BQVA 1ITOA 3LFYA 2YJ8A 3HHAA 3CBJA 4P6EA 2G8JA 3TRKA 4N8WA 1U9WA 4MM3B 1BQIA 3BB7A 1SNKA 2Y5BA 4BOPA 1MHWA 4YV8A 4RF0A 3OF9A 4WA6A 5JH3A 3H8CA 1FH0A 3MTVA 3ZNHA 1GMYA 1F2CA 4XZXA 2FUDA 3BC3A 1QDQA 3KKUA 3V6EA 3RNVA 2NQAA 1U9VA 6PADA 4QBBA 2OZ2A 2C0YA 1AU0A 3S3QA 4D8EA 4HWYA 2R9MA 1GCBA 4MZOA 1THEA 9PAPA 2HXZA 4PADA 5KO3A 3WXGA 3O65A 1GLOA 2R9FA 4PP2E 4W5CA 5PADA 1MEMA 1M6DA 2BTWA 1NQCA 2JRIA 1KFXL 1F29A 1HUCB 4QRVA 5K16A 1YK7A 2G8EA 1PBHA 1EF7A 1MS6A 2P7UA 2XU5A 1BGOA 2IPPB 1DEUA 1CB5A 3W31A 4PP1A 2AUXA 2F7DA 2CIOA 3D6SA 4IUMA 3MORA 1YK8A 2FRAA 2O6XA 1U9XA 8PCHA 3C0RA 4N79A 5CVOB 1POPA 1PCIA 2DJGB 1NPZA 1AU3A 2AUZA 4RNAA 1MEGA 1DF0A 2DC6A 2NQGA 2OULA 3P5WA 3RVWA 3P5XA 3MP2A 1U5IA 3QJ3A 1TU6A 2BDLA 4K7CA 1A6RA 1EWMA 2AIMA 4OEMA 2VHSA 3HHIA 3N4CA 4CDCB 2XU3A 4Q8GA 1K3BB 4ZUXU 1PVJA 3PNRA 3WXEA 2YJ2A 3C9EA 3K8UA 1CSBB 1F2BA 1X9YA 4CZWA 4YYRA 4KQTA 2P0RA 1VJVA 3H89A 4WURA 2GFOA 3KSEA 5JZEA 3OF8A 3P5VA 4XUIA 4OVZA 3TMPA 1NB5A 4KLBA 4OVZB 2AVWA 1EWOA 4REZA 1PPNA 1DKIA 3M99A 2G7YA 3PHUA 3N3GA 5EGWA 3K9MA 2Z84A 1JQPA 3RVXA 3WXFA 4YYVA 3B21A 4BOZA 2ACTA 1VSNA 5JA7A 3IMAA 1QOLA 2FT2A 4DMYA 2G6DA 3PHXA 1PADA 2PNSA 2GHUA 5CHVA 1PPPA 2VHFA 4MZSA 4W4UA 2DC7A 1ZIVA 2OP3A 3MJ5A 3K24A 4AXLA 3CH2X 2YJBA 3H8BA 4FIPA 2R9CA 2FQ9A 2NQIA 4N4ZA 4OW0A 4MSXA 2BU3A 4CDDB
chains in the Genus database with same CATH topology
1UKFA 2JTCA 4RNAA 4D8IA 4RF0A 5E6JA 1PVJA 4PT5A 3W31A 5EZQA 2AGAA 3MTVA 3BY4A 4MI7A 4EVXA 3IFUA 4HXDB 4R3DA 3ZNHA 3PSEA 5KO3A 3MP2A 3PHWA 3O65A 3PHUA 3PT2A 4XZXA 4P16A 4BOUA 4D8BA 2Z84A 4WURA 4IUMA 1YZBA 2DOSA 3MJ5A 4GUAA 4ZTBA 2J7QA 5JZEA 2UZJA 4RKXA 2BTWA 4M0WA 4OVZA 3RNVA 3TMPA 3B21A 2BU3A 4BOZA 3TRKA 3C0RA 2BTWB 4MM3B 2JRIA 4OVZB 4A5UA 3OQCA 4IP3A 2FE8A 3BB7A 2J7QC 3PHXA 3E9SA 4REZA 4OW0A 4RF1A 3PRMA 5EZSA 1DKIA 4BOSA 4BOPA 4BOQA 4D8EA 3BBAA 3W30A 2HWKA 3PRPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JTC A;  4D8I A;  3BB7 A;  1PVJ A;  2UZJ A;  4D8E A;  4RKX A;  1DKI A;  3BBA A;  4D8B A; 
#chains in the Genus database with same CATH topology
 2FO5 A;  4D8I A;  2DCC A;  1F2A A;  1CTE A;  3OVZ A;  1AU2 A;  3AI8 A;  2E00 A;  3ZUA A;  4BS5 A;  2AGA A;  3IUT A;  4HXD B;  4X6J A;  2F1G A;  3V6C A;  2JQG R;  1AEC A;  1Q6K A;  4YYU A;  2BTW B;  4A5U A;  1IWD A;  1ICF A;  1QMY A;  1YT7 A;  2Y6E A;  1ME4 A;  1KHQ A;  1STF E;  3H7D A;  1QXP A;  3MHS A;  3KWB X;  1KFU L;  1O0E A;  2CB5 A;  1ME3 A;  1BP4 A;  3GCB A;  3BCN A;  3OVX A;  2IBI A;  4M0W A;  3BPM A;  2H7J A;  1ZCM A;  2AU1 A;  5EZS A;  3ERV A;  1NB3 A;  4X6I A;  3I06 A;  2FYE A;  3F5V A;  1S4V A;  2DCA A;  3KX1 A;  1AYV A;  3CH3 X;  2E02 A;  3BY4 A;  1GHH A;  2HH5 A;  2PAD A;  3PSE A;  2AYO A;  4X6H A;  4YYQ A;  1CS8 A;  3HD3 A;  2NQD B;  4DMX A;  3B79 A;  4PI3 A;  4FJC A;  2HD5 A;  4RKX A;  1Y4H A;  3P5U A;  4IP3 A;  2B1M A;  3PW3 A;  2DCB A;  1CQD A;  3O0U A;  3HWN A;  2DC9 A;  4QRG A;  3TNX A;  5A24 A;  1PPO A;  3U8E A;  2R9N A;  4YYW A;  2R6N A;  1EWP A;  1BY8 A;  1TL9 A;  4BPV A;  2ATO A;  2J7Q A;  2P86 A;  2BDZ A;  2DZY A;  3BOW A;  1U2M A;  4RY2 A;  1CJL A;  3OIS A;  2FE8 A;  2J7Q C;  3IEJ A;  4BOQ A;  3BBA A;  3PRP A;  4D8B A;  1Y08 A;  5EZQ A;  1CVZ A;  1CV8 A;  4EVX A;  3DF0 A;  1ATK A;  7PCK A;  3H6S A;  2ARY A;  5CVN B;  4P16 A;  1YZB A;  2E03 A;  4ZTB A;  1SG2 A;  1AIM A;  4Q8H A;  4BS6 A;  2FTD A;  1U9Q X;  4G54 A;  4OEL A;  1PXV A;  3PRM A;  4CDF B;  2DZZ A;  1UKF A;  5E6J A;  3E1Z B;  5CHT A;  1GEC E;  3KWZ A;  5F02 A;  3PBH A;  3LXS A;  1NL6 A;  3IOQ A;  3PT2 A;  3KW9 A;  2DC8 A;  1MDW A;  1XKG A;  5J94 A;  3BPF A;  2XU1 A;  4XR7 A;  1MIR A;  4RF1 A;  4QRX A;  1PE6 A;  1YVB A;  3W30 A;  3S3R A;  4YYS A;  4BSQ A;  3MHH A;  2AS8 A;  1CPJ A;  2E01 A;  5FPW A;  4P6G A;  4I05 A;  2DCD A;  1AU4 A;  3O1G A;  1PIP A;  3PHW A;  3IV2 A;  2XU4 A;  4BOU A;  2FRQ A;  4GUA A;  3MTN A;  1PPD A;  2UZJ A;  4QH6 A;  3NHE A;  3PDF A;  1KHP A;  3RVV A;  2HHN A;  3KFQ A;  1YAL A;  5EF4 A;  2YJC A;  2PRE A;  2WBF X;  4PT5 A;  4FK5 A;  1SP4 B;  3BWK A;  3QSD A;  1TLO A;  1EWL A;  2B1N A;  4MI7 A;  3IFU A;  4I07 A;  4R3D A;  2R9O A;  2DJF B;  5CVM A;  3CBK A;  4YVA A;  2DOS A;  4I04 A;  1KXR A;  3USV A;  4CDE B;  3IHP A;  2YJ9 A;  3QT4 A;  1AYW A;  1AYU A;  3OQC A;  2JQF R;  4AXM A;  4BOS A;  3E9S A;  3F75 A;  4W5B A;  2HWK A;  2AYN A;  2JTC A;  1NLJ A;  3N3K A;  2PBH A;  3I3T A;  4BQV A;  1ITO A;  3LFY A;  2YJ8 A;  3HHA A;  3CBJ A;  4P6E A;  2G8J A;  3TRK A;  4N8W A;  1U9W A;  4MM3 B;  1BQI A;  3BB7 A;  1SNK A;  2Y5B A;  4BOP A;  1MHW A;  4YV8 A;  4RF0 A;  3OF9 A;  4WA6 A;  5JH3 A;  3H8C A;  1FH0 A;  3MTV A;  3ZNH A;  1GMY A;  1F2C A;  4XZX A;  2FUD A;  3BC3 A;  1QDQ A;  3KKU A;  3V6E A;  3RNV A;  2NQA A;  1U9V A;  6PAD A;  4QBB A;  2OZ2 A;  2C0Y A;  1AU0 A;  3S3Q A;  4D8E A;  4HWY A;  2R9M A;  1GCB A;  4MZO A;  1THE A;  9PAP A;  2HXZ A;  4PAD A;  5KO3 A;  3WXG A;  3O65 A;  1GLO A;  2R9F A;  4PP2 E;  4W5C A;  5PAD A;  1MEM A;  1M6D A;  2BTW A;  1NQC A;  2JRI A;  1KFX L;  1F29 A;  1HUC B;  4QRV A;  5K16 A;  1YK7 A;  2G8E A;  1PBH A;  1EF7 A;  1MS6 A;  2P7U A;  2XU5 A;  1BGO A;  2IPP B;  1DEU A;  1CB5 A;  3W31 A;  4PP1 A;  2AUX A;  2F7D A;  2CIO A;  3D6S A;  4IUM A;  3MOR A;  1YK8 A;  2FRA A;  2O6X A;  1U9X A;  8PCH A;  3C0R A;  4N79 A;  5CVO B;  1POP A;  1PCI A;  2DJG B;  1NPZ A;  1AU3 A;  2AUZ A;  4RNA A;  1MEG A;  1DF0 A;  2DC6 A;  2NQG A;  2OUL A;  3P5W A;  3RVW A;  3P5X A;  3MP2 A;  1U5I A;  3QJ3 A;  1TU6 A;  2BDL A;  4K7C A;  1A6R A;  1EWM A;  2AIM A;  4OEM A;  2VHS A;  3HHI A;  3N4C A;  4CDC B;  2XU3 A;  4Q8G A;  1K3B B;  4ZUX U;  1PVJ A;  3PNR A;  3WXE A;  2YJ2 A;  3C9E A;  3K8U A;  1CSB B;  1F2B A;  1X9Y A;  4CZW A;  4YYR A;  4KQT A;  2P0R A;  1VJV A;  3H89 A;  4WUR A;  2GFO A;  3KSE A;  5JZE A;  3OF8 A;  3P5V A;  4XUI A;  4OVZ A;  3TMP A;  1NB5 A;  4KLB A;  4OVZ B;  2AVW A;  1EWO A;  4REZ A;  1PPN A;  1DKI A;  3M99 A;  2G7Y A;  3PHU A;  3N3G A;  5EGW A;  3K9M A;  2Z84 A;  1JQP A;  3RVX A;  3WXF A;  4YYV A;  3B21 A;  4BOZ A;  2ACT A;  1VSN A;  5JA7 A;  3IMA A;  1QOL A;  2FT2 A;  4DMY A;  2G6D A;  3PHX A;  1PAD A;  2PNS A;  2GHU A;  5CHV A;  1PPP A;  2VHF A;  4MZS A;  4W4U A;  2DC7 A;  1ZIV A;  2OP3 A;  3MJ5 A;  3K24 A;  4AXL A;  3CH2 X;  2YJB A;  3H8B A;  4FIP A;  2R9C A;  2FQ9 A;  2NQI A;  4N4Z A;  4OW0 A;  4MSX A;  2BU3 A;  4CDD B; 
#chains in the Genus database with same CATH homology
 1UKF A;  2JTC A;  4RNA A;  4D8I A;  4RF0 A;  5E6J A;  1PVJ A;  4PT5 A;  3W31 A;  5EZQ A;  2AGA A;  3MTV A;  3BY4 A;  4MI7 A;  4EVX A;  3IFU A;  4HXD B;  4R3D A;  3ZNH A;  3PSE A;  5KO3 A;  3MP2 A;  3PHW A;  3O65 A;  3PHU A;  3PT2 A;  4XZX A;  4P16 A;  4BOU A;  4D8B A;  2Z84 A;  4WUR A;  4IUM A;  1YZB A;  2DOS A;  3MJ5 A;  4GUA A;  4ZTB A;  2J7Q A;  5JZE A;  2UZJ A;  4RKX A;  2BTW A;  4M0W A;  4OVZ A;  3RNV A;  3TMP A;  3B21 A;  2BU3 A;  4BOZ A;  3TRK A;  3C0R A;  2BTW B;  4MM3 B;  2JRI A;  4OVZ B;  4A5U A;  3OQC A;  4IP3 A;  2FE8 A;  3BB7 A;  2J7Q C;  3PHX A;  3E9S A;  4REZ A;  4OW0 A;  4RF1 A;  3PRM A;  5EZS A;  1DKI A;  4BOS A;  4BOP A;  4BOQ A;  4D8E A;  3BBA A;  3W30 A;  2HWK A;  3PRP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...