1NU1 | Genus

Total Genus 1

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus	1
sequence length	57
structure length	57
Chain Sequence	MLSVAARSGPFAPVLSATSRGVAGALRPLVQAAVPATSESPVLDLKRSVLCRESLRG

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

loadScript /static/js/j2s/core/package.js

loadScript /static/js/j2s/core/corejmol.z.js

loadScript /static/js/j2s/core/corescript.z.js

JSmol exec jmolApplet0 start applet null

Jmol JavaScript applet jmolApplet0__2915958452000686__ initializing

Jmol getValue debug null

Jmol getValue logLevel null

Jmol getValue allowjavascript null

AppletRegistry.checkIn(jmolApplet0__2915958452000686__)

vwrOptions:

{ "name":"jmolApplet0","applet":true,"documentBase":"https://genus.fuw.edu.pl/view/1nu1/I/","platform":"J.awtjs2d.Platform","fullName":"jmolApplet0__2915958452000686__","codePath":"https:/static/js/j2s/","display":"jmolApplet0_canvas2d","signedApplet":"true","appletReadyCallback":"Jmol._readyCallback","statusListener":"[J.appletjs.Jmol object]","syncId":"2915958452000686","bgcolor":"white" }

setting document base to "https://genus.fuw.edu.pl/view/1nu1/I/"

Jmol Version: 14.29.13 2018-04-17 17:17

java.vendor: Java2Script (HTML5)

java.version: 2018-01-28 23:38:52 (JSmol/j2s)

os.name: Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; ClaudeBot/1.0; +claudebot@anthropic.com)

Access: ALL

memory: 0.0/0.0

processors available: 1

useCommandThread: false

appletId:jmolApplet0 (signed)

Jmol getValue emulate null

defaults = "Jmol"

Jmol getValue boxbgcolor null

Jmol getValue bgcolor white

backgroundColor = "white"

Jmol getValue ANIMFRAMECallback null

Jmol getValue APPLETREADYCallback Jmol._readyCallback

APPLETREADYCallback = "Jmol._readyCallback"

callback set for APPLETREADYCallback Jmol._readyCallback APPLETREADY

Jmol getValue ATOMMOVEDCallback null

Jmol getValue AUDIOCallback null

Jmol getValue CLICKCallback null

Jmol getValue DRAGDROPCallback null

Jmol getValue ECHOCallback null

Jmol getValue ERRORCallback null

Jmol getValue EVALCallback null

Jmol getValue HOVERCallback null

Jmol getValue IMAGECallback null

Jmol getValue LOADSTRUCTCallback null

Jmol getValue MEASURECallback null

Jmol getValue MESSAGECallback null

Jmol getValue MINIMIZATIONCallback null

Jmol getValue SERVICECallback null

Jmol getValue PICKCallback null

Jmol getValue RESIZECallback null

Jmol getValue SCRIPTCallback null

Jmol getValue SYNCCallback null

Jmol getValue STRUCTUREMODIFIEDCallback null

Jmol getValue doTranslate null

language=en_US

Jmol getValue popupMenu null

Jmol getValue script null

Jmol getValue loadInline null

Jmol getValue load null

Jmol applet jmolApplet0__2915958452000686__ ready

script 1 started

platformSpeed = 8

Viewer cachePut cache://localLOAD_/file/5cfbad721b1b4784f9b3e1a6/pdb.gz

Viewer cachePut https://genus.fuw.edu.pl/file/5cfbad721b1b4784f9b3e1a6/pdb.gz

FileManager.getAtomSetCollectionFromFile(/file/5cfbad721b1b4784f9b3e1a6/pdb.gz)

loadScript /static/js/j2s/core/corezip.z.js

The Resolver thinks Pdb

loadScript /static/js/j2s/core/corebio.z.js

Time for openFile(/file/5cfbad721b1b4784f9b3e1a6/pdb.gz): 2379 ms

reading 57 atoms

ModelSet: haveSymmetry:false haveUnitcells:false haveFractionalCoord:false

1 model in this collection. Use getProperty "modelInfo" or getProperty "auxiliaryInfo" to inspect them.

Default Van der Waals type for model set to Jmol

57 atoms created

ModelSet: autobonding; use autobond=false to not generate bonds automatically

Time for creating model: 17 ms

Adding embedded #jmolscript: select ({0:56});backbone only;select *;

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Genus data interpretation

Chord Diagram

molecule tags	Oxidoreductase
publication title	Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site pubmed doi rcsb
molecule keywords	Ubiquinol-cytochrome C reductase complex core protein I, mit
total genus	1
structure length	57
sequence length	57
ec nomenclature	ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date	2003-01-30

Image from the rcsb pdb (www.rcsb.org)

cath code	Class	Architecture	Topology	Homology	Domain
2.10.210.10	Mainly Beta	Ribbon	Cytochrome Bc1 Complex; Chain I	Cytochrome Bc1 Complex; Chain I	1nu1I00

3TGUI 3L73I 3H1KI 1SQXI 3L72I 3H1II 3H1HI 3L71I 1NTZI 1NTKI 1L0NI 3H1LI 3H1JI 1PPJI 1SQBI 1NTMI 3L70I 3CWBI 2FYUI 1SQQI 3L75I 1NU1I 1SQPI 2A06I 4U3FI 1SQVI 3L74I 1L0LI 1PP9I
chains in the Genus database with same CATH superfamily

#chains in the Genus database with same CATH superfamily
 3TGU I;  3L73 I;  3H1K I;  1SQX I;  3L72 I;  3H1I I;  3H1H I;  3L71 I;  1NTZ I;  1NTK I;  1L0N I;  3H1L I;  3H1J I;  1PPJ I;  1SQB I;  1NTM I;  3L70 I;  3CWB I;  2FYU I;  1SQQ I;  3L75 I;  1NU1 I;  1SQP I;  2A06 I;  4U3F I;  1SQV I;  3L74 I;  1L0L I;  1PP9 I; 
#chains in the Genus database with same CATH topology
 3TGU I;  3L73 I;  3H1K I;  1SQX I;  3L72 I;  3H1I I;  3H1H I;  3L71 I;  1NTZ I;  1NTK I;  1L0N I;  3H1L I;  3H1J I;  1PPJ I;  1SQB I;  1NTM I;  3L70 I;  3CWB I;  2FYU I;  1SQQ I;  3L75 I;  1NU1 I;  1SQP I;  2A06 I;  4U3F I;  1SQV I;  3L74 I;  1L0L I;  1PP9 I; 
#chains in the Genus database with same CATH homology
 3TGU I;  3L73 I;  3H1K I;  1SQX I;  3L72 I;  3H1I I;  3H1H I;  3L71 I;  1NTZ I;  1NTK I;  1L0N I;  3H1L I;  3H1J I;  1PPJ I;  1SQB I;  1NTM I;  3L70 I;  3CWB I;  2FYU I;  1SQQ I;  3L75 I;  1NU1 I;  1SQP I;  2A06 I;  4U3F I;  1SQV I;  3L74 I;  1L0L I;  1PP9 I;

...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)

...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

1NU1I

Total Genus

sequence length

structure length

Chain Sequence

Structure visualization

Chord Diagram

connected with : NaN