The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
87
|
sequence length |
290
|
structure length |
290
|
Chain Sequence |
MDYLVKALAYDGKVRAYAARTTDMVNEGQRRHGTWPTASAALGRTMTASLMLGAMLKGDDKLTVKIEGGGPIGAIVADANAKGEVRAYVSNPQVHFDLNAAGKLDVRRAVGTNGTLSVVKDLGLREFFTGQVEIVSGELGDDFTYYLVSSEQVPSSVGVGVLVNPDNTILAAGGFIIQLMPGTDDETITKIEQRLSQVEPISKLIQKGLTPEEILEEVLGEKPEILETMPVRFHCPCSKERFETAILGLGKKEIQDMIEEDGQAEAVCHFCNEKYLFTKEELEGLRDQTT
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
The crystal structure of the reduced, Zn2+-bound form of the B. subtilis Hsp33 chaperone and its implications for the activation mechanism.
pubmed doi rcsb |
| molecule tags |
Chaperone
|
| source organism |
Bacillus subtilis 168
|
| molecule keywords |
33 KDA CHAPERONIN
|
| total genus |
87
|
| structure length |
290
|
| sequence length |
290
|
| chains with identical sequence |
B
|
| ec nomenclature | |
| pdb deposition date | 2004-05-29 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF01430 | HSP33 | Hsp33 protein |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 3-Layer(bab) Sandwich | Hsp33 domain | Hsp33 domain | ||
| Alpha Beta | Alpha-Beta Complex | CBS domain Like | HSP33 redox switch-like |
#chains in the Genus database with same CATH superfamily 1HW7 A; 1VZY A; 1XJH A; 3M7M X; 1VQ0 A; 1I7F A; #chains in the Genus database with same CATH topology 1VR9 A; 2J9L A; 3LFR A; 2JA3 A; 3JTF A; 1HW7 A; 3OI8 A; 3GHD A; 1VZY A; 1XJH A; 3M7M X; 1VQ0 A; 3NQR A; 1I7F A; #chains in the Genus database with same CATH homology 1HW7 A; 1VZY A; 1XJH A; 3M7M X; 1VQ0 A; 1I7F A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
