3M7MX

Crystal structure of monomeric hsp33
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
231
structure length
231
Chain Sequence
IMPQHDQLHRYLFENFAVRGELVTVSETLQQILENHDYPQPVKNVLAELLVATSLLTATLKFDGDITVQLQGDGPMNLAVINGNNNQQMRGVARVQGEIPENADLKTLVGNGYVVITITPSEGERYQGVVGLEGDTLAADLEDYFMRSEELPTRLFIRTGDVDGKPAAGGMLLQVMPAQNAQQDDFDHLATLTETIKTEELLTLPANEVLWRLYHEEEVTVYDPQDVEFKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 33 kDa chaperonin
publication title Crystal structure of monomeric hsp33
rcsb
source organism Escherichia coli
molecule tags Chaperone
total genus 53
structure length 231
sequence length 231
ec nomenclature
pdb deposition date 2010-03-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.480 Mainly Alpha Orthogonal Bundle Helix Hairpins helix hairpin bin 3m7mX02
3.55.30.10 Alpha Beta 3-Layer(bab) Sandwich Hsp33 domain Hsp33 domain 3m7mX01
1VZYA 1VQ0A 1HW7A 1I7FA 3M7MX
chains in the Genus database with same CATH superfamily
1KYOF 3CCRV 5IT9N 5FNVA 2Q0AA 5EC1C 1AP6A 1SESA 1M5IA 1FJGB 3VBBA 4FLVA 4HZ3A 4B08A 2Q4PA 3W7SA 3OR6C 4DR6B 2KG7B 3JCZA 2CH7B 3IAYA 4LF5B 1R6NA 3ZJZA 4I50A 3LDDA 1NVPB 3CEIA 1KU9A 4JYAB 1SC5B 1VF5B 2Q7EA 2DMXA 2WSSG 4YXWG 4LCUC 1AB3A 3E8HA 2WLIB 3CYOA 1WA8B 1VIBA 1N36O 3E89A 3F7YC 4LF6B 1MABG 1R73A 4K0KB 1RSOB 1E79G 5H9CA 5LA6A 3G6EV 1SS3A 3H1LH 4JAAA 1QQCA 2QM7A 1N0JA 4BIOA 4I9QA 5GW7A 3K5NA 4UVAA 2Q6AA 1G6UA 1SZTA 4JI8B 5BMVA 1R1BA 3L70H 4O2BA 4JYCA 2VS0A 4DR3B 2UXDO 1F4NA 1SZXA 1N32B 1DK1A 3ZRWB 3K5OA 3ABUA 2ZM6O 1UPGA 5JVDA 2UXCB 4FZ1A 2YS8A 3CPWU 1N33B 4G2KA 3CD6V 1L0LH 2RQ6A 1ZTEA 3MDSA 3NR7A 3S3XA 2GV9A 4JAVA 2AW9A 3AG7A 4CH3A 1YCIA 4PA9A 1FJGO 1BGYH 5DN6G 1FFXB 3CC7V 4LFCB 3T2MA 1AVMA 4PD4F 4PA3A 3VQYA 1JVMA 1P4RA 5LOVB 2IW5A 5D5PA 4KHPB 4J10A 5DEDA 3BRCA 4JYAO 4ZI7A 3L9DA 3SPGA 2B9ZA 2F1MA 1TAEA 3ZN1A 5JCOA 4NB5A 2HFEC 5IYCO 1VQKV 5LMUO 2ATKC 2EZOA 2JVDA 3CCLV 4R8CA 1GH6A 5HFLA 2FL4A 2JEXA 4B7KA 2HHHO 1JMKC 1FD9A 1XQ8A 1MZEA 4LWSA 2LJ2A 4X1IA 3L72H 5E79Z 4DV0B 4RAIA 1XMOB 3CC2V 2DYSC 1WAZA 4DV3O 4BIUA 5CN0A 2DWEC 4DR3O 1HR0B 2ZKOA 1P7GA 2GBOA 1COWG 3LSUA 1FXHA 4TQDA 3ZMZA 4UCRA 1SQXH 1N4CA 5EYPA 4JI1B 2CTRA 5CA0A 1EBOA 2AXTZ 2XAHA 4LP8A 5B1BC 2JJ2G 4WBNB 4GKKB 3I55V 3J81N 2LGQA 2YIBA 2Z3YA 1N33O 1HP8A 3MD0A 4WFFA 2GHYA 2QWRB 4LF7B 3WB2A 2OTLV 2UUAB 2WA4A 4FIPC 3FB8C 3LDEA 1K34A 3VOUA 4E4EA 2KSDA 4CZZA 4N21A 2JS3A 1WPBA 3STLC 3SJQC 1XUQA 3VQXA 4DV4B 1H8EG 2QWPB 2JS5A 4I0XA 4TV9A 4PJ0Z 4KHPO 5LL6Y 4FM2A 3GB7C 3R66A 2K1EA 1NBMG 2XAJA 5H6RA 3DXRB 2DE0X 5K1XA 4NR1A 3KKYA 2ZINA 5LP6A 3THOA 2JGUA 1TA8A 5B1AC 1SQFA 3CCMV 4D7TA 1DLBA 2E3CA 1YDXA 2ODMA 4J42A 3CP1A 2X6BA 4IGGA 3D36C 1URFA 5IJ0A 2IH1C 1F7YA 3WG7B 1V54C 2E76B 4O4JA 1XMOO 2YSUB 4PI2A 1MZFA 2FYUH 3ZMTA 4J41A 1SKVA 2YEVB 2F43G 2C2AA 2Q9LA 5KA5A 1O9GA 2N05A 2W0XA 5H5NA 1KC8W 3C3TA 3N2KB 1K5QA 3ZX6A 1M56C 4GKKO 2ZE8A 1PNMA 3ABMB 3JD2A 3EXAA 4NYKA 1K4DC 1VQMV 1Z5VA 2QTSA 2UUAO 1FXVA 2YIBD 1Q6UA 2P90A 3JYCA 2HP8A 1LUVA 5B3SC 3QO5A 4I55B 2M6YA 1XL6A 3TETA 3G80A 1TVKA 3HKDA 4HNAA 1OZ0A 2ITCC 3HR0A 5JH7B 4CH6A 4IYIA 5B1NA 4GX5A 1FXKB 2YI8A 1K33A 4UB6Z 5LXTA 1H8HG 1OHHG 2EIKC 3K03A 4X9QA 2WLLB 2HEPA 4Z2WA 2GTSA 2Q8VA 4O4HA 2QR4A 2CAZC 2QWQB 3CS5A 5ITZB 1HNWB 1FPOA 4X1KA 2H94A 4NXMO 4IIJA 2R72A 2XAQA 3ASNC 4PA4A 4GX1A 3T1CA 1SQBH 1IZ3A 3CXHF 4MTXA 5JQGB 3E8GA 1H2GA 3APOA 4DO2A 1H2SB 3W7XA 4FLUA 1R6KA 1PM9A 2BTQA 4GYCB 3RVZA 5EZYB 3EHBB 2W6JG 3H1IH 3RYFB 1QLEB 4EB6B 1J5EB 2P7TC 2BSKA 5KUMA 2DN9A 2QEXV 1SQVH 5C93A 4YY3O 2PYJA 1XNRB 1R3IC 4LH6A 5BXZA 4TOIA 3L71H 2YXYA 2XASA 1VQPV 1HWYA 2Q7GA 3K0DA 1AJQA 1BHAA 1S77D 1XBLA 4YHHB 1BS3A 4UVCA 2YICA 2WLHA 2PZSA 4FLZA 3A8TA 2FB5A 2WLNA 1JJ2U 2UUBB 3K79A 2A79B 2EIJB 3JAKB 3H1HH 4KXRA 3SYQA 5L3FA 1KUQA 1ZL8B 3K04A 3RBZA 4UCTA 1BT8A 3ZS8C 2PGGA 3OGCC 5LHHA 1Y76A 1HNWO 1KP3A 2AHYA 1PNLA 3JATB 2NR5A 4PA6A 3SR2C 3CCUV 5LGNA 4PA7A 2PI5A 3SJAC 2A06H 2F4VB 2OWOA 4LF8O 1SQGA 4UUJC 1YI2V 1V54B 4RUEA 4JZGA 2QTOA 2UXXA 1Q81W 1XILA 3WFVA 3ABTA 5KMGB 1QHTA 3H01A 3ICXA 4JI5B 3FD9A 2XT9A 4B7EA 5A2QN 5FPOA 2R9AA 5KLVH 1QNMA 4WCEV 1J5EO 2QA4V 1M90W 1KB9F 1RP3B 4JTDB 1XNRO 3MHSC 1Q43A 3UCSC 1OCOB 3JAWB 1HDJA 3RYHA 5BZBA 1XI1A 1M9NA 5J2UA 4PELA 4GKJB 4RUFA 3ZRSA 1KKCA 1ZLZA 4KL1A 4YHHO 1TUBA 2D3OW 3UT5B 5KA6A 4L8JA 4UCUA 3G71V 3JAMN 4U7OA 4UB8Z 1IBLB 3J7AU 2UUBO 1NQTA 3K9SA 1AJNA 4JI2O 4MTOA 1UFIA 5L3GA 3K5MA 4PDMA 2A3QA 1Y74B 1IBMO 3N2GA 3D3IA 3T1YB 1NI8A 1H2KA 1Q82W 1KQSU 3JASA 4R7CA 4LF9B 1VQNV 3TJTA 5IWAO 4DR1O 1K7DA 1L8DA 3AG4B 1XOUA 3ZMSA 3SYPA 3P3PA 1F23A 4JI5O 2QWNB 4JI3B 5J9PC 1LR1A 4QPKA 4CC6A 5FNVB 2H8PC 2P06A 2ZT9B 1P84F 1SA0B 4JZ2A 4JV5O 4GX2A 2DYRB 4LFBB 1L0NH 4ZOLA 1NKDA 5H6QA 2F93B 1NTKH 2DJVA 4JPRA 4B3RO 2ETNA 5IYZA 5CBFA 3FFQA 3FKSG 1BHBA 1YF2A 2WLMA 1MMMA 5JJNB 3SYAA 3ZRXA 2NNUA 4DV1B 1W0JG 3BVOA 3SYCA 1TUEB 4MVQA 4UFZA 5FLXN 4J9ZB 4O4LA 4PDVA 2W0FC 3NXSA 5BR8O 3WB0A 4UCVA 1IBLO 4ZHQA 2WA3A 1K9MW 3HKEA 2KQXA 1XDCA 1WB7A 3WG7C 4F4LA 4MTGA 3B8MA 1S3JA 3T1YO 4GX0A 1ZX3A 3AK3A 3FAVB 1YZBA 1VQ5V 3FYIB 3A0RA 4NXNB 3CCEV 3IJ4A 3L75H 4B3MB 3UM7A 2WWWA 4LF9O 2BCCH 3JD4A 5JJEB 3PJSK 3CRCA 2KG7A 1R3LC 3CB2A 4J7KA 4O2AB 2CH7A 4JF3A 4CS3A 4IHJB 4CC5A 5JVDB 3G4SV 4B3TO 4DR4B 4X64B 3ABMC 1NH2B 3P30A 4X66O 2EIMB 3Q4HB 3CCQV 2UUCO 4JI6B 4JI3O 2QJ1A 4MS2A 4G27B 3IFXA 2LFSA 2WPDG 3ZIAG 1M57B 3E35A 3SJCC 4HBNA 5CBGA 4LFBO 1N0NA 1FKAO 4FK5C 1GM8A 4N23A 2YI9A 1KMIZ 1OCCB 5IYBO 3OMIB 3B09A 1FXKC 1GAXA 1GKFA 2IJHA 2V1DA 2XNDG 3ETDA 3DC5A 4DV7B 4RWUA 3C90A 3G67A 4DV1O 3CRAA 4DR6O 2WLKA 3M8AA 1K4CC 3ZRWA 4QE9A 1OCRB 3JSLA 2DOSA 2PYLA 2GTAA 1K8AW 4LF5O 4GCZA 1JFFA 1GMGA 3LSQA 4K35A 2GUZB 4LWSB 4OXSA 1KD1W 2E75B 3PN1A 4WFEA 1B6QA 4LF6O 1T5EA 4K0KO 1PL0A 2QKAA 1V55B 1VQ6V 1YHQV 4GLXA 4Z1VA 1H2LA 1VQ9V 2B1IA 1I94B 3SYOA 3CWBH 1JA8A 2ZXWB 2OIGA 3OUSA 3B40A 3SPIA 4NXNO 2E74B 2RMKB 2A9HA 1JJOA 4B3MO 5CBHA 5JWPA 5F2VO 5LOVA 4JI8O 3F5TA 4QPJA 3ZEDA 1QCEA 3OE7G 1VMGA 2Q68A 3JD1A 4QE7A 1Q7YW 4X64O 3BY6A 3CC4V 1N32O 5CA3A 1QLEC 1ORQC 3RYIB 4JI6O 4X89A 4F6EA 2Y48A 1IBKB 2QKCA 4MTFA 1NVPD 3TCUA 2BTOA 4UCOA 2UXCO 4I7ZB 1M1KW 4LH7A 4O4IB 3MAQA 4E2LA 2DQ3A 2DW4A 4KUMA 5A9GA 1WP8A 4I0XB 1US6A 1U97A 1Q8IA 4AQYB 4H0LB 1WLEA 3IGAC 4FVMA 4LFCO 3ABLC 4C7UA 4Q20A 1YVWA 2RJZA 1AI7A 2DWDC 2RNBA 1BQZA 1O9HA 5KX5B 3CRRA 3ZHVA 2OYQA 2EIJC 4WBNA 1D5AA 3KCYA 1U96A 3JALA 1WP7A 3AG2B 2A7WA 3HKBB 3OGIB 4FLXA 1PV0A 5L3EA 4O4JB 1V9PA 3CRQA 2JRIA 4H13B 3B4SA 4W4LA 1AR1B 1YTFD 3JD3A 5IDJA 1R3KC 4DV0O 2F66C 2ADPA 1H2NA 1IXMA 1HR0O 1UJWB 5IJ9A 2OTJV 3B77A 2HVJC 2EINC 1EZJA 3DXRA 4UV8A 4RO2A 5J2TB 2YUAA 3HB3B 4JI1O 1D5NA 1HNZB 1IBKO 1FFTB 3JCUZ 4DUYB 4LF4B 2RN9A 1OCOC 2R9IA 3T1HB 1IVSA 4LF7O 3UO3A 2JGDB 3BPZA 2LW7A 1VQ8V 4XDJA 1OJHA 1MSDA 3D8CA 4EKWA 1K97A 2Z5UA 4YJ2B 4P30A 4WFAV 3P3NA 4AQYO 2M7WA 2EZPA 2XOKG 3H9VA 4H37A 3JD0A 2O57A 5LXTB 4B3SB 4IT5A 1JPXA 3OW2U 4DV4O 5CA1B 3ZMVA 4TV8B 4RQEA 3N2KA 4ABMA 1SQQH 2VQFB 3CHXA 3X2QC 4LBEC 4QGPA 4O4HB 3OMAB 2PUSA 4X1KB 2OT5A 3ZN0A 3AEIA 3UQ8A 3UKMA 4J7JA 4DR2B 3CE2A 3ETQA 1KECA 1YJWV 2F23A 4L87A 4HYOA 3RW0A 4PHZA 4ASUG 4X20A 5JH7A 2LP7A 3AG4C 2BTQB 3BA8A 1NS1A 4FFBA 2NLJC 1FXKA 2EJRA 1CP9A 3QVNA 1FS0G 4MVZA 3E86A 4I4TA 3ZHQA 2AZ2A 2WAMA 1X4TA 2IU0A 3SPCA 4NTYA 1H2MA 4FPPA 1HNZO 2BSKB 1IX9A 2WLLA 4DUYO 4JI0B 2DYRC 4FFKA 4DV2B 4LF4O 4MSWC 2CUGA 3T1HO 1NU1H 1M93A 2CTPA 2QGNA 1JOYA 3DC6A 4LNUA 4HAMA 5ITZA 2LW1A 2YIDA 4Z1MG 3ETGA 2AHZA 4RQFA 4U3FH 1I5XA 2FKXA 3OAAG 5E1AC 4DRXB 3RVYA 5JQGA 5IY5B 4B3SO 4YJ3B 1AR4A 1W0KG 4X62B 2OCHA 1Y67A 4U3JB 2IU3A 1KKDA 1VEWA 1AI4A 5EZYA 4F6RB 1P7BA 3OMNB 3OTFA 1XHZA 3HPLC 2ZDIC 4W4KA 4DK0A 3J80N 3ABLB 4AHCA 2N74A 2Q7HA 3E83A 3K59A 1Y76B 3QNEA 3ABKB 5EBMC 3JARB 2R9RB 3F5WC 1I0HA 3MHHC 4DR2O 1CPYA 1EM1A 2X0LA 1BQ0A 3LDCA 3CCVV 2IBZH 1OV9A 2QSAA 3TXSA 3JSNA 1MG1A 4MVUA 4PDRA 4EFBA 4UXNA 2ARHA 1EN6A 2EIMC 1HW7A 1VQOV 4DW1A 2JJ1G 4FJCC 3S3WA 1DGSA 4LR3A 2V4DA 4OPAA 2ZD9A 1M57C 4P9OA 1QR8A 3K58A 3SPJA 3JAKA 4DV2O 2Y69B 1XMQB 3HKCB 1ZL8A 1N34B 2OCCB 3ASOC 2EINB 5CMUA 2CE4A 1OCCC 2EULA 3O65A 3RYHB 2IJJA 4X65B 5LHIA 4K8ZA 5JJJB 3U11A 3CSXA 3K5LA 1FYJA 2KKWA 3H1KH 4NVPA 1LNQA 5JCOC 3ZCCA 4X1YA 1OCRC 4H44B 1XEQA 5L3CA 3D36A 4MVMA 1W2BU 4JGSA 3RYCB 4X62O 5LHGA 3RT3C 3LNNA 4FLWA 3B2EE 5H2FZ 1W59A 1NTMH 1G8MA 4JASA 5LYJA 5KMGA 1ZSPA 1BL8A 3AG1C 5LMNB 4LFAB 5EK0A 1V55C 4J11A 5GONA 1Q6IA 3KCXA 1GRJA 1SRYA 3N2GB 1AP5A 3AG3B 2ZXWC 3L74H 4TWKA 2BE3A 1VQ0A 1AILA 3ZHSA 3X2QB 3EVKA 4A5UB 2YXLA 4Q6GA 1L1FA 3QG5A 3JAWA 3GVMA 2E5LB 4JAUA 4TUYA 5FPRA 3E22A 4KP4A 4BW5A 1QVGU 2F4VO 3OT7A 3OFNG 4FLTA 4BR6A 4OX9B 4QNHB 3UT5A 1S5HC 3FYEB 2VWJA 3ZMUA 1RFYA 5C8YA 1Y66A 4H33A 5L3DA 1PP9H 1XMQO 5B66Z 2IM9A 2LFRA 1N34O 3SPHA 1MOFA 4AI8A 2Y0IA 1B04A 5EIBC 1Y74A 4X65O 1QR9A 3APQA 4DR5B 2HLDG 1G4YB 5LBQA 3ZBHA 4DXWA 2QM4A 4O4LB 4QIWF 4YIPA 5BY1A 1VQLV 1MNGA 3QF7A 1A32A 1Q86W 1WB8A 1YSCA 5LP6C 4I50B 2ZM6B 3AG2C 4R6ZA 4FM1A 4GKJO 4CBCA 5LMNO 4UVBA 4MVRA 1D2DA 5KHKA 5CB4A 1E1RG 2EILB 2D2CB 2DQ0A 5LA6B 1SA0A 3E8FA 2Q0OC 1ZUQA 3K57A 1ENVA 3CJHA 3RN4A 3OD4A 1YJNV 4DV5B 1OCZB 4XBFA 1K5SA 2Y4UA 2E5LO 5BMVB 4O2BB 2X7RB 2VWKA 2FTKA 1JCHA 2ZQMA 4ICGA 3ZRVA 4YIOA 3VQVA 1PD3A 4UCSA 5EBLC 4EEQA 2HG5C 3CMAV 1GK9A 4CH5A 4D6TH 4OX9O 5LMUB 3LUTB 2CGNA 2L35A 3LNMB 3SDLA 3RGBA 1N8RW 2HHHB 2MK3A 1VP7A 2Y4TA 2ZDIA 2XTAA 2WLIA 4P2ZA 2Z0AA 1WA8A 5DECA 3H1JH 1S76D 1JQ0A 1RSOA 1XREA 3OR7C 5L3BA 4DV3B 1DTOA 4DR5O 3FAVA 2LO1A 1AROP 3U10A 4CS2A 1E1QG 1BMFG 2HJFC 4JYBA 3ASOB 2N04A 3DSQA 2P6JA 4O2AA 1QLNA 2QKSA 3BAAA 4IHJA 4LC1A 1GM9A 1JFFB 4ZI7B 3BABA 3Q4HA 5LGTA 2UXNA 1X59A 2P22C 4DK1A 3OUFA 1YTFB 4JI7B 4WF9V 5GTIZ 5LGUA 2VRZA 3FB7C 3K3WA 3QO7A 3CRMA 3ML0A 1RPOA 2ZNJA 3AG1B 4X1IB 1F51A 5EBWC 4DV5O 4OPHA 2EBOA 3FX7A 2H3OA 2XUMA 4JTAB 2YIAA 1FFXA 2X6AA 4DV6B 2P4KA 4JI4B 1NJIW 1H38A 2Y0PA 1M4UA 3K08A 5EYPB 5CA0B 1XNQB 1GN2A 1MSWD 4J9YB 4DR4O 1GN4A 1YIJV 2ZIMA 1Z2GA 1AJPA 2GUZA 2HKOA 1BE3H 3OEHG 4UV9A 4TSFG 4DUZB 3CX5F 1NTZH 2Q73A 1GO3F 3W7WA 2QM8A 2MW2B 3OEEG 4PDLA 3K0GA 5IY5C 2WLJA 2JK5C 4ZIBA 1ZAUA 4TV9B 1F4MA 3P32A 5D5QA 3OTOB 4DV7O 3JALB 1I5YA 1AI5A 4MW3A 3F7VC 2K9PA 4FMTA 4NTXA 3RYIA 3ABKC 3GWKC 4JI7O 2HR3A 1NH2D 5LP6B 1EFRG 1RM1C 3E2EA 4O4IA 5IJ0B 2AZ0A 1VZYA 3T4DA 3CXCU 3A0HZ 5KAIZ 2R70A 3ZHUA 4CS4A 1I94O 4KFMA 2PI4A 1I08A 5IJ9B 2JEUA 4DV6O 3SGIA 1GTOA 3SJBC 4JI4O 2UU9B 2Q5ZA 1AR5A 4FM0A 2ADQB 4FLYA 4GZRB 2XAFA 2ZIOA 2RCVA 2ZE7A 1XNQO 5KHGA 5KX5A 2A0LA 2QWOB 4PV1B 1B06A 2CDYA 2Y69C 1IDSA 2OCCC 1VARA 1VF6C 1Q3EA 2ILMA 2AGAA 3HKBA 4AILC 2CK3G 1K73W 2P67A 4NXMB 4DUZO 3AK2A 4DYLA 1R6TA 4NTWA 1TVKB 2EJ7A 3HKDB 4HNAB 1GN3A 1AI6A 1PNKA 2GDSA 3I56V 4X8AA 3OTOO 1PL4A 2LQTA 1JR9A 2YEVA 2VQEB 2YXHA 3BA9A 1G1XB 2YC0A 1KBHA 4MVOA 1Q90D 5J2TA 3AG3C 1DF4A 2F95B 3FB5C 3EFFK 1S0VA 1NR1A 1JX9A 4YY3B 4G28B 3O9OA 2X6CA 1CXZB 2UXBB 3W7UA 2JGDA 4IIJB 1BSMA 4X20B 2FMLA 4FFBB 1SERA 4J80A 4I55A 4YJ2A 2HVKC 4NKGB 2JIZG 3VQWA 4I4TB 1B3QA 3KG2A 1SQPH 2JDIG 3K9AA 2ZR3A 2UU9O 1THZA 3CCSV 5EIBD 5CA1A 5B1OA 4QJFB 4TV8A 1FAFA 3K06A 2OIEA 5DM6V 5FL7G 5KHJA 3IC7A 1TGOA 2L6LA 4OGQB 3T4ZA 1WPXA 4K3AA 2KB1A 4XDKA 4LNUB 1PKXA 3C3SA 2LGWA 3WB1A 1Q6HA 2NN4A 3G6BA 3UO2A 1VQ7V 4LF8B 4CH4A 1R3JC 4MVSA 1GM7A 1QU7A 3TXQA 3U0ZA 1XHXA 1I7FA 2ZR2A 2DYSB 5KHIA 4DW0A 4ZBMA 3A0BZ 2QE7G 5K1PA 1MA1A 4D7SA 2VQEO 3TGUH 1KP2A 4JYYA 4R50A 2EILC 3CMEV 5B1BB 5KUKA 2VQFO 2QDOA 3RYFA 1OCZC 4EB6A 5TISZ 1HNXB 2UXBO 3DTUB 3M99B 2B5UA 1YXBA 1LUWA 4MW8A 1K3EA 1ROPA 3BCCH 5AG2A 1RM1B 3FB6C 1J95A 4DRXA 3M7MX 1Q5OA 3L73H 4YJ3A 2BOBC 3IC9A 2YDEA 1VQ4V 4JTCB 2PTMA 3N27A 4U7NA 3BEHA 2IJKA 2P4VA 4U3JA 2P5OA 3ETEA 2Q69A 4F6RA 1XL4A 2GSMB 5GTHZ 3DGEA 4JI2B 5KHHA 2B1GA 1IBMB 3JARA 4JI0O 3QTCA 1NT2B 5B1AB 3ZHTA 1ZWIC 1SF9A 4X1YB 4BIZA 5IWAB 1NZ6A 2ITDC 5B5EZ 4DR1B 2RDCA 5IYDO 4K8XA 3JATA 1NR7A 5J2UB 3STZC 3OM3B 4I9WA 1GN6A 1VF7A 5LYJB 4BWAA 3D3QA 3CCJV 2G38A 4GUNA 2ZE5A 1TUBB 3GWOA 4TQFA 5GONB 2PY5A 1EN4A 4JV5B 1YEWA 1M56B 1YITV 2CGOA 3HKCA 4DR7B 1VF6A 2ZE6A 1RPRA 1Y6XA 3R65A 1HNXO 3BHPA 4B3RB 4EFEA 1IXBA 1P49A 1Z5WA 2XHBA 2CTQA 1PPJH 4TUYB 3RWRD 3E22B 1QBZA 4WFGA 4IYHA 5B3SB 3JASB 2XAGA 4MT8A 4PI0A 3A2FA 3WU2Z 3TK1A 5BR8B 1CEZA 4J7ZA 1YJ9V 3RYCA 5IE9A 3B8NA 4I5SA 4WFHA 4P9PA 4ZKIA 5C8YB 5HFMA 3I5DA 1S72V 3AK1A 1WN7A 1BCCH 2PF4E 5KAFZ 1Y4MA 1N36B 3QO8A 4FZ0A 3W7TA 2CTWA 2EIKB 3RFRA 4GT1A 2W6IG 1EZVH 3BFRA 4ZOLB 1WJZA 5EC2C 2IJIA 4X88A 5IYZB 4BW9A 2Q67A 1QVFU 1DF5A 2ZNIA 1SETA 3E8BA 1S5LZ 4BAYA 2EX3A 3ASNB 4TT3G 4IL6Z 2UXDB 4B3TB 2IH3C 1S5JA 1EN5A 1WNSA 3LSSA 2ZCEA 4X66B 2UUCB 1BZKA 1K92A 2HJDA 2BOCC 2V7QG 5CB4B 3KZIZ 4WFBV 4ZHQB 3HKEB 3CJHB 4XDLA 4LFAO 4DR7O 1IURA 3ZHRA
chains in the Genus database with same CATH topology
2ZIMA 3SJAC 4TV8B 5FNVA 2F4VB 2Q0AA 3N2KA 2OWOA 1M5IA 1FJGB 4FLVA 4B08A 1SQGA 2VQFB 3CHXA 4DUZB 4DR6B 4O4HB 2PUSA 5KMGB 4X1KB 1QHTA 4JI5B 3ICXA 3IAYA 3UQ8A 5FPOA 4LF5B 4ZIBA 2R9AA 4I50A 4DR2B 3ETQA 1KU9A 4JYAB 1ZAUA 2Q7EA 4TV9B 5D5QA 4PHZA 3OTOB 4LF6B 3JALB 4X20A 5JH7A 4K0KB 1Q43A 2BTQB 3BA8A 4FFBA 3JAWB 3RYIA 5LA6A 3RYHA 4I4TA 1XI1A 1QQCA 1X4TA 5LP6B 5J2UA 4I9QA 3K5NA 1G6UA 4GKJB 4JI8B 4O4IA 5BMVA 5IJ0B 4KL1A 4O2BA 4DR3B 1VZYA 4JI0B 4DV2B 1TUBA 3UT5B 4L8JA 4UCUA 1M93A 1N32B 2R70A 4CS4A 1IBLB 3K5OA 4LNUA 5ITZA 5IJ9B 3SGIA 3SJBC 2UU9B 5JVDA 2UXCB 4FM0A 4FLYA 3K5MA 2ZIOA 1N33B 4DRXB 5KHGA 5KX5A 3N2GA 5JQGA 3T1YB 2RQ6A 4YJ3B 2GV9A 3JASA 4X62B 1Q3EA 4U3JB 4CH3A 4LF9B 5EZYA 1FFXB 3HKBA 4F6RB 3OTFA 1XHZA 4AILC 4NXMB 4LFCB 4DK0A 4AHCA 1L8DA 2Q7HA 3VQYA 3K59A 1TVKB 5LOVB 3HKDB 5D5PA 3JARB 4KHPB 4HNAB 4JI3B 3BRCA 4CC6A 4ZI7A 5FNVB 2F1MA 1TAEA 1SA0B 5JCOA 4LFBB 2VQEB 3BA9A 3JSNA 4ZOLA 2F93B 2JVDA 4EFBA 5J2TA 1JMKC 5IYZA 1HW7A 3FFQA 2F95B 1XQ8A 4X1IA 1DGSA 5JJNB 4LR3A 4YY3B 4DV0B 1XMOB 2V4DA 4DV1B 4UFZA 3K58A 2UXBB 1HR0B 4O4LA 3JAKA 4IIJB 1XMQB 4X20B 3HKCB 1N34B 4FFBB 3WB0A 4TQDA 4UCVA 4UCRA 4I55A 4YJ2A 3RYHB 5EYPA 4JI1B 3VQWA 4ZHQA 4I4TB 5CA0A 4X65B 3HKEA 4K8ZA 4WBNB 5JJJB 4GKKB 3U11A 5EIBD 3CSXA 3K5LA 5CA1A 2YIBA 2KKWA 4TV8A 4NVPA 5JCOC 4X1YA 4LF7B 3WB2A 5KHJA 2UUAB 4NXNB 1TGOA 4B3MB 3RYCB 3LNNA 4FLWA 3B2EE 4LNUB 5JJEB 5LYJA 5KMGA 4O2AB 3CB2A 3WB1A 5LMNB 1WPBA 4LFAB 4CS3A 4IHJB 4CC5A 5JVDB 3VQXA 4DV4B 4X64B 4DR4B 2JS5A 5GONA 4TV9A 3N2GB 4JI6B 4FM2A 4CH4A 4LF8B 2QJ1A 1VQ0A 3U0ZA 1XHXA 1I7FA 2YXLA 5KHIA 4Q6GA 5K1XA 3SJCC 3QG5A 3JAWA 4HBNA 2E5LB 5K1PA 4D7SA 4TUYA 2ZINA 5FPRA 3E22A 5LP6A 3THOA 2JGUA 1TA8A 1SQFA 2YI9A 1KMIZ 4D7TA 2E3CA 5IJ0A 4FLTA 4OX9B 4DV7B 4O4JA 3UT5A 3RYFA 4PI2A 2VWJA 4EB6A 1HNXB 3JSLA 5C8YA 1SKVA 2IM9A 2PYLA 1O9GA 1JFFA 1B04A 5EIBC 3N2KB 3M7MX 4DRXA 1Q5OA 4DR5B 4YJ3A 3PN1A 1T5EA 2PTMA 4GLXA 4U3JA 1I94B 2P5OA 1Z5VA 2QM4A 4O4LB 4F6RA 3QF7A 2YIBD 1JJOA 5LP6C 4I50B 2ZM6B 4JI2B 5KHHA 4I55B 4FM1A 1TVKA 5LOVA 3HKDA 1IBMB 3JARA 3ZEDA 4HNAA 5JH7B 4CH6A 3QTCA 1NT2B 5KHKA 5CB4A 4X1YB 3RYIB 5LA6B 1SA0A 2YI8A 5IWAB 3K57A 1IBKB 5LXTA 2BTOA 4DR1B 4K8XA 3JATA 5J2UB 4DV5B 4UCOA 4LH7A 1VF7A 5LYJB 4BWAA 4O4IB 5BMVB 4O2BB 3MAQA 2VWKA 2HEPA 1TUBB 3VQVA 4TQFA 5GONB 4UCSA 2PY5A 4O4HA 2CAZC 1Q8IA 4EEQA 1YEWA 5ITZB 4AQYB 1HNWB 4JV5B 4CH5A 4X1KA 4IIJA 2R72A 4FVMA 5LMUB 3HKCA 4DR7B 2RJZA 3RGBA 3BHPA 2HHHB 4B3RB 1O9HA 4EFEA 5KX5B 5JQGB 1P49A 2OYQA 1Z5WA 2XHBA 4TUYB 3RWRD 1H2SB 3E22B 4WBNA 1D5AA 4FLUA 3JASB 3JALA 1RSOA 2BTQA 4GYCB 4DV3B 5EZYB 4PI0A 3HKBB 4FLXA 3A2FA 3U10A 4CS2A 4O4JB 5BR8B 1V9PA 3RYFB 3RYCA 4EB6B 3DSQA 5C8YB 1J5EB 1WN7A 4O2AA 3BAAA 4IHJA 1N36B 2PYJA 1JFFB 4ZI7B 1XNRB 2F66C 3BABA 4LH6A 2P22C 4DK1A 4TOIA 3RFRA 5IJ9A 4JI7B 4ZOLB 2Q7GA 5J2TB 5IYZB 4BW9A 1HNZB 2ZNIA 2ZNJA 2EX3A 4X1IB 4YHHB 4DUYB 2UXDB 4B3TB 2PZSA 4LF4B 1S5JA 4FLZA 1WNSA 3T1HB 2ZCEA 4X66B 2UUCB 2YIAA 2UUBB 3JAKB 1FFXA 3BPZA 4DV6B 4UCTA 3ZS8C 4JI4B 2PGGA 5CB4B 4YJ2B 1M4UA 5EYPB 4ZHQB 5CA0B 1XNQB 3HKEB 5LXTB 4B3SB 3JATB 3SR2C 5CA1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VZY A;  1VQ0 A;  1HW7 A;  1I7F A;  3M7M X; 
#chains in the Genus database with same CATH topology
 1KYO F;  3CCR V;  5IT9 N;  5FNV A;  2Q0A A;  5EC1 C;  1AP6 A;  1SES A;  1M5I A;  1FJG B;  3VBB A;  4FLV A;  4HZ3 A;  4B08 A;  2Q4P A;  3W7S A;  3OR6 C;  4DR6 B;  2KG7 B;  3JCZ A;  2CH7 B;  3IAY A;  4LF5 B;  1R6N A;  3ZJZ A;  4I50 A;  3LDD A;  1NVP B;  3CEI A;  1KU9 A;  4JYA B;  1SC5 B;  1VF5 B;  2Q7E A;  2DMX A;  2WSS G;  4YXW G;  4LCU C;  1AB3 A;  3E8H A;  2WLI B;  3CYO A;  1WA8 B;  1VIB A;  1N36 O;  3E89 A;  3F7Y C;  4LF6 B;  1MAB G;  1R73 A;  4K0K B;  1RSO B;  1E79 G;  5H9C A;  5LA6 A;  3G6E V;  1SS3 A;  3H1L H;  4JAA A;  1QQC A;  2QM7 A;  1N0J A;  4BIO A;  4I9Q A;  5GW7 A;  3K5N A;  4UVA A;  2Q6A A;  1G6U A;  1SZT A;  4JI8 B;  5BMV A;  1R1B A;  3L70 H;  4O2B A;  4JYC A;  2VS0 A;  4DR3 B;  2UXD O;  1F4N A;  1SZX A;  1N32 B;  1DK1 A;  3ZRW B;  3K5O A;  3ABU A;  2ZM6 O;  1UPG A;  5JVD A;  2UXC B;  4FZ1 A;  2YS8 A;  3CPW U;  1N33 B;  4G2K A;  3CD6 V;  1L0L H;  2RQ6 A;  1ZTE A;  3MDS A;  3NR7 A;  3S3X A;  2GV9 A;  4JAV A;  2AW9 A;  3AG7 A;  4CH3 A;  1YCI A;  4PA9 A;  1FJG O;  1BGY H;  5DN6 G;  1FFX B;  3CC7 V;  4LFC B;  3T2M A;  1AVM A;  4PD4 F;  4PA3 A;  3VQY A;  1JVM A;  1P4R A;  5LOV B;  2IW5 A;  5D5P A;  4KHP B;  4J10 A;  5DED A;  3BRC A;  4JYA O;  4ZI7 A;  3L9D A;  3SPG A;  2B9Z A;  2F1M A;  1TAE A;  3ZN1 A;  5JCO A;  4NB5 A;  2HFE C;  5IYC O;  1VQK V;  5LMU O;  2ATK C;  2EZO A;  2JVD A;  3CCL V;  4R8C A;  1GH6 A;  5HFL A;  2FL4 A;  2JEX A;  4B7K A;  2HHH O;  1JMK C;  1FD9 A;  1XQ8 A;  1MZE A;  4LWS A;  2LJ2 A;  4X1I A;  3L72 H;  5E79 Z;  4DV0 B;  4RAI A;  1XMO B;  3CC2 V;  2DYS C;  1WAZ A;  4DV3 O;  4BIU A;  5CN0 A;  2DWE C;  4DR3 O;  1HR0 B;  2ZKO A;  1P7G A;  2GBO A;  1COW G;  3LSU A;  1FXH A;  4TQD A;  3ZMZ A;  4UCR A;  1SQX H;  1N4C A;  5EYP A;  4JI1 B;  2CTR A;  5CA0 A;  1EBO A;  2AXT Z;  2XAH A;  4LP8 A;  5B1B C;  2JJ2 G;  4WBN B;  4GKK B;  3I55 V;  3J81 N;  2LGQ A;  2YIB A;  2Z3Y A;  1N33 O;  1HP8 A;  3MD0 A;  4WFF A;  2GHY A;  2QWR B;  4LF7 B;  3WB2 A;  2OTL V;  2UUA B;  2WA4 A;  4FIP C;  3FB8 C;  3LDE A;  1K34 A;  3VOU A;  4E4E A;  2KSD A;  4CZZ A;  4N21 A;  2JS3 A;  1WPB A;  3STL C;  3SJQ C;  1XUQ A;  3VQX A;  4DV4 B;  1H8E G;  2QWP B;  2JS5 A;  4I0X A;  4TV9 A;  4PJ0 Z;  4KHP O;  5LL6 Y;  4FM2 A;  3GB7 C;  3R66 A;  2K1E A;  1NBM G;  2XAJ A;  5H6R A;  3DXR B;  2DE0 X;  5K1X A;  4NR1 A;  3KKY A;  2ZIN A;  5LP6 A;  3THO A;  2JGU A;  1TA8 A;  5B1A C;  1SQF A;  3CCM V;  4D7T A;  1DLB A;  2E3C A;  1YDX A;  2ODM A;  4J42 A;  3CP1 A;  2X6B A;  4IGG A;  3D36 C;  1URF A;  5IJ0 A;  2IH1 C;  1F7Y A;  3WG7 B;  1V54 C;  2E76 B;  4O4J A;  1XMO O;  2YSU B;  4PI2 A;  1MZF A;  2FYU H;  3ZMT A;  4J41 A;  1SKV A;  2YEV B;  2F43 G;  2C2A A;  2Q9L A;  5KA5 A;  1O9G A;  2N05 A;  2W0X A;  5H5N A;  1KC8 W;  3C3T A;  3N2K B;  1K5Q A;  3ZX6 A;  1M56 C;  4GKK O;  2ZE8 A;  1PNM A;  3ABM B;  3JD2 A;  3EXA A;  4NYK A;  1K4D C;  1VQM V;  1Z5V A;  2QTS A;  2UUA O;  1FXV A;  2YIB D;  1Q6U A;  2P90 A;  3JYC A;  2HP8 A;  1LUV A;  5B3S C;  3QO5 A;  4I55 B;  2M6Y A;  1XL6 A;  3TET A;  3G80 A;  1TVK A;  3HKD A;  4HNA A;  1OZ0 A;  2ITC C;  3HR0 A;  5JH7 B;  4CH6 A;  4IYI A;  5B1N A;  4GX5 A;  1FXK B;  2YI8 A;  1K33 A;  4UB6 Z;  5LXT A;  1H8H G;  1OHH G;  2EIK C;  3K03 A;  4X9Q A;  2WLL B;  2HEP A;  4Z2W A;  2GTS A;  2Q8V A;  4O4H A;  2QR4 A;  2CAZ C;  2QWQ B;  3CS5 A;  5ITZ B;  1HNW B;  1FPO A;  4X1K A;  2H94 A;  4NXM O;  4IIJ A;  2R72 A;  2XAQ A;  3ASN C;  4PA4 A;  4GX1 A;  3T1C A;  1SQB H;  1IZ3 A;  3CXH F;  4MTX A;  5JQG B;  3E8G A;  1H2G A;  3APO A;  4DO2 A;  1H2S B;  3W7X A;  4FLU A;  1R6K A;  1PM9 A;  2BTQ A;  4GYC B;  3RVZ A;  5EZY B;  3EHB B;  2W6J G;  3H1I H;  3RYF B;  1QLE B;  4EB6 B;  1J5E B;  2P7T C;  2BSK A;  5KUM A;  2DN9 A;  2QEX V;  1SQV H;  5C93 A;  4YY3 O;  2PYJ A;  1XNR B;  1R3I C;  4LH6 A;  5BXZ A;  4TOI A;  3L71 H;  2YXY A;  2XAS A;  1VQP V;  1HWY A;  2Q7G A;  3K0D A;  1AJQ A;  1BHA A;  1S77 D;  1XBL A;  4YHH B;  1BS3 A;  4UVC A;  2YIC A;  2WLH A;  2PZS A;  4FLZ A;  3A8T A;  2FB5 A;  2WLN A;  1JJ2 U;  2UUB B;  3K79 A;  2A79 B;  2EIJ B;  3JAK B;  3H1H H;  4KXR A;  3SYQ A;  5L3F A;  1KUQ A;  1ZL8 B;  3K04 A;  3RBZ A;  4UCT A;  1BT8 A;  3ZS8 C;  2PGG A;  3OGC C;  5LHH A;  1Y76 A;  1HNW O;  1KP3 A;  2AHY A;  1PNL A;  3JAT B;  2NR5 A;  4PA6 A;  3SR2 C;  3CCU V;  5LGN A;  4PA7 A;  2PI5 A;  3SJA C;  2A06 H;  2F4V B;  2OWO A;  4LF8 O;  1SQG A;  4UUJ C;  1YI2 V;  1V54 B;  4RUE A;  4JZG A;  2QTO A;  2UXX A;  1Q81 W;  1XIL A;  3WFV A;  3ABT A;  5KMG B;  1QHT A;  3H01 A;  3ICX A;  4JI5 B;  3FD9 A;  2XT9 A;  4B7E A;  5A2Q N;  5FPO A;  2R9A A;  5KLV H;  1QNM A;  4WCE V;  1J5E O;  2QA4 V;  1M90 W;  1KB9 F;  1RP3 B;  4JTD B;  1XNR O;  3MHS C;  1Q43 A;  3UCS C;  1OCO B;  3JAW B;  1HDJ A;  3RYH A;  5BZB A;  1XI1 A;  1M9N A;  5J2U A;  4PEL A;  4GKJ B;  4RUF A;  3ZRS A;  1KKC A;  1ZLZ A;  4KL1 A;  4YHH O;  1TUB A;  2D3O W;  3UT5 B;  5KA6 A;  4L8J A;  4UCU A;  3G71 V;  3JAM N;  4U7O A;  4UB8 Z;  1IBL B;  3J7A U;  2UUB O;  1NQT A;  3K9S A;  1AJN A;  4JI2 O;  4MTO A;  1UFI A;  5L3G A;  3K5M A;  4PDM A;  2A3Q A;  1Y74 B;  1IBM O;  3N2G A;  3D3I A;  3T1Y B;  1NI8 A;  1H2K A;  1Q82 W;  1KQS U;  3JAS A;  4R7C A;  4LF9 B;  1VQN V;  3TJT A;  5IWA O;  4DR1 O;  1K7D A;  1L8D A;  3AG4 B;  1XOU A;  3ZMS A;  3SYP A;  3P3P A;  1F23 A;  4JI5 O;  2QWN B;  4JI3 B;  5J9P C;  1LR1 A;  4QPK A;  4CC6 A;  5FNV B;  2H8P C;  2P06 A;  2ZT9 B;  1P84 F;  1SA0 B;  4JZ2 A;  4JV5 O;  4GX2 A;  2DYR B;  4LFB B;  1L0N H;  4ZOL A;  1NKD A;  5H6Q A;  2F93 B;  1NTK H;  2DJV A;  4JPR A;  4B3R O;  2ETN A;  5IYZ A;  5CBF A;  3FFQ A;  3FKS G;  1BHB A;  1YF2 A;  2WLM A;  1MMM A;  5JJN B;  3SYA A;  3ZRX A;  2NNU A;  4DV1 B;  1W0J G;  3BVO A;  3SYC A;  1TUE B;  4MVQ A;  4UFZ A;  5FLX N;  4J9Z B;  4O4L A;  4PDV A;  2W0F C;  3NXS A;  5BR8 O;  3WB0 A;  4UCV A;  1IBL O;  4ZHQ A;  2WA3 A;  1K9M W;  3HKE A;  2KQX A;  1XDC A;  1WB7 A;  3WG7 C;  4F4L A;  4MTG A;  3B8M A;  1S3J A;  3T1Y O;  4GX0 A;  1ZX3 A;  3AK3 A;  3FAV B;  1YZB A;  1VQ5 V;  3FYI B;  3A0R A;  4NXN B;  3CCE V;  3IJ4 A;  3L75 H;  4B3M B;  3UM7 A;  2WWW A;  4LF9 O;  2BCC H;  3JD4 A;  5JJE B;  3PJS K;  3CRC A;  2KG7 A;  1R3L C;  3CB2 A;  4J7K A;  4O2A B;  2CH7 A;  4JF3 A;  4CS3 A;  4IHJ B;  4CC5 A;  5JVD B;  3G4S V;  4B3T O;  4DR4 B;  4X64 B;  3ABM C;  1NH2 B;  3P30 A;  4X66 O;  2EIM B;  3Q4H B;  3CCQ V;  2UUC O;  4JI6 B;  4JI3 O;  2QJ1 A;  4MS2 A;  4G27 B;  3IFX A;  2LFS A;  2WPD G;  3ZIA G;  1M57 B;  3E35 A;  3SJC C;  4HBN A;  5CBG A;  4LFB O;  1N0N A;  1FKA O;  4FK5 C;  1GM8 A;  4N23 A;  2YI9 A;  1KMI Z;  1OCC B;  5IYB O;  3OMI B;  3B09 A;  1FXK C;  1GAX A;  1GKF A;  2IJH A;  2V1D A;  2XND G;  3ETD A;  3DC5 A;  4DV7 B;  4RWU A;  3C90 A;  3G67 A;  4DV1 O;  3CRA A;  4DR6 O;  2WLK A;  3M8A A;  1K4C C;  3ZRW A;  4QE9 A;  1OCR B;  3JSL A;  2DOS A;  2PYL A;  2GTA A;  1K8A W;  4LF5 O;  4GCZ A;  1JFF A;  1GMG A;  3LSQ A;  4K35 A;  2GUZ B;  4LWS B;  4OXS A;  1KD1 W;  2E75 B;  3PN1 A;  4WFE A;  1B6Q A;  4LF6 O;  1T5E A;  4K0K O;  1PL0 A;  2QKA A;  1V55 B;  1VQ6 V;  1YHQ V;  4GLX A;  4Z1V A;  1H2L A;  1VQ9 V;  2B1I A;  1I94 B;  3SYO A;  3CWB H;  1JA8 A;  2ZXW B;  2OIG A;  3OUS A;  3B40 A;  3SPI A;  4NXN O;  2E74 B;  2RMK B;  2A9H A;  1JJO A;  4B3M O;  5CBH A;  5JWP A;  5F2V O;  5LOV A;  4JI8 O;  3F5T A;  4QPJ A;  3ZED A;  1QCE A;  3OE7 G;  1VMG A;  2Q68 A;  3JD1 A;  4QE7 A;  1Q7Y W;  4X64 O;  3BY6 A;  3CC4 V;  1N32 O;  5CA3 A;  1QLE C;  1ORQ C;  3RYI B;  4JI6 O;  4X89 A;  4F6E A;  2Y48 A;  1IBK B;  2QKC A;  4MTF A;  1NVP D;  3TCU A;  2BTO A;  4UCO A;  2UXC O;  4I7Z B;  1M1K W;  4LH7 A;  4O4I B;  3MAQ A;  4E2L A;  2DQ3 A;  2DW4 A;  4KUM A;  5A9G A;  1WP8 A;  4I0X B;  1US6 A;  1U97 A;  1Q8I A;  4AQY B;  4H0L B;  1WLE A;  3IGA C;  4FVM A;  4LFC O;  3ABL C;  4C7U A;  4Q20 A;  1YVW A;  2RJZ A;  1AI7 A;  2DWD C;  2RNB A;  1BQZ A;  1O9H A;  5KX5 B;  3CRR A;  3ZHV A;  2OYQ A;  2EIJ C;  4WBN A;  1D5A A;  3KCY A;  1U96 A;  3JAL A;  1WP7 A;  3AG2 B;  2A7W A;  3HKB B;  3OGI B;  4FLX A;  1PV0 A;  5L3E A;  4O4J B;  1V9P A;  3CRQ A;  2JRI A;  4H13 B;  3B4S A;  4W4L A;  1AR1 B;  1YTF D;  3JD3 A;  5IDJ A;  1R3K C;  4DV0 O;  2F66 C;  2ADP A;  1H2N A;  1IXM A;  1HR0 O;  1UJW B;  5IJ9 A;  2OTJ V;  3B77 A;  2HVJ C;  2EIN C;  1EZJ A;  3DXR A;  4UV8 A;  4RO2 A;  5J2T B;  2YUA A;  3HB3 B;  4JI1 O;  1D5N A;  1HNZ B;  1IBK O;  1FFT B;  3JCU Z;  4DUY B;  4LF4 B;  2RN9 A;  1OCO C;  2R9I A;  3T1H B;  1IVS A;  4LF7 O;  3UO3 A;  2JGD B;  3BPZ A;  2LW7 A;  1VQ8 V;  4XDJ A;  1OJH A;  1MSD A;  3D8C A;  4EKW A;  1K97 A;  2Z5U A;  4YJ2 B;  4P30 A;  4WFA V;  3P3N A;  4AQY O;  2M7W A;  2EZP A;  2XOK G;  3H9V A;  4H37 A;  3JD0 A;  2O57 A;  5LXT B;  4B3S B;  4IT5 A;  1JPX A;  3OW2 U;  4DV4 O;  5CA1 B;  3ZMV A;  4TV8 B;  4RQE A;  3N2K A;  4ABM A;  1SQQ H;  2VQF B;  3CHX A;  3X2Q C;  4LBE C;  4QGP A;  4O4H B;  3OMA B;  2PUS A;  4X1K B;  2OT5 A;  3ZN0 A;  3AEI A;  3UQ8 A;  3UKM A;  4J7J A;  4DR2 B;  3CE2 A;  3ETQ A;  1KEC A;  1YJW V;  2F23 A;  4L87 A;  4HYO A;  3RW0 A;  4PHZ A;  4ASU G;  4X20 A;  5JH7 A;  2LP7 A;  3AG4 C;  2BTQ B;  3BA8 A;  1NS1 A;  4FFB A;  2NLJ C;  1FXK A;  2EJR A;  1CP9 A;  3QVN A;  1FS0 G;  4MVZ A;  3E86 A;  4I4T A;  3ZHQ A;  2AZ2 A;  2WAM A;  1X4T A;  2IU0 A;  3SPC A;  4NTY A;  1H2M A;  4FPP A;  1HNZ O;  2BSK B;  1IX9 A;  2WLL A;  4DUY O;  4JI0 B;  2DYR C;  4FFK A;  4DV2 B;  4LF4 O;  4MSW C;  2CUG A;  3T1H O;  1NU1 H;  1M93 A;  2CTP A;  2QGN A;  1JOY A;  3DC6 A;  4LNU A;  4HAM A;  5ITZ A;  2LW1 A;  2YID A;  4Z1M G;  3ETG A;  2AHZ A;  4RQF A;  4U3F H;  1I5X A;  2FKX A;  3OAA G;  5E1A C;  4DRX B;  3RVY A;  5JQG A;  5IY5 B;  4B3S O;  4YJ3 B;  1AR4 A;  1W0K G;  4X62 B;  2OCH A;  1Y67 A;  4U3J B;  2IU3 A;  1KKD A;  1VEW A;  1AI4 A;  5EZY A;  4F6R B;  1P7B A;  3OMN B;  3OTF A;  1XHZ A;  3HPL C;  2ZDI C;  4W4K A;  4DK0 A;  3J80 N;  3ABL B;  4AHC A;  2N74 A;  2Q7H A;  3E83 A;  3K59 A;  1Y76 B;  3QNE A;  3ABK B;  5EBM C;  3JAR B;  2R9R B;  3F5W C;  1I0H A;  3MHH C;  4DR2 O;  1CPY A;  1EM1 A;  2X0L A;  1BQ0 A;  3LDC A;  3CCV V;  2IBZ H;  1OV9 A;  2QSA A;  3TXS A;  3JSN A;  1MG1 A;  4MVU A;  4PDR A;  4EFB A;  4UXN A;  2ARH A;  1EN6 A;  2EIM C;  1HW7 A;  1VQO V;  4DW1 A;  2JJ1 G;  4FJC C;  3S3W A;  1DGS A;  4LR3 A;  2V4D A;  4OPA A;  2ZD9 A;  1M57 C;  4P9O A;  1QR8 A;  3K58 A;  3SPJ A;  3JAK A;  4DV2 O;  2Y69 B;  1XMQ B;  3HKC B;  1ZL8 A;  1N34 B;  2OCC B;  3ASO C;  2EIN B;  5CMU A;  2CE4 A;  1OCC C;  2EUL A;  3O65 A;  3RYH B;  2IJJ A;  4X65 B;  5LHI A;  4K8Z A;  5JJJ B;  3U11 A;  3CSX A;  3K5L A;  1FYJ A;  2KKW A;  3H1K H;  4NVP A;  1LNQ A;  5JCO C;  3ZCC A;  4X1Y A;  1OCR C;  4H44 B;  1XEQ A;  5L3C A;  3D36 A;  4MVM A;  1W2B U;  4JGS A;  3RYC B;  4X62 O;  5LHG A;  3RT3 C;  3LNN A;  4FLW A;  3B2E E;  5H2F Z;  1W59 A;  1NTM H;  1G8M A;  4JAS A;  5LYJ A;  5KMG A;  1ZSP A;  1BL8 A;  3AG1 C;  5LMN B;  4LFA B;  5EK0 A;  1V55 C;  4J11 A;  5GON A;  1Q6I A;  3KCX A;  1GRJ A;  1SRY A;  3N2G B;  1AP5 A;  3AG3 B;  2ZXW C;  3L74 H;  4TWK A;  2BE3 A;  1VQ0 A;  1AIL A;  3ZHS A;  3X2Q B;  3EVK A;  4A5U B;  2YXL A;  4Q6G A;  1L1F A;  3QG5 A;  3JAW A;  3GVM A;  2E5L B;  4JAU A;  4TUY A;  5FPR A;  3E22 A;  4KP4 A;  4BW5 A;  1QVG U;  2F4V O;  3OT7 A;  3OFN G;  4FLT A;  4BR6 A;  4OX9 B;  4QNH B;  3UT5 A;  1S5H C;  3FYE B;  2VWJ A;  3ZMU A;  1RFY A;  5C8Y A;  1Y66 A;  4H33 A;  5L3D A;  1PP9 H;  1XMQ O;  5B66 Z;  2IM9 A;  2LFR A;  1N34 O;  3SPH A;  1MOF A;  4AI8 A;  2Y0I A;  1B04 A;  5EIB C;  1Y74 A;  4X65 O;  1QR9 A;  3APQ A;  4DR5 B;  2HLD G;  1G4Y B;  5LBQ A;  3ZBH A;  4DXW A;  2QM4 A;  4O4L B;  4QIW F;  4YIP A;  5BY1 A;  1VQL V;  1MNG A;  3QF7 A;  1A32 A;  1Q86 W;  1WB8 A;  1YSC A;  5LP6 C;  4I50 B;  2ZM6 B;  3AG2 C;  4R6Z A;  4FM1 A;  4GKJ O;  4CBC A;  5LMN O;  4UVB A;  4MVR A;  1D2D A;  5KHK A;  5CB4 A;  1E1R G;  2EIL B;  2D2C B;  2DQ0 A;  5LA6 B;  1SA0 A;  3E8F A;  2Q0O C;  1ZUQ A;  3K57 A;  1ENV A;  3CJH A;  3RN4 A;  3OD4 A;  1YJN V;  4DV5 B;  1OCZ B;  4XBF A;  1K5S A;  2Y4U A;  2E5L O;  5BMV B;  4O2B B;  2X7R B;  2VWK A;  2FTK A;  1JCH A;  2ZQM A;  4ICG A;  3ZRV A;  4YIO A;  3VQV A;  1PD3 A;  4UCS A;  5EBL C;  4EEQ A;  2HG5 C;  3CMA V;  1GK9 A;  4CH5 A;  4D6T H;  4OX9 O;  5LMU B;  3LUT B;  2CGN A;  2L35 A;  3LNM B;  3SDL A;  3RGB A;  1N8R W;  2HHH B;  2MK3 A;  1VP7 A;  2Y4T A;  2ZDI A;  2XTA A;  2WLI A;  4P2Z A;  2Z0A A;  1WA8 A;  5DEC A;  3H1J H;  1S76 D;  1JQ0 A;  1RSO A;  1XRE A;  3OR7 C;  5L3B A;  4DV3 B;  1DTO A;  4DR5 O;  3FAV A;  2LO1 A;  1ARO P;  3U10 A;  4CS2 A;  1E1Q G;  1BMF G;  2HJF C;  4JYB A;  3ASO B;  2N04 A;  3DSQ A;  2P6J A;  4O2A A;  1QLN A;  2QKS A;  3BAA A;  4IHJ A;  4LC1 A;  1GM9 A;  1JFF B;  4ZI7 B;  3BAB A;  3Q4H A;  5LGT A;  2UXN A;  1X59 A;  2P22 C;  4DK1 A;  3OUF A;  1YTF B;  4JI7 B;  4WF9 V;  5GTI Z;  5LGU A;  2VRZ A;  3FB7 C;  3K3W A;  3QO7 A;  3CRM A;  3ML0 A;  1RPO A;  2ZNJ A;  3AG1 B;  4X1I B;  1F51 A;  5EBW C;  4DV5 O;  4OPH A;  2EBO A;  3FX7 A;  2H3O A;  2XUM A;  4JTA B;  2YIA A;  1FFX A;  2X6A A;  4DV6 B;  2P4K A;  4JI4 B;  1NJI W;  1H38 A;  2Y0P A;  1M4U A;  3K08 A;  5EYP B;  5CA0 B;  1XNQ B;  1GN2 A;  1MSW D;  4J9Y B;  4DR4 O;  1GN4 A;  1YIJ V;  2ZIM A;  1Z2G A;  1AJP A;  2GUZ A;  2HKO A;  1BE3 H;  3OEH G;  4UV9 A;  4TSF G;  4DUZ B;  3CX5 F;  1NTZ H;  2Q73 A;  1GO3 F;  3W7W A;  2QM8 A;  2MW2 B;  3OEE G;  4PDL A;  3K0G A;  5IY5 C;  2WLJ A;  2JK5 C;  4ZIB A;  1ZAU A;  4TV9 B;  1F4M A;  3P32 A;  5D5Q A;  3OTO B;  4DV7 O;  3JAL B;  1I5Y A;  1AI5 A;  4MW3 A;  3F7V C;  2K9P A;  4FMT A;  4NTX A;  3RYI A;  3ABK C;  3GWK C;  4JI7 O;  2HR3 A;  1NH2 D;  5LP6 B;  1EFR G;  1RM1 C;  3E2E A;  4O4I A;  5IJ0 B;  2AZ0 A;  1VZY A;  3T4D A;  3CXC U;  3A0H Z;  5KAI Z;  2R70 A;  3ZHU A;  4CS4 A;  1I94 O;  4KFM A;  2PI4 A;  1I08 A;  5IJ9 B;  2JEU A;  4DV6 O;  3SGI A;  1GTO A;  3SJB C;  4JI4 O;  2UU9 B;  2Q5Z A;  1AR5 A;  4FM0 A;  2ADQ B;  4FLY A;  4GZR B;  2XAF A;  2ZIO A;  2RCV A;  2ZE7 A;  1XNQ O;  5KHG A;  5KX5 A;  2A0L A;  2QWO B;  4PV1 B;  1B06 A;  2CDY A;  2Y69 C;  1IDS A;  2OCC C;  1VAR A;  1VF6 C;  1Q3E A;  2ILM A;  2AGA A;  3HKB A;  4AIL C;  2CK3 G;  1K73 W;  2P67 A;  4NXM B;  4DUZ O;  3AK2 A;  4DYL A;  1R6T A;  4NTW A;  1TVK B;  2EJ7 A;  3HKD B;  4HNA B;  1GN3 A;  1AI6 A;  1PNK A;  2GDS A;  3I56 V;  4X8A A;  3OTO O;  1PL4 A;  2LQT A;  1JR9 A;  2YEV A;  2VQE B;  2YXH A;  3BA9 A;  1G1X B;  2YC0 A;  1KBH A;  4MVO A;  1Q90 D;  5J2T A;  3AG3 C;  1DF4 A;  2F95 B;  3FB5 C;  3EFF K;  1S0V A;  1NR1 A;  1JX9 A;  4YY3 B;  4G28 B;  3O9O A;  2X6C A;  1CXZ B;  2UXB B;  3W7U A;  2JGD A;  4IIJ B;  1BSM A;  4X20 B;  2FML A;  4FFB B;  1SER A;  4J80 A;  4I55 A;  4YJ2 A;  2HVK C;  4NKG B;  2JIZ G;  3VQW A;  4I4T B;  1B3Q A;  3KG2 A;  1SQP H;  2JDI G;  3K9A A;  2ZR3 A;  2UU9 O;  1THZ A;  3CCS V;  5EIB D;  5CA1 A;  5B1O A;  4QJF B;  4TV8 A;  1FAF A;  3K06 A;  2OIE A;  5DM6 V;  5FL7 G;  5KHJ A;  3IC7 A;  1TGO A;  2L6L A;  4OGQ B;  3T4Z A;  1WPX A;  4K3A A;  2KB1 A;  4XDK A;  4LNU B;  1PKX A;  3C3S A;  2LGW A;  3WB1 A;  1Q6H A;  2NN4 A;  3G6B A;  3UO2 A;  1VQ7 V;  4LF8 B;  4CH4 A;  1R3J C;  4MVS A;  1GM7 A;  1QU7 A;  3TXQ A;  3U0Z A;  1XHX A;  1I7F A;  2ZR2 A;  2DYS B;  5KHI A;  4DW0 A;  4ZBM A;  3A0B Z;  2QE7 G;  5K1P A;  1MA1 A;  4D7S A;  2VQE O;  3TGU H;  1KP2 A;  4JYY A;  4R50 A;  2EIL C;  3CME V;  5B1B B;  5KUK A;  2VQF O;  2QDO A;  3RYF A;  1OCZ C;  4EB6 A;  5TIS Z;  1HNX B;  2UXB O;  3DTU B;  3M99 B;  2B5U A;  1YXB A;  1LUW A;  4MW8 A;  1K3E A;  1ROP A;  3BCC H;  5AG2 A;  1RM1 B;  3FB6 C;  1J95 A;  4DRX A;  3M7M X;  1Q5O A;  3L73 H;  4YJ3 A;  2BOB C;  3IC9 A;  2YDE A;  1VQ4 V;  4JTC B;  2PTM A;  3N27 A;  4U7N A;  3BEH A;  2IJK A;  2P4V A;  4U3J A;  2P5O A;  3ETE A;  2Q69 A;  4F6R A;  1XL4 A;  2GSM B;  5GTH Z;  3DGE A;  4JI2 B;  5KHH A;  2B1G A;  1IBM B;  3JAR A;  4JI0 O;  3QTC A;  1NT2 B;  5B1A B;  3ZHT A;  1ZWI C;  1SF9 A;  4X1Y B;  4BIZ A;  5IWA B;  1NZ6 A;  2ITD C;  5B5E Z;  4DR1 B;  2RDC A;  5IYD O;  4K8X A;  3JAT A;  1NR7 A;  5J2U B;  3STZ C;  3OM3 B;  4I9W A;  1GN6 A;  1VF7 A;  5LYJ B;  4BWA A;  3D3Q A;  3CCJ V;  2G38 A;  4GUN A;  2ZE5 A;  1TUB B;  3GWO A;  4TQF A;  5GON B;  2PY5 A;  1EN4 A;  4JV5 B;  1YEW A;  1M56 B;  1YIT V;  2CGO A;  3HKC A;  4DR7 B;  1VF6 A;  2ZE6 A;  1RPR A;  1Y6X A;  3R65 A;  1HNX O;  3BHP A;  4B3R B;  4EFE A;  1IXB A;  1P49 A;  1Z5W A;  2XHB A;  2CTQ A;  1PPJ H;  4TUY B;  3RWR D;  3E22 B;  1QBZ A;  4WFG A;  4IYH A;  5B3S B;  3JAS B;  2XAG A;  4MT8 A;  4PI0 A;  3A2F A;  3WU2 Z;  3TK1 A;  5BR8 B;  1CEZ A;  4J7Z A;  1YJ9 V;  3RYC A;  5IE9 A;  3B8N A;  4I5S A;  4WFH A;  4P9P A;  4ZKI A;  5C8Y B;  5HFM A;  3I5D A;  1S72 V;  3AK1 A;  1WN7 A;  1BCC H;  2PF4 E;  5KAF Z;  1Y4M A;  1N36 B;  3QO8 A;  4FZ0 A;  3W7T A;  2CTW A;  2EIK B;  3RFR A;  4GT1 A;  2W6I G;  1EZV H;  3BFR A;  4ZOL B;  1WJZ A;  5EC2 C;  2IJI A;  4X88 A;  5IYZ B;  4BW9 A;  2Q67 A;  1QVF U;  1DF5 A;  2ZNI A;  1SET A;  3E8B A;  1S5L Z;  4BAY A;  2EX3 A;  3ASN B;  4TT3 G;  4IL6 Z;  2UXD B;  4B3T B;  2IH3 C;  1S5J A;  1EN5 A;  1WNS A;  3LSS A;  2ZCE A;  4X66 B;  2UUC B;  1BZK A;  1K92 A;  2HJD A;  2BOC C;  2V7Q G;  5CB4 B;  3KZI Z;  4WFB V;  4ZHQ B;  3HKE B;  3CJH B;  4XDL A;  4LFA O;  4DR7 O;  1IUR A;  3ZHR A; 
#chains in the Genus database with same CATH homology
 2ZIM A;  3SJA C;  4TV8 B;  5FNV A;  2F4V B;  2Q0A A;  3N2K A;  2OWO A;  1M5I A;  1FJG B;  4FLV A;  4B08 A;  1SQG A;  2VQF B;  3CHX A;  4DUZ B;  4DR6 B;  4O4H B;  2PUS A;  5KMG B;  4X1K B;  1QHT A;  4JI5 B;  3ICX A;  3IAY A;  3UQ8 A;  5FPO A;  4LF5 B;  4ZIB A;  2R9A A;  4I50 A;  4DR2 B;  3ETQ A;  1KU9 A;  4JYA B;  1ZAU A;  2Q7E A;  4TV9 B;  5D5Q A;  4PHZ A;  3OTO B;  4LF6 B;  3JAL B;  4X20 A;  5JH7 A;  4K0K B;  1Q43 A;  2BTQ B;  3BA8 A;  4FFB A;  3JAW B;  3RYI A;  5LA6 A;  3RYH A;  4I4T A;  1XI1 A;  1QQC A;  1X4T A;  5LP6 B;  5J2U A;  4I9Q A;  3K5N A;  1G6U A;  4GKJ B;  4JI8 B;  4O4I A;  5BMV A;  5IJ0 B;  4KL1 A;  4O2B A;  4DR3 B;  1VZY A;  4JI0 B;  4DV2 B;  1TUB A;  3UT5 B;  4L8J A;  4UCU A;  1M93 A;  1N32 B;  2R70 A;  4CS4 A;  1IBL B;  3K5O A;  4LNU A;  5ITZ A;  5IJ9 B;  3SGI A;  3SJB C;  2UU9 B;  5JVD A;  2UXC B;  4FM0 A;  4FLY A;  3K5M A;  2ZIO A;  1N33 B;  4DRX B;  5KHG A;  5KX5 A;  3N2G A;  5JQG A;  3T1Y B;  2RQ6 A;  4YJ3 B;  2GV9 A;  3JAS A;  4X62 B;  1Q3E A;  4U3J B;  4CH3 A;  4LF9 B;  5EZY A;  1FFX B;  3HKB A;  4F6R B;  3OTF A;  1XHZ A;  4AIL C;  4NXM B;  4LFC B;  4DK0 A;  4AHC A;  1L8D A;  2Q7H A;  3VQY A;  3K59 A;  1TVK B;  5LOV B;  3HKD B;  5D5P A;  3JAR B;  4KHP B;  4HNA B;  4JI3 B;  3BRC A;  4CC6 A;  4ZI7 A;  5FNV B;  2F1M A;  1TAE A;  1SA0 B;  5JCO A;  4LFB B;  2VQE B;  3BA9 A;  3JSN A;  4ZOL A;  2F93 B;  2JVD A;  4EFB A;  5J2T A;  1JMK C;  5IYZ A;  1HW7 A;  3FFQ A;  2F95 B;  1XQ8 A;  4X1I A;  1DGS A;  5JJN B;  4LR3 A;  4YY3 B;  4DV0 B;  1XMO B;  2V4D A;  4DV1 B;  4UFZ A;  3K58 A;  2UXB B;  1HR0 B;  4O4L A;  3JAK A;  4IIJ B;  1XMQ B;  4X20 B;  3HKC B;  1N34 B;  4FFB B;  3WB0 A;  4TQD A;  4UCV A;  4UCR A;  4I55 A;  4YJ2 A;  3RYH B;  5EYP A;  4JI1 B;  3VQW A;  4ZHQ A;  4I4T B;  5CA0 A;  4X65 B;  3HKE A;  4K8Z A;  4WBN B;  5JJJ B;  4GKK B;  3U11 A;  5EIB D;  3CSX A;  3K5L A;  5CA1 A;  2YIB A;  2KKW A;  4TV8 A;  4NVP A;  5JCO C;  4X1Y A;  4LF7 B;  3WB2 A;  5KHJ A;  2UUA B;  4NXN B;  1TGO A;  4B3M B;  3RYC B;  3LNN A;  4FLW A;  3B2E E;  4LNU B;  5JJE B;  5LYJ A;  5KMG A;  4O2A B;  3CB2 A;  3WB1 A;  5LMN B;  1WPB A;  4LFA B;  4CS3 A;  4IHJ B;  4CC5 A;  5JVD B;  3VQX A;  4DV4 B;  4X64 B;  4DR4 B;  2JS5 A;  5GON A;  4TV9 A;  3N2G B;  4JI6 B;  4FM2 A;  4CH4 A;  4LF8 B;  2QJ1 A;  1VQ0 A;  3U0Z A;  1XHX A;  1I7F A;  2YXL A;  5KHI A;  4Q6G A;  5K1X A;  3SJC C;  3QG5 A;  3JAW A;  4HBN A;  2E5L B;  5K1P A;  4D7S A;  4TUY A;  2ZIN A;  5FPR A;  3E22 A;  5LP6 A;  3THO A;  2JGU A;  1TA8 A;  1SQF A;  2YI9 A;  1KMI Z;  4D7T A;  2E3C A;  5IJ0 A;  4FLT A;  4OX9 B;  4DV7 B;  4O4J A;  3UT5 A;  3RYF A;  4PI2 A;  2VWJ A;  4EB6 A;  1HNX B;  3JSL A;  5C8Y A;  1SKV A;  2IM9 A;  2PYL A;  1O9G A;  1JFF A;  1B04 A;  5EIB C;  3N2K B;  3M7M X;  4DRX A;  1Q5O A;  4DR5 B;  4YJ3 A;  3PN1 A;  1T5E A;  2PTM A;  4GLX A;  4U3J A;  1I94 B;  2P5O A;  1Z5V A;  2QM4 A;  4O4L B;  4F6R A;  3QF7 A;  2YIB D;  1JJO A;  5LP6 C;  4I50 B;  2ZM6 B;  4JI2 B;  5KHH A;  4I55 B;  4FM1 A;  1TVK A;  5LOV A;  3HKD A;  1IBM B;  3JAR A;  3ZED A;  4HNA A;  5JH7 B;  4CH6 A;  3QTC A;  1NT2 B;  5KHK A;  5CB4 A;  4X1Y B;  3RYI B;  5LA6 B;  1SA0 A;  2YI8 A;  5IWA B;  3K57 A;  1IBK B;  5LXT A;  2BTO A;  4DR1 B;  4K8X A;  3JAT A;  5J2U B;  4DV5 B;  4UCO A;  4LH7 A;  1VF7 A;  5LYJ B;  4BWA A;  4O4I B;  5BMV B;  4O2B B;  3MAQ A;  2VWK A;  2HEP A;  1TUB B;  3VQV A;  4TQF A;  5GON B;  4UCS A;  2PY5 A;  4O4H A;  2CAZ C;  1Q8I A;  4EEQ A;  1YEW A;  5ITZ B;  4AQY B;  1HNW B;  4JV5 B;  4CH5 A;  4X1K A;  4IIJ A;  2R72 A;  4FVM A;  5LMU B;  3HKC A;  4DR7 B;  2RJZ A;  3RGB A;  3BHP A;  2HHH B;  4B3R B;  1O9H A;  4EFE A;  5KX5 B;  5JQG B;  1P49 A;  2OYQ A;  1Z5W A;  2XHB A;  4TUY B;  3RWR D;  1H2S B;  3E22 B;  4WBN A;  1D5A A;  4FLU A;  3JAS B;  3JAL A;  1RSO A;  2BTQ A;  4GYC B;  4DV3 B;  5EZY B;  4PI0 A;  3HKB B;  4FLX A;  3A2F A;  3U10 A;  4CS2 A;  4O4J B;  5BR8 B;  1V9P A;  3RYF B;  3RYC A;  4EB6 B;  3DSQ A;  5C8Y B;  1J5E B;  1WN7 A;  4O2A A;  3BAA A;  4IHJ A;  1N36 B;  2PYJ A;  1JFF B;  4ZI7 B;  1XNR B;  2F66 C;  3BAB A;  4LH6 A;  2P22 C;  4DK1 A;  4TOI A;  3RFR A;  5IJ9 A;  4JI7 B;  4ZOL B;  2Q7G A;  5J2T B;  5IYZ B;  4BW9 A;  1HNZ B;  2ZNI A;  2ZNJ A;  2EX3 A;  4X1I B;  4YHH B;  4DUY B;  2UXD B;  4B3T B;  2PZS A;  4LF4 B;  1S5J A;  4FLZ A;  1WNS A;  3T1H B;  2ZCE A;  4X66 B;  2UUC B;  2YIA A;  2UUB B;  3JAK B;  1FFX A;  3BPZ A;  4DV6 B;  4UCT A;  3ZS8 C;  4JI4 B;  2PGG A;  5CB4 B;  4YJ2 B;  1M4U A;  5EYP B;  4ZHQ B;  5CA0 B;  1XNQ B;  3HKE B;  5LXT B;  4B3S B;  3JAT B;  3SR2 C;  5CA1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...