3M7MX

Crystal structure of monomeric hsp33
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
231
structure length
231
Chain Sequence
IMPQHDQLHRYLFENFAVRGELVTVSETLQQILENHDYPQPVKNVLAELLVATSLLTATLKFDGDITVQLQGDGPMNLAVINGNNNQQMRGVARVQGEIPENADLKTLVGNGYVVITITPSEGERYQGVVGLEGDTLAADLEDYFMRSEELPTRLFIRTGDVDGKPAAGGMLLQVMPAQNAQQDDFDHLATLTETIKTEELLTLPANEVLWRLYHEEEVTVYDPQDVEFKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 33 kDa chaperonin
publication title Crystal structure of monomeric hsp33
rcsb
source organism Escherichia coli
molecule tags Chaperone
total genus 53
structure length 231
sequence length 231
ec nomenclature
pdb deposition date 2010-03-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.480 Mainly Alpha Orthogonal Bundle Helix Hairpins helix hairpin bin 3m7mX02
3.55.30.10 Alpha Beta 3-Layer(bab) Sandwich Hsp33 domain Hsp33 domain 3m7mX01
3M7MX 1VZYA 1VQ0A 1HW7A 1I7FA
chains in the Genus database with same CATH superfamily
1MZEA 2ITCC 2DQ3A 3T4ZA 3QNEA 3N2GB 4RUFA 4DV1B 2E5LO 1RPOA 3HKEB 1RP3B 4GYCB 2HLDG 2W6IG 3GWKC 4ZOLA 1VF5B 4H33A 4FIPC 1PKXA 4JTCB 1K73W 5EIBD 1ZX3A 4DR7O 1V9PA 3E89A 4J9YB 2ZINA 2Q6AA 1VQ9V 1SZXA 4L8JA 1OCRC 2JK5C 5KMGA 1KKDA 1HWYA 1AR4A 2P22C 3D36C 3ICXA 1VEWA 2JVDA 2WLJA 5B1AC 3DC6A 1QR8A 3CPWU 4O4LA 1HW7A 1Q43A 1YHQV 3Q4HB 1VF6C 3J80N 3CWBH 3ZHTA 4MVSA 4Q20A 2Q68A 1RSOA 4NTYA 5L3FA 4WFAV 3RVYA 1KMIZ 3UQ8A 3OMNB 1S76D 4RO2A 2CK3G 3ZRVA 4PA6A 5JCOC 2ZE5A 4I0XB 4PHZA 4DV6O 1FD9A 4LFAB 5GTIZ 5LP6B 5B1BC 1D5AA 3OAAG 1VQ5V 4O4LB 4LF6B 1AB3A 1NS1A 1K3EA 4FLWA 5K1PA 5LMUO 4DUYB 2VQEB 3KZIZ 3W7WA 3SPIA 1Y67A 1SC5B 2X6CA 3ZN1A 1F4NA 3BHPA 2PYJA 4DR1O 2Q4PA 1M90W 2OCCC 4YHHB 1Q6HA 3AK1A 2UUAB 2UXXA 3SYAA 4LWSA 2B1GA 1VQ0A 1Q86W 2L6LA 2ZE7A 1KC8W 4OXSA 4X1KA 2LGWA 3AG1B 3SJBC 1ENVA 2LGQA 3OR6C 3CCQV 5EBMC 1I94O 2EULA 4B3MB 2FL4A 5LA6A 1MG1A 1Q6IA 1AP6A 1OV9A 2ZR3A 4WFEA 2ZKOA 1XBLA 5LMNO 1YSCA 4L87A 3TXQA 3X2QC 4MW3A 2W6JG 5CA1A 1S5HC 3QO7A 2HVJC 1ZUQA 3B77A 2NLJC 4DO2A 2ZD9A 3HKBA 4FFBA 3RN4A 3AG2B 3T4DA 4WFGA 2NNUA 4QPKA 2Y0IA 4JGSA 5EZYA 3SPCA 2VQFB 4DV7B 4JI8O 4IT5A 2QWNB 1QVFU 4HNAA 2PYLA 1N4CA 5J9PC 5CA1B 1SZTA 2UXDB 3LSQA 4MVQA 3OT7A 1V54C 4IHJA 1NH2D 1F23A 4R8CA 3HKBB 3JASA 3PN1A 2GTSA 2WLIA 2LP7A 4FFBB 3APOA 2VWJA 1ORQC 1IZ3A 2YUAA 2DOSA 4CS2A 4R6ZA 3CJHA 4D7TA 5A9GA 1SS3A 2QWRB 4DUZB 2VRZA 4JYAB 3HKCB 1UPGA 1BCCH 1EM1A 5EZYB 1EZJA 4YJ3B 3G6EV 1XILA 5LYJA 1GN3A 3QG5A 5EC1C 3ABKB 1GRJA 1ZSPA 2ZM6O 1Z2GA 2YS8A 5B66Z 1K34A 4OGQB 3NXSA 3JASB 2WLIB 4J10A 4PDRA 2B9ZA 3HR0A 5JVDA 2HJFC 5KX5A 1N32B 1EN4A 3ZJZA 2E75B 2QE7G 4NTWA 4K0KO 2NN4A 2BOBC 4UV8A 2UUCB 3FAVA 2Q9LA 1G1XB 1M57C 1IXMA 1FPOA 1YTFB 2ARHA 1DGSA 5LHHA 2ZXWC 1VQOV 2A7WA 3KCYA 3KG2A 3RYFB 1R3IC 4CH3A 3C90A 5JJEB 1XMOB 4FLTA 2YXYA 4FM2A 2EINC 3HKDA 2RNBA 4K3AA 3ETQA 2KG7A 3OW2U 1OZ0A 2OCHA 5JJNB 3S3XA 1K5SA 2BTQB 1GN6A 3UO2A 1Y76B 4U7OA 4CC6A 1BQ0A 1R6KA 4YY3O 4TWKA 1URFA 2EIKC 3ZRWA 3CE2A 3FAVB 4Z1VA 3B8NA 3SDLA 1AR5A 3OTOB 2R9RB 1WP8A 5H2FZ 2EBOA 2UXCB 5GONA 1WB8A 1FKAO 4JI2O 4F4LA 1OHHG 1Y6XA 2LQTA 1DF4A 2X6AA 1VQ6V 2AHYA 3RBZA 1IBLB 1VMGA 5HFLA 2Q7HA 2IJIA 4I55A 2JJ2G 4W4LA 4Q6GA 2N04A 5LGTA 2GUZB 1ZTEA 2EILB 3ZS8C 2P6JA 2H8PC 4JAAA 4LP8A 5KLVH 1GM9A 1HP8A 1B6QA 3ABLB 4DRXA 1KKCA 4DR6B 3THOA 3K9SA 4K8ZA 3M99B 3E2EA 2YIDA 5GONB 2YC0A 3EHBB 3UKMA 4LH7A 1KYOF 1UFIA 1VQLV 3CCJV 3WB0A 4JI3B 2PUSA 3ZBHA 1AI4A 4I55B 3UT5A 4PD4F 4B3TO 4ZBMA 2LFRA 2EIJB 3ETGA 3J81N 1W2BU 3VQXA 2Y69C 1XL4A 5CN0A 3JAKB 1M1KW 3ZMTA 1BQZA 5JQGB 4F6RA 2D3OW 4HYOA 4DV0B 3DTUB 1J95A 2ILMA 2IH3C 2OIEA 1HDJA 5LBQA 4X64B 2QA4V 2QM4A 1HR0B 4LCUC 2XAQA 1RPRA 4X65O 3K04A 2UXBO 3K79A 1XHZA 1R6TA 5GW7A 2DWDC 2LO1A 1VF6A 3M8AA 1HNXB 3AK3A 2E5LB 4CH5A 3G71V 1VQ8V 2XAFA 1IXBA 4F6RB 1CXZB 5IJ0B 3E86A 1SQBH 3JALB 4I4TA 4TSFG 3ZIAG 2CH7B 1OCRB 4DR7B 2ZE6A 2HJDA 3CXCU 3L75H 4DR4B 1G4YB 2HKOA 5BMVB 1P84F 3CMEV 1Q7YW 5FNVA 5B1AB 5H6RA 2YDEA 1TUEB 2QDOA 3CSXA 2G38A 1NTKH 2CTQA 5KUMA 4DYLA 5JWPA 2QM8A 4JI5B 2Q67A 1AI5A 1Q90D 1VP7A 2A06H 4IGGA 3APQA 4HBNA 2QTSA 5IYCO 4NXNB 4I4TB 4PJ0Z 3OFNG 2QTOA 4KHPB 3LDEA 3SYQA 4U3FH 4J42A 3SPGA 3O65A 4P30A 2IJKA 4LR3A 3RYHB 3CC7V 1FJGB 3SYOA 1YEWA 3I55V 2GDSA 1J5EB 1CPYA 4XDLA 4O2AA 4H0LB 5FNVB 5B1BB 4JI6O 3QVNA 4TT3G 1QNMA 4O4IA 1PD3A 3U11A 1SQQH 1ZWIC 4GLXA 3OD4A 4GCZA 3D8CA 5LXTB 2RN9A 1R1BA 2XUMA 1NTMH 4TV9B 4GX0A 3L74H 3TETA 1SETA 2DE0X 3ML0A 2Q8VA 1PV0A 4JI7B 2PI5A 2BCCH 1KECA 4DW1A 4DV2B 5J2UA 3OEHG 1WB7A 3LNMB 3CD6V 2RMKB 4BAYA 2QR4A 1YCIA 1OCCC 4ICGA 2N05A 4DR3B 2JGDB 3T1HB 4OPHA 4BW9A 4NXMB 1JVMA 2ATKC 1BGYH 4O4IB 2K1EA 4FLZA 1DLBA 2F4VO 3IGAC 2P4VA 3EVKA 4HAMA 5FL7G 1FXKC 1BE3H 3SJCC 1YDXA 1WLEA 4B3SB 4GKJO 2EX3A 2ZNJA 3HPLC 2B1IA 5DEDA 3RW0A 3LSSA 3K9AA 1N36O 1N33B 3SJQC 4K35A 4PDVA 3TJTA 5ITZB 2R9AA 2H94A 2K9PA 2XAJA 4LH6A 4LF9O 1AVMA 1XNQO 1QBZA 2Q69A 1M56C 1M93A 4E4EA 3CS5A 4UUJC 4MTGA 2X0LA 1K4CC 2Y4TA 3B2EE 3QO5A 1YITV 3P3NA 1MZFA 3OE7G 5J2TB 3ZRSA 5FPOA 2ZCEA 1BHBA 3CCSV 4LFBB 1H2MA 4ZHQA 3EXAA 1VZYA 2F93B 2IU3A 3W7UA 3CCRV 3BFRA 1TAEA 4X20A 1FXVA 1GTOA 4QPJA 4DR5B 1H38A 4LF8O 3M7MX 4G27B 1V54B 1W59A 2HP8A 1MNGA 4H37A 2WPDG 3ETEA 3E8BA 3T1CA 4ZOLB 4UVBA 4DV5O 1K92A 1NTZH 4CH4A 4G2KA 3T1YB 1JQ0A 2DYSB 1I5XA 2R9IA 2ZIOA 1B3QA 4LFCB 1YF2A 5KMGB 4ZHQB 3CP1A 1UJWB 1IURA 5AG2A 2CE4A 5EYPA 2ZQMA 1T5EA 3H01A 4JI4O 3CCEV 4UVCA 1XI1A 3ZMSA 2F95B 3C3TA 3P30A 5C93A 1RSOB 3MHHC 5LOVA 2YIBD 4LC1A 3VQVA 2V7QG 1LUWA 4UB8Z 4TQFA 1JX9A 3K0GA 4JI1O 3ZN0A 1OCZC 3EFFK 5B5EZ 1M57B 3BRCA 1VQPV 4NTXA 2QKCA 1Z5WA 2ZXWB 1SQFA 2A9HA 2AW9A 4WFBV 2Q7GA 4X62B 3RYCA 4UB6Z 5LGUA 4ZIBA 1WP7A 2EINB 3TCUA 3B09A 1KU9A 3AG4C 2ZT9B 5A2QN 3B8MA 2QEXV 1QHTA 5IT9N 1JOYA 1IBKO 3DC5A 2GSMB 2V4DA 2EIKB 2UU9O 4GUNA 3L73H 4MSWC 4LWSB 3CXHF 4YIPA 3ZMUA 4K8XA 4HZ3A 4NVPA 1GK9A 5L3BA 4YIOA 3CRRA 3GB7C 3K59A 4JTDB 2P67A 4WFHA 3IFXA 4X1KB 4IYHA 4PA4A 2OTLV 3ZHRA 1Y66A 1N0JA 3STLC 4J9ZB 4DV1O 4JV5B 1L0NH 2CUGA 1K9MW 5LA6B 4QE7A 4R50A 2EIMC 3K5LA 4MTFA 4YJ2A 1CP9A 3CCUV 3L70H 5HFMA 3SYPA 3BVOA 2AZ0A 3BABA 1BHAA 2QSAA 4QGPA 2XT9A 4X66B 4EKWA 2HR3A 3CRAA 4QIWF 5H6QA 2CTRA 2M7WA 1NVPD 2CAZC 2RJZA 1IBMB 3WG7B 5L3DA 4RUEA 4DK0A 1EZVH 3R65A 3KKYA 2BSKA 1LNQA 1MSDA 2WA4A 5L3GA 4U7NA 1NJIW 2YI9A 3FB6C 4C7UA 4EB6A 1XUQA 2HHHB 1XDCA 3ZCCA 2OTJV 4UCTA 2QWPB 1XQ8A 1D2DA 3N2KA 1BSMA 1EBOA 4HNAB 4GKKB 1GM8A 4ABMA 5CA0A 4IHJB 3K08A 2E76B 4UXNA 4LFAO 1HNWB 4B7KA 3AG7A 4LF6O 3CJHB 1BS3A 2WLHA 3QO8A 2DJVA 4P2ZA 4DUYO 2VQEO 3F5WC 1XNRB 4JYCA 1KD1W 5CB4A 2F23A 3ABTA 3JYCA 3F7VC 5LYJB 5H9CA 1N34O 3DXRA 1EFRG 1H2KA 5CA0B 1H2GA 5E1AC 5KA5A 3G67A 2R70A 5KA6A 3CEIA 1PL4A 3JD2A 2UUAO 3LDDA 1NR1A 4KXRA 3H9VA 1M5IA 4J7ZA 2AGAA 2Q73A 4J7KA 3QF7A 4NKGB 2MK3A 2QWQB 5JVDB 5KX5B 3ZHVA 1U97A 1XOUA 5DECA 1K8AW 4UCOA 3WB2A 1Q6UA 3OUFA 3E35A 3VQYA 1DK1A 2XAHA 1HNZO 4IL6Z 2RDCA 4GX5A 2UUBB 5CBFA 3MHSC 1AR1B 1IVSA 3E8HA 4B3MO 4PA3A 1XREA 4BW5A 4FM1A 3JAWA 1JMKC 4AI8A 3RT3C 2PI4A 3D3QA 2XNDG 1V55C 2XASA 2Q0AA 3HB3B 3CX5F 4JASA 4U3JA 3J7AU 5KAIZ 1H8EG 2P7TC 1AJPA 3L72H 4J7JA 1NR7A 3HKDB 4MVMA 4KL1A 2KG7B 4UCRA 3RWRD 4OX9O 5L3CA 4TV8A 1IDSA 3TGUH 2YIBA 3FX7A 2X7RB 5BR8B 4JZ2A 1FXKA 2CGNA 3G4SV 4LF7B 3SPJA 3ZRWB 2ZE8A 5DN6G 3L71H 4UCSA 1ZL8A 1QVGU 3B4SA 1GH6A 2Y48A 3JD1A 3JAWB 5KHIA 3K03A 1M4UA 2JEUA 2ITDC 4B3RB 2JDIG 2WA3A 2DWEC 1OCCB 2VQFO 1ZLZA 1TGOA 4U3JB 1QU7A 2RCVA 3H1KH 3AG3C 3RGBA 4FZ1A 4MS2A 5IWAB 3MDSA 3DSQA 2HVKC 2UXDO 4CS3A 2V1DA 5IY5B 1NZ6A 4FMTA 4O2BA 3ASOC 1Q8IA 4JAUA 3WFVA 2LW1A 3OGCC 1FXKB 5IYZA 1WNSA 4FK5C 4EFEA 4LF5B 3MD0A 4NB5A 3VOUA 4AQYB 3ZHQA 4DV3B 1QCEA 3ASNC 4DRXB 4DUZO 3U10A 4JYAO 1XHXA 3CYOA 2PGGA 2IJHA 4RWUA 1P49A 3JARA 4X1IA 4BIZA 1JPXA 4PI2A 4J41A 1YXBA 2Q0OC 1M56B 3CC2V 3UT5B 1CEZA 1XNQB 5BZBA 1WAZA 3JD3A 4O2BB 1AI6A 3ZMZA 3CC4V 2GHYA 3ABKC 1R3LC 1N32O 5LL6Y 3R66A 4PDLA 1Q3EA 3KCXA 3U0ZA 2PF4E 3SGIA 1SERA 3JARB 2UUCO 2ZNIA 3AEIA 1AP5A 4X1YA 4J80A 3VQWA 1I08A 3BPZA 4JAVA 2JEXA 3ZRXA 1KB9F 1KQSU 3W7SA 1KBHA 1IX9A 1D5NA 1EN6A 4FLXA 1P4RA 3RYIA 3T2MA 3UCSC 1XMQO 4IIJA 4AHCA 1K7DA 1PNLA 5KUKA 2CTWA 2WWWA 1B04A 2IM9A 4FJCC 3OGIB 4CZZA 4B7EA 2M6YA 1NH2B 4DW0A 4A5UB 4QNHB 2EZPA 3RFRA 4DV6B 2Z5UA 2FB5A 4DR2O 3ABUA 3BY6A 1MABG 2UXCO 2AXTZ 1TVKA 3SR2C 1KP3A 4PELA 1ZAUA 1LR1A 1IBLO 4F6EA 5B1NA 5LMUB 5KHHA 3RYIB 2P5OA 1X4TA 4UFZA 3H1IH 2E74B 3IJ4A 2OCCB 1OCZB 4FLUA 4WBNA 4DR1B 2D2CB 2GBOA 4JI1B 1N0NA 2F43G 2OT5A 4LF4O 4O2AB 4NYKA 4DR6O 2CGOA 5KHGA 4GX2A 2PY5A 1QLEC 1P7BA 3F7YC 1SQVH 1YI2V 1JA8A 2XOKG 3K5NA 5JH7A 1TVKB 3AG4B 2NR5A 4MTOA 3N27A 4JI3O 3D3IA 4PA7A 5IYBO 5D5QA 3WB1A 3N2GA 2QKSA 2GV9A 2WLKA 4TOIA 1I94B 5J2UB 3HKEA 3CMAV 2FTKA 2LW7A 1M9NA 4X8AA 5K1XA 3JCUZ 1VQNV 1RM1C 1SRYA 4YXWG 2PZSA 1E1QG 3X2QB 3PJSK 2E3CA 3LUTB 2YEVA 3GWOA 5JJJB 1K4DC 4DV4O 5LMNB 2DMXA 3NR7A 4FM0A 3K58A 4X64O 1HR0O 2QWOB 1US6A 3BEHA 3W7TA 1S72V 1I5YA 3FB8C 1YTFD 1PNKA 4FLYA 5GTHZ 1BZKA 2BOCC 1HNXO 4I5SA 1GO3F 1H2SB 3LDCA 2EIMB 2C2AA 1TA8A 2IBZH 3B40A 3Q4HA 2PTMA 4XDJA 2KQXA 2YIAA 2A3QA 2YEVB 2KB1A 2FKXA 4JI8B 3CHXA 1S77D 5EBLC 1S5JA 1VARA 2IH1C 1K5QA 1NQTA 5KAFZ 1BT8A 5EK0A 3FB7C 3ZX6A 4FPPA 3OUSA 4DR4O 1GN2A 2P06A 5B3SC 5LHGA 1YIJV 2Y0PA 5BXZA 1VQKV 4I0XA 5F2VO 1YJNV 4MVZA 3P3PA 5LP6A 1Z5VA 4GZRB 1LUVA 3ZMVA 1QLNA 3FKSG 1FAFA 4JI5O 3I5DA 1SF9A 2N74A 1OCOC 3K5OA 1S5LZ 4X20B 4NXNO 3JATA 3K06A 2YSUB 4KHPO 1F51A 1WPBA 1B06A 3WU2Z 4G28B 3OR7C 2YXLA 1FJGO 1N8RW 1AILA 3UO3A 4JI0O 1SQPH 5TISZ 3K5MA 1J5EO 2HFEC 1GMGA 2KSDA 2ZM6B 2VWKA 2FMLA 1NBMG 1SA0A 1NI8A 4D7SA 2O57A 1S3JA 1FFTB 2RQ6A 3GVMA 4UCUA 4PDMA 5CMUA 4JI7O 3STZC 2XTAA 4K0KB 4I9QA 5CBGA 3JATB 3CCVV 2OWOA 5EYPB 1OJHA 3BCCH 2AZ2A 4DV2O 1E1RG 1E79G 2ZDIC 5FLXN 4UVAA 1Q5OA 1H8HG 3SYCA 1N34B 3ABMC 3TXSA 3O9OA 4KP4A 4GT1A 3S3WA 3MAQA 2ADQB 1RFYA 2CTPA 4DR3O 2EZOA 3T1HO 3CB2A 2KKWA 4NXMO 4WCEV 4Z2WA 3IC9A 5LOVB 1FYJA 5EBWC 1SA0B 2JS3A 1EN5A 4NR1A 5C8YA 3FYEB 4ASUG 2LJ2A 2R72A 5H5NA 4LBEC 4YY3B 3JD0A 1HNZB 4B3SO 3ZEDA 4O4JA 4FVMA 4BIOA 3I56V 1N33O 1V55B 1THZA 3K57A 1G8MA 1L1FA 5BY1A 3RYCB 2MW2B 3H1LH 1VQ7V 4JI2B 4JYBA 4PV1B 2DYRC 4W4KA 3W7XA 4BR6A 3FD9A 3K3WA 4UCVA 5C8YB 1Y74A 4OX9B 2A79B 2Z0AA 4XBFA 5L3EA 1H2LA 1AJQA 4EEQA 2W0FC 2QM7A 3JAMN 5LGNA 4O4JB 3H1JH 3OM3B 1R3KC 3BA8A 1GN4A 2JRIA 3G80A 4E2LA 3AG3B 4LFBO 4XDKA 1O9GA 3HKCA 2ZIMA 4PI0A 4JF3A 4YJ3A 4DR5O 2JGUA 4DK1A 4B08A 5CBHA 4MTXA 2Y69B 4GX1A 1Y74B 3C3SA 3ASOB 4RQEA 1GM7A 1COWG 4B3TB 4YJ2B 4MVRA 2IW5A 3JSNA 2A0LA 1YJWV 3ASNB 3T1YO 1A32A 2UXNA 4WF9V 2Y4UA 3SJAC 1F7YA 1KUQA 1Q81W 4LFCO 4O4HA 3CRMA 2ODMA 2DYSC 1R73A 4JPRA 3CRQA 3FYIB 4CBCA 2BSKB 3OMAB 3RVZA 2EJRA 2P90A 4X65B 2UXBB 1MMMA 4EB6B 3CCLV 2QKAA 5LP6C 1R3JC 2EJ7A 1YVWA 4CC5A 4CH6A 4LNUA 3RYFA 3N2KB 1I7FA 4RAIA 2DQ0A 1SKVA 3L9DA 5KHKA 4R7CA 1JR9A 2F1MA 5LHIA 4O4HB 2BTQA 1DF5A 4EFBA 4YHHO 1Y76A 1WN7A 2ZR2A 1PPJH 2OYQA 1VQMV 2QGNA 4X62O 4MW8A 4P9PA 1NT2B 4LNUB 3E22A 2AHZA 2FYUH 1G6UA 4OPAA 1FS0G 5CB4B 3AG1C 4CS4A 3UM7A 1AROP 5D5PA 3DXRB 4X89A 4X9QA 5CA3A 1XMQB 3IC7A 1PNMA 2GUZA 3BA9A 1SQGA 1FXHA 4RQFA 2F66C 4UV9A 2ADPA 4FFKA 1SESA 4JI6B 4DR2B 2QJ1A 1JJOA 5E79Z 1PM9A 1Q82W 1YJ9V 3E22B 3G6BA 4JYYA 3OMIB 5IJ9A 1MA1A 4JV5O 4QJFB 1W0KG 3AG2C 1H2NA 4N23A 3LSUA 4DV7O 1U96A 3JAKA 2WSSG 2HEPA 5JQGA 2CDYA 1TUBA 1QLEB 5IYDO 4X66O 4TV8B 4ZKIA 4LF4B 1K33A 3JSLA 1IBMO 1K97A 1L0LH 2DW4A 2F4VB 4FZ0A 3WG7C 5IJ9B 1ZL8B 2WLNA 4H44B 4N21A 2Q5ZA 1PP9H 2YI8A 2HG5C 1I0HA 1X59A 4GKJB 2HHHO 4MVOA 2WLLA 2BE3A 1N36B 3A8TA 3CCMV 1RM1B 4J11A 3E8FA 4Z1MG 3K0DA 1GAXA 2H3OA 1TUBB 4GKKO 5IJ0A 2GTAA 4LF9B 1FFXA 4DV4B 3JALA 4ZI7A 1P7GA 2CH7A 2WAMA 4H13B 1O9HA 3OTFA 2XHBA 1VF7A 5IYZB 3IAYA 3D36A 5BMVA 2BTOA 1HNWO 5IE9A 1DTOA 1PL0A 4I50A 2JIZG 2Q7EA 1VQ4V 4I7ZB 1BL8A 1JCHA 3E8GA 2P4KA 2WLLB 3AK2A 1QQCA 3ETDA 1GKFA 1XNRO 4D6TH 4X88A 4X1IB 3VBBA 1VIBA 1NKDA 4WFFA 3A0BZ 5EC2C 1FFXB 4LF8B 4ZI7B 2DN9A 3E83A 4AILC 5B3SB 1XMOO 1JFFA 5JCOA 3RYHA 4P9OA 2OIGA 1MOFA 1F4MA 2XAGA 4TQDA 2YXHA 3FB5C 4TUYA 4DV5B 4I50B 4FLVA 2LFSA 3A0RA 2ETNA 5LXTA 1OCOB 2UUBO 4TV9A 4BWAA 4X1YB 3H1HH 5EIBC 1NVPB 3BAAA 1Y4MA 3LNNA 1BMFG 3OTOO 2ZDIA 2WLMA 2YICA 4QE9A 5B1OA 2X6BA 1KP2A 4JI4B 3P32A 1JFFB 5DM6V 3SPHA 1WA8A 4JI0B 3F5TA 5KHJA 1WJZA 2JGDA 4TUYB 1XEQA 1SQXH 4BIUA 4IIJB 2B5UA 3JD4A 2JJ1G 5IDJA 2L35A 3ZHSA 1JJ2U 5BR8O 1W0JG 4LF7O 4MT8A 2EILC 4JTAB 1L8DA 1XL6A 3JCZA 1ROPA 3A2FA 3ABMB 3FFQA 1AJNA 4B3RO 3ABLC 3ZHUA 3TK1A 5FPRA 5ITZA 1MSWD 1S0VA 1WA8B 1WPXA 1AI7A 4I9WA 5IWAO 1QR9A 3QTCA 4JZGA 1YZBA 2Z3YA 3DGEA 4MVUA 2JS5A 2W0XA 1NU1H 5IY5C 1IBKB 2IJJA 4IYIA 4WBNB 2EIJC 4KUMA 4LF5O 2UU9B 4AQYO 4DV0O 2VS0A 2IU0A 4DV3O 4PA9A 3OEEG 5J2TA 4DXWA 5JH7B 2DYRB 1R6NA 3CRCA 3A0HZ 4KFMA
chains in the Genus database with same CATH topology
1M5IA 3ZEDA 4F6RB 5IJ0B 4O4JA 3QF7A 4FVMA 4I4TA 3JALB 3N2GB 3K57A 5JVDB 5KX5B 4DV1B 3HKEB 4UCOA 3RYCB 3WB2A 4DR7B 3VQYA 4GYCB 4DR4B 4JI2B 5BMVB 2UUBB 4ZOLA 4UCVA 5FNVA 4FM1A 3JAWA 5EIBD 3CSXA 5C8YB 1JMKC 4OX9B 1V9PA 2ZINA 2Q0AA 4L8JA 4U3JA 5KMGA 4EEQA 4JI5B 2P22C 3HKDB 4KL1A 4HBNA 4O4JB 4UCRA 3RWRD 3ICXA 4NXNB 4I4TB 3BA8A 2JVDA 4TV8A 4KHPB 4O4LA 2YIBA 1HW7A 1Q43A 1O9GA 3HKCA 4LR3A 3RYHB 5BR8B 1FJGB 2ZIMA 4PI0A 1YEWA 4LF7B 4YJ3A 1J5EB 1RSOA 2JGUA 4UCSA 4DK1A 4B08A 4O2AA 5FNVB 3JAWB 5KHIA 4O4IA 3U11A 1KMIZ 3UQ8A 1M4UA 4GLXA 4B3RB 5LXTB 4B3TB 4YJ2B 1TGOA 4TV9B 4U3JB 3RGBA 3JSNA 5JCOC 4PHZA 4JI7B 5IWAB 3DSQA 4LFAB 3SJAC 4CS3A 5LP6B 1D5AA 4DV2B 4O4HA 4LF6B 4O2BA 4O4LB 5J2UA 1Q8IA 4FLWA 5IYZA 5K1PA 1WNSA 4EFEA 4DUYB 2VQEB 4DR3B 4LF5B 3T1HB 4BW9A 4AQYB 4X65B 4NXMB 4DV3B 2UXBB 4DRXB 3BHPA 4EB6B 3U10A 4O4IB 5LP6C 4CC5A 4FLZA 1XHXA 4CH6A 2PYJA 2PGGA 4LNUA 3RYFA 1P49A 3JARA 1I7FA 3N2KB 4YHHB 4X1IA 2UUAB 1SKVA 5KHKA 4PI2A 3SJCC 4B3SB 2EX3A 2ZNJA 2F1MA 1VQ0A 3UT5B 1XNQB 1N33B 4O4HB 2BTQA 4O2BB 4EFBA 5ITZB 2R9AA 1WN7A 4X1KA 4LH6A 3SJBC 2OYQA 4B3MB 5LA6A 1Q3EA 1M93A 1NT2B 4LNUB 3U0ZA 3E22A 3SGIA 1G6UA 3JARB 2ZNIA 4X1YA 3VQWA 5CB4B 3B2EE 4CS4A 5D5PA 3BPZA 5CA1A 5J2TB 1XMQB 5FPOA 2ZCEA 4LFBB 3BA9A 1SQGA 4ZHQA 3HKBA 1VZYA 2F93B 4FFBA 1TAEA 2F66C 4X20A 4DR5B 4FLXA 3RYIA 3M7MX 4IIJA 4AHCA 4JI6B 4DR2B 2QJ1A 1JJOA 1B04A 2IM9A 3E22B 5EZYA 2VQFB 4DV7B 4ZOLB 5IJ9A 4CH4A 3RFRA 4DV6B 3T1YB 4HNAA 2PYLA 5CA1B 2UXDB 2ZIOA 4LFCB 4IHJA 1TVKA 3SR2C 5KMGB 3JAKA 1ZAUA 4ZHQB 2HEPA 3HKBB 3PN1A 3JASA 5JQGA 1TUBA 5LMUB 4FFBB 5KHHA 2VWJA 3RYIB 5EYPA 1T5EA 4TV8B 2P5OA 1X4TA 4LF4B 4UFZA 4CS2A 4D7TA 3JSLA 4DUZB 4JYAB 3HKCB 1XI1A 4FLUA 2F95B 4WBNA 4DR1B 5EZYB 2F4VB 4YJ3B 5IJ9B 4JI1B 4O2AB 5LOVA 2YIBD 2YI8A 5KHGA 5LYJA 3VQVA 2PY5A 4GKJB 3QG5A 3K5NA 1N36B 4TQFA 5JH7A 1TVKB 3JASB 1TUBB 3BRCA 5IJ0A 4LF9B 1FFXA 1Z5WA 5D5QA 1SQFA 4DV4B 3JALA 3N2GA 3WB1A 4ZI7A 5JVDA 5KX5A 4TOIA 2GV9A 1I94B 1N32B 5J2UB 2Q7GA 3HKEA 4X62B 1O9HA 3RYCA 3OTFA 4ZIBA 2XHBA 1VF7A 5IYZB 5K1XA 3IAYA 1KU9A 2PZSA 5BMVA 2UUCB 2BTOA 2E3CA 5JJJB 5LMNB 1QHTA 4I50A 4FM0A 2Q7EA 3K58A 1DGSA 2V4DA 1QQCA 3RYFB 4CH3A 5JJEB 1XMOB 4X1IB 4FLTA 4FM2A 3HKDA 3ETQA 4FLYA 1FFXB 4K8XA 4NVPA 5JJNB 1H2SB 4LF8B 4ZI7B 1TA8A 2BTQB 4AILC 3K59A 4CC6A 1JFFA 4X1KB 5JCOA 2PTMA 3RYHA 4TQDA 2YIAA 4JI8B 3CHXA 4TUYA 4DV5B 1S5JA 4JV5B 3OTOB 4I50B 4FLVA 5LA6B 5LXTA 3K5LA 2UXCB 5GONA 4YJ2A 4TV9A 4BWAA 4X1YB 5EIBC 3BAAA 3LNNA 1IBLB 2Q7HA 5LP6A 1Z5VA 3BABA 4I55A 4X66B 4JI4B 4Q6GA 2CAZC 1JFFB 2RJZA 1IBMB 4DK0A 4JI0B 3K5OA 3ZS8C 4X20B 5KHJA 3JATA 4TUYB 4IIJB 4DRXA 1WPBA 2YI9A 4EB6A 3THOA 4DR6B 4K8ZA 2YXLA 2HHHB 4UCTA 5GONB 1XQ8A 3K5MA 3N2KA 4LH7A 2ZM6B 2VWKA 3WB0A 1L8DA 4JI3B 2PUSA 4HNAB 3A2FA 4GKKB 1SA0A 4I55B 3FFQA 3UT5A 5CA0A 4D7SA 5FPRA 4IHJB 3VQXA 5ITZA 3JAKB 2RQ6A 4UCUA 5JQGB 3QTCA 4K0KB 4I9QA 4F6RA 3JATB 2OWOA 1HNWB 5EYPB 2JS5A 4DV0B 1Q5OA 1N34B 1IBKB 4X64B 4WBNB 2QM4A 1HR0B 3MAQA 1XNRB 2UU9B 3CB2A 2KKWA 5CB4A 5LOVB 1XHZA 5LYJB 1SA0B 5C8YA 5CA0B 5J2TA 1HNXB 2R72A 2R70A 5JH7B 2E5LB 4CH5A 4YY3B 1HNZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M7M X;  1VZY A;  1VQ0 A;  1HW7 A;  1I7F A; 
#chains in the Genus database with same CATH topology
 1MZE A;  2ITC C;  2DQ3 A;  3T4Z A;  3QNE A;  3N2G B;  4RUF A;  4DV1 B;  2E5L O;  1RPO A;  3HKE B;  1RP3 B;  4GYC B;  2HLD G;  2W6I G;  3GWK C;  4ZOL A;  1VF5 B;  4H33 A;  4FIP C;  1PKX A;  4JTC B;  1K73 W;  5EIB D;  1ZX3 A;  4DR7 O;  1V9P A;  3E89 A;  4J9Y B;  2ZIN A;  2Q6A A;  1VQ9 V;  1SZX A;  4L8J A;  1OCR C;  2JK5 C;  5KMG A;  1KKD A;  1HWY A;  1AR4 A;  2P22 C;  3D36 C;  3ICX A;  1VEW A;  2JVD A;  2WLJ A;  5B1A C;  3DC6 A;  1QR8 A;  3CPW U;  4O4L A;  1HW7 A;  1Q43 A;  1YHQ V;  3Q4H B;  1VF6 C;  3J80 N;  3CWB H;  3ZHT A;  4MVS A;  4Q20 A;  2Q68 A;  1RSO A;  4NTY A;  5L3F A;  4WFA V;  3RVY A;  1KMI Z;  3UQ8 A;  3OMN B;  1S76 D;  4RO2 A;  2CK3 G;  3ZRV A;  4PA6 A;  5JCO C;  2ZE5 A;  4I0X B;  4PHZ A;  4DV6 O;  1FD9 A;  4LFA B;  5GTI Z;  5LP6 B;  5B1B C;  1D5A A;  3OAA G;  1VQ5 V;  4O4L B;  4LF6 B;  1AB3 A;  1NS1 A;  1K3E A;  4FLW A;  5K1P A;  5LMU O;  4DUY B;  2VQE B;  3KZI Z;  3W7W A;  3SPI A;  1Y67 A;  1SC5 B;  2X6C A;  3ZN1 A;  1F4N A;  3BHP A;  2PYJ A;  4DR1 O;  2Q4P A;  1M90 W;  2OCC C;  4YHH B;  1Q6H A;  3AK1 A;  2UUA B;  2UXX A;  3SYA A;  4LWS A;  2B1G A;  1VQ0 A;  1Q86 W;  2L6L A;  2ZE7 A;  1KC8 W;  4OXS A;  4X1K A;  2LGW A;  3AG1 B;  3SJB C;  1ENV A;  2LGQ A;  3OR6 C;  3CCQ V;  5EBM C;  1I94 O;  2EUL A;  4B3M B;  2FL4 A;  5LA6 A;  1MG1 A;  1Q6I A;  1AP6 A;  1OV9 A;  2ZR3 A;  4WFE A;  2ZKO A;  1XBL A;  5LMN O;  1YSC A;  4L87 A;  3TXQ A;  3X2Q C;  4MW3 A;  2W6J G;  5CA1 A;  1S5H C;  3QO7 A;  2HVJ C;  1ZUQ A;  3B77 A;  2NLJ C;  4DO2 A;  2ZD9 A;  3HKB A;  4FFB A;  3RN4 A;  3AG2 B;  3T4D A;  4WFG A;  2NNU A;  4QPK A;  2Y0I A;  4JGS A;  5EZY A;  3SPC A;  2VQF B;  4DV7 B;  4JI8 O;  4IT5 A;  2QWN B;  1QVF U;  4HNA A;  2PYL A;  1N4C A;  5J9P C;  5CA1 B;  1SZT A;  2UXD B;  3LSQ A;  4MVQ A;  3OT7 A;  1V54 C;  4IHJ A;  1NH2 D;  1F23 A;  4R8C A;  3HKB B;  3JAS A;  3PN1 A;  2GTS A;  2WLI A;  2LP7 A;  4FFB B;  3APO A;  2VWJ A;  1ORQ C;  1IZ3 A;  2YUA A;  2DOS A;  4CS2 A;  4R6Z A;  3CJH A;  4D7T A;  5A9G A;  1SS3 A;  2QWR B;  4DUZ B;  2VRZ A;  4JYA B;  3HKC B;  1UPG A;  1BCC H;  1EM1 A;  5EZY B;  1EZJ A;  4YJ3 B;  3G6E V;  1XIL A;  5LYJ A;  1GN3 A;  3QG5 A;  5EC1 C;  3ABK B;  1GRJ A;  1ZSP A;  2ZM6 O;  1Z2G A;  2YS8 A;  5B66 Z;  1K34 A;  4OGQ B;  3NXS A;  3JAS B;  2WLI B;  4J10 A;  4PDR A;  2B9Z A;  3HR0 A;  5JVD A;  2HJF C;  5KX5 A;  1N32 B;  1EN4 A;  3ZJZ A;  2E75 B;  2QE7 G;  4NTW A;  4K0K O;  2NN4 A;  2BOB C;  4UV8 A;  2UUC B;  3FAV A;  2Q9L A;  1G1X B;  1M57 C;  1IXM A;  1FPO A;  1YTF B;  2ARH A;  1DGS A;  5LHH A;  2ZXW C;  1VQO V;  2A7W A;  3KCY A;  3KG2 A;  3RYF B;  1R3I C;  4CH3 A;  3C90 A;  5JJE B;  1XMO B;  4FLT A;  2YXY A;  4FM2 A;  2EIN C;  3HKD A;  2RNB A;  4K3A A;  3ETQ A;  2KG7 A;  3OW2 U;  1OZ0 A;  2OCH A;  5JJN B;  3S3X A;  1K5S A;  2BTQ B;  1GN6 A;  3UO2 A;  1Y76 B;  4U7O A;  4CC6 A;  1BQ0 A;  1R6K A;  4YY3 O;  4TWK A;  1URF A;  2EIK C;  3ZRW A;  3CE2 A;  3FAV B;  4Z1V A;  3B8N A;  3SDL A;  1AR5 A;  3OTO B;  2R9R B;  1WP8 A;  5H2F Z;  2EBO A;  2UXC B;  5GON A;  1WB8 A;  1FKA O;  4JI2 O;  4F4L A;  1OHH G;  1Y6X A;  2LQT A;  1DF4 A;  2X6A A;  1VQ6 V;  2AHY A;  3RBZ A;  1IBL B;  1VMG A;  5HFL A;  2Q7H A;  2IJI A;  4I55 A;  2JJ2 G;  4W4L A;  4Q6G A;  2N04 A;  5LGT A;  2GUZ B;  1ZTE A;  2EIL B;  3ZS8 C;  2P6J A;  2H8P C;  4JAA A;  4LP8 A;  5KLV H;  1GM9 A;  1HP8 A;  1B6Q A;  3ABL B;  4DRX A;  1KKC A;  4DR6 B;  3THO A;  3K9S A;  4K8Z A;  3M99 B;  3E2E A;  2YID A;  5GON B;  2YC0 A;  3EHB B;  3UKM A;  4LH7 A;  1KYO F;  1UFI A;  1VQL V;  3CCJ V;  3WB0 A;  4JI3 B;  2PUS A;  3ZBH A;  1AI4 A;  4I55 B;  3UT5 A;  4PD4 F;  4B3T O;  4ZBM A;  2LFR A;  2EIJ B;  3ETG A;  3J81 N;  1W2B U;  3VQX A;  2Y69 C;  1XL4 A;  5CN0 A;  3JAK B;  1M1K W;  3ZMT A;  1BQZ A;  5JQG B;  4F6R A;  2D3O W;  4HYO A;  4DV0 B;  3DTU B;  1J95 A;  2ILM A;  2IH3 C;  2OIE A;  1HDJ A;  5LBQ A;  4X64 B;  2QA4 V;  2QM4 A;  1HR0 B;  4LCU C;  2XAQ A;  1RPR A;  4X65 O;  3K04 A;  2UXB O;  3K79 A;  1XHZ A;  1R6T A;  5GW7 A;  2DWD C;  2LO1 A;  1VF6 A;  3M8A A;  1HNX B;  3AK3 A;  2E5L B;  4CH5 A;  3G71 V;  1VQ8 V;  2XAF A;  1IXB A;  4F6R B;  1CXZ B;  5IJ0 B;  3E86 A;  1SQB H;  3JAL B;  4I4T A;  4TSF G;  3ZIA G;  2CH7 B;  1OCR B;  4DR7 B;  2ZE6 A;  2HJD A;  3CXC U;  3L75 H;  4DR4 B;  1G4Y B;  2HKO A;  5BMV B;  1P84 F;  3CME V;  1Q7Y W;  5FNV A;  5B1A B;  5H6R A;  2YDE A;  1TUE B;  2QDO A;  3CSX A;  2G38 A;  1NTK H;  2CTQ A;  5KUM A;  4DYL A;  5JWP A;  2QM8 A;  4JI5 B;  2Q67 A;  1AI5 A;  1Q90 D;  1VP7 A;  2A06 H;  4IGG A;  3APQ A;  4HBN A;  2QTS A;  5IYC O;  4NXN B;  4I4T B;  4PJ0 Z;  3OFN G;  2QTO A;  4KHP B;  3LDE A;  3SYQ A;  4U3F H;  4J42 A;  3SPG A;  3O65 A;  4P30 A;  2IJK A;  4LR3 A;  3RYH B;  3CC7 V;  1FJG B;  3SYO A;  1YEW A;  3I55 V;  2GDS A;  1J5E B;  1CPY A;  4XDL A;  4O2A A;  4H0L B;  5FNV B;  5B1B B;  4JI6 O;  3QVN A;  4TT3 G;  1QNM A;  4O4I A;  1PD3 A;  3U11 A;  1SQQ H;  1ZWI C;  4GLX A;  3OD4 A;  4GCZ A;  3D8C A;  5LXT B;  2RN9 A;  1R1B A;  2XUM A;  1NTM H;  4TV9 B;  4GX0 A;  3L74 H;  3TET A;  1SET A;  2DE0 X;  3ML0 A;  2Q8V A;  1PV0 A;  4JI7 B;  2PI5 A;  2BCC H;  1KEC A;  4DW1 A;  4DV2 B;  5J2U A;  3OEH G;  1WB7 A;  3LNM B;  3CD6 V;  2RMK B;  4BAY A;  2QR4 A;  1YCI A;  1OCC C;  4ICG A;  2N05 A;  4DR3 B;  2JGD B;  3T1H B;  4OPH A;  4BW9 A;  4NXM B;  1JVM A;  2ATK C;  1BGY H;  4O4I B;  2K1E A;  4FLZ A;  1DLB A;  2F4V O;  3IGA C;  2P4V A;  3EVK A;  4HAM A;  5FL7 G;  1FXK C;  1BE3 H;  3SJC C;  1YDX A;  1WLE A;  4B3S B;  4GKJ O;  2EX3 A;  2ZNJ A;  3HPL C;  2B1I A;  5DED A;  3RW0 A;  3LSS A;  3K9A A;  1N36 O;  1N33 B;  3SJQ C;  4K35 A;  4PDV A;  3TJT A;  5ITZ B;  2R9A A;  2H94 A;  2K9P A;  2XAJ A;  4LH6 A;  4LF9 O;  1AVM A;  1XNQ O;  1QBZ A;  2Q69 A;  1M56 C;  1M93 A;  4E4E A;  3CS5 A;  4UUJ C;  4MTG A;  2X0L A;  1K4C C;  2Y4T A;  3B2E E;  3QO5 A;  1YIT V;  3P3N A;  1MZF A;  3OE7 G;  5J2T B;  3ZRS A;  5FPO A;  2ZCE A;  1BHB A;  3CCS V;  4LFB B;  1H2M A;  4ZHQ A;  3EXA A;  1VZY A;  2F93 B;  2IU3 A;  3W7U A;  3CCR V;  3BFR A;  1TAE A;  4X20 A;  1FXV A;  1GTO A;  4QPJ A;  4DR5 B;  1H38 A;  4LF8 O;  3M7M X;  4G27 B;  1V54 B;  1W59 A;  2HP8 A;  1MNG A;  4H37 A;  2WPD G;  3ETE A;  3E8B A;  3T1C A;  4ZOL B;  4UVB A;  4DV5 O;  1K92 A;  1NTZ H;  4CH4 A;  4G2K A;  3T1Y B;  1JQ0 A;  2DYS B;  1I5X A;  2R9I A;  2ZIO A;  1B3Q A;  4LFC B;  1YF2 A;  5KMG B;  4ZHQ B;  3CP1 A;  1UJW B;  1IUR A;  5AG2 A;  2CE4 A;  5EYP A;  2ZQM A;  1T5E A;  3H01 A;  4JI4 O;  3CCE V;  4UVC A;  1XI1 A;  3ZMS A;  2F95 B;  3C3T A;  3P30 A;  5C93 A;  1RSO B;  3MHH C;  5LOV A;  2YIB D;  4LC1 A;  3VQV A;  2V7Q G;  1LUW A;  4UB8 Z;  4TQF A;  1JX9 A;  3K0G A;  4JI1 O;  3ZN0 A;  1OCZ C;  3EFF K;  5B5E Z;  1M57 B;  3BRC A;  1VQP V;  4NTX A;  2QKC A;  1Z5W A;  2ZXW B;  1SQF A;  2A9H A;  2AW9 A;  4WFB V;  2Q7G A;  4X62 B;  3RYC A;  4UB6 Z;  5LGU A;  4ZIB A;  1WP7 A;  2EIN B;  3TCU A;  3B09 A;  1KU9 A;  3AG4 C;  2ZT9 B;  5A2Q N;  3B8M A;  2QEX V;  1QHT A;  5IT9 N;  1JOY A;  1IBK O;  3DC5 A;  2GSM B;  2V4D A;  2EIK B;  2UU9 O;  4GUN A;  3L73 H;  4MSW C;  4LWS B;  3CXH F;  4YIP A;  3ZMU A;  4K8X A;  4HZ3 A;  4NVP A;  1GK9 A;  5L3B A;  4YIO A;  3CRR A;  3GB7 C;  3K59 A;  4JTD B;  2P67 A;  4WFH A;  3IFX A;  4X1K B;  4IYH A;  4PA4 A;  2OTL V;  3ZHR A;  1Y66 A;  1N0J A;  3STL C;  4J9Z B;  4DV1 O;  4JV5 B;  1L0N H;  2CUG A;  1K9M W;  5LA6 B;  4QE7 A;  4R50 A;  2EIM C;  3K5L A;  4MTF A;  4YJ2 A;  1CP9 A;  3CCU V;  3L70 H;  5HFM A;  3SYP A;  3BVO A;  2AZ0 A;  3BAB A;  1BHA A;  2QSA A;  4QGP A;  2XT9 A;  4X66 B;  4EKW A;  2HR3 A;  3CRA A;  4QIW F;  5H6Q A;  2CTR A;  2M7W A;  1NVP D;  2CAZ C;  2RJZ A;  1IBM B;  3WG7 B;  5L3D A;  4RUE A;  4DK0 A;  1EZV H;  3R65 A;  3KKY A;  2BSK A;  1LNQ A;  1MSD A;  2WA4 A;  5L3G A;  4U7N A;  1NJI W;  2YI9 A;  3FB6 C;  4C7U A;  4EB6 A;  1XUQ A;  2HHH B;  1XDC A;  3ZCC A;  2OTJ V;  4UCT A;  2QWP B;  1XQ8 A;  1D2D A;  3N2K A;  1BSM A;  1EBO A;  4HNA B;  4GKK B;  1GM8 A;  4ABM A;  5CA0 A;  4IHJ B;  3K08 A;  2E76 B;  4UXN A;  4LFA O;  1HNW B;  4B7K A;  3AG7 A;  4LF6 O;  3CJH B;  1BS3 A;  2WLH A;  3QO8 A;  2DJV A;  4P2Z A;  4DUY O;  2VQE O;  3F5W C;  1XNR B;  4JYC A;  1KD1 W;  5CB4 A;  2F23 A;  3ABT A;  3JYC A;  3F7V C;  5LYJ B;  5H9C A;  1N34 O;  3DXR A;  1EFR G;  1H2K A;  5CA0 B;  1H2G A;  5E1A C;  5KA5 A;  3G67 A;  2R70 A;  5KA6 A;  3CEI A;  1PL4 A;  3JD2 A;  2UUA O;  3LDD A;  1NR1 A;  4KXR A;  3H9V A;  1M5I A;  4J7Z A;  2AGA A;  2Q73 A;  4J7K A;  3QF7 A;  4NKG B;  2MK3 A;  2QWQ B;  5JVD B;  5KX5 B;  3ZHV A;  1U97 A;  1XOU A;  5DEC A;  1K8A W;  4UCO A;  3WB2 A;  1Q6U A;  3OUF A;  3E35 A;  3VQY A;  1DK1 A;  2XAH A;  1HNZ O;  4IL6 Z;  2RDC A;  4GX5 A;  2UUB B;  5CBF A;  3MHS C;  1AR1 B;  1IVS A;  3E8H A;  4B3M O;  4PA3 A;  1XRE A;  4BW5 A;  4FM1 A;  3JAW A;  1JMK C;  4AI8 A;  3RT3 C;  2PI4 A;  3D3Q A;  2XND G;  1V55 C;  2XAS A;  2Q0A A;  3HB3 B;  3CX5 F;  4JAS A;  4U3J A;  3J7A U;  5KAI Z;  1H8E G;  2P7T C;  1AJP A;  3L72 H;  4J7J A;  1NR7 A;  3HKD B;  4MVM A;  4KL1 A;  2KG7 B;  4UCR A;  3RWR D;  4OX9 O;  5L3C A;  4TV8 A;  1IDS A;  3TGU H;  2YIB A;  3FX7 A;  2X7R B;  5BR8 B;  4JZ2 A;  1FXK A;  2CGN A;  3G4S V;  4LF7 B;  3SPJ A;  3ZRW B;  2ZE8 A;  5DN6 G;  3L71 H;  4UCS A;  1ZL8 A;  1QVG U;  3B4S A;  1GH6 A;  2Y48 A;  3JD1 A;  3JAW B;  5KHI A;  3K03 A;  1M4U A;  2JEU A;  2ITD C;  4B3R B;  2JDI G;  2WA3 A;  2DWE C;  1OCC B;  2VQF O;  1ZLZ A;  1TGO A;  4U3J B;  1QU7 A;  2RCV A;  3H1K H;  3AG3 C;  3RGB A;  4FZ1 A;  4MS2 A;  5IWA B;  3MDS A;  3DSQ A;  2HVK C;  2UXD O;  4CS3 A;  2V1D A;  5IY5 B;  1NZ6 A;  4FMT A;  4O2B A;  3ASO C;  1Q8I A;  4JAU A;  3WFV A;  2LW1 A;  3OGC C;  1FXK B;  5IYZ A;  1WNS A;  4FK5 C;  4EFE A;  4LF5 B;  3MD0 A;  4NB5 A;  3VOU A;  4AQY B;  3ZHQ A;  4DV3 B;  1QCE A;  3ASN C;  4DRX B;  4DUZ O;  3U10 A;  4JYA O;  1XHX A;  3CYO A;  2PGG A;  2IJH A;  4RWU A;  1P49 A;  3JAR A;  4X1I A;  4BIZ A;  1JPX A;  4PI2 A;  4J41 A;  1YXB A;  2Q0O C;  1M56 B;  3CC2 V;  3UT5 B;  1CEZ A;  1XNQ B;  5BZB A;  1WAZ A;  3JD3 A;  4O2B B;  1AI6 A;  3ZMZ A;  3CC4 V;  2GHY A;  3ABK C;  1R3L C;  1N32 O;  5LL6 Y;  3R66 A;  4PDL A;  1Q3E A;  3KCX A;  3U0Z A;  2PF4 E;  3SGI A;  1SER A;  3JAR B;  2UUC O;  2ZNI A;  3AEI A;  1AP5 A;  4X1Y A;  4J80 A;  3VQW A;  1I08 A;  3BPZ A;  4JAV A;  2JEX A;  3ZRX A;  1KB9 F;  1KQS U;  3W7S A;  1KBH A;  1IX9 A;  1D5N A;  1EN6 A;  4FLX A;  1P4R A;  3RYI A;  3T2M A;  3UCS C;  1XMQ O;  4IIJ A;  4AHC A;  1K7D A;  1PNL A;  5KUK A;  2CTW A;  2WWW A;  1B04 A;  2IM9 A;  4FJC C;  3OGI B;  4CZZ A;  4B7E A;  2M6Y A;  1NH2 B;  4DW0 A;  4A5U B;  4QNH B;  2EZP A;  3RFR A;  4DV6 B;  2Z5U A;  2FB5 A;  4DR2 O;  3ABU A;  3BY6 A;  1MAB G;  2UXC O;  2AXT Z;  1TVK A;  3SR2 C;  1KP3 A;  4PEL A;  1ZAU A;  1LR1 A;  1IBL O;  4F6E A;  5B1N A;  5LMU B;  5KHH A;  3RYI B;  2P5O A;  1X4T A;  4UFZ A;  3H1I H;  2E74 B;  3IJ4 A;  2OCC B;  1OCZ B;  4FLU A;  4WBN A;  4DR1 B;  2D2C B;  2GBO A;  4JI1 B;  1N0N A;  2F43 G;  2OT5 A;  4LF4 O;  4O2A B;  4NYK A;  4DR6 O;  2CGO A;  5KHG A;  4GX2 A;  2PY5 A;  1QLE C;  1P7B A;  3F7Y C;  1SQV H;  1YI2 V;  1JA8 A;  2XOK G;  3K5N A;  5JH7 A;  1TVK B;  3AG4 B;  2NR5 A;  4MTO A;  3N27 A;  4JI3 O;  3D3I A;  4PA7 A;  5IYB O;  5D5Q A;  3WB1 A;  3N2G A;  2QKS A;  2GV9 A;  2WLK A;  4TOI A;  1I94 B;  5J2U B;  3HKE A;  3CMA V;  2FTK A;  2LW7 A;  1M9N A;  4X8A A;  5K1X A;  3JCU Z;  1VQN V;  1RM1 C;  1SRY A;  4YXW G;  2PZS A;  1E1Q G;  3X2Q B;  3PJS K;  2E3C A;  3LUT B;  2YEV A;  3GWO A;  5JJJ B;  1K4D C;  4DV4 O;  5LMN B;  2DMX A;  3NR7 A;  4FM0 A;  3K58 A;  4X64 O;  1HR0 O;  2QWO B;  1US6 A;  3BEH A;  3W7T A;  1S72 V;  1I5Y A;  3FB8 C;  1YTF D;  1PNK A;  4FLY A;  5GTH Z;  1BZK A;  2BOC C;  1HNX O;  4I5S A;  1GO3 F;  1H2S B;  3LDC A;  2EIM B;  2C2A A;  1TA8 A;  2IBZ H;  3B40 A;  3Q4H A;  2PTM A;  4XDJ A;  2KQX A;  2YIA A;  2A3Q A;  2YEV B;  2KB1 A;  2FKX A;  4JI8 B;  3CHX A;  1S77 D;  5EBL C;  1S5J A;  1VAR A;  2IH1 C;  1K5Q A;  1NQT A;  5KAF Z;  1BT8 A;  5EK0 A;  3FB7 C;  3ZX6 A;  4FPP A;  3OUS A;  4DR4 O;  1GN2 A;  2P06 A;  5B3S C;  5LHG A;  1YIJ V;  2Y0P A;  5BXZ A;  1VQK V;  4I0X A;  5F2V O;  1YJN V;  4MVZ A;  3P3P A;  5LP6 A;  1Z5V A;  4GZR B;  1LUV A;  3ZMV A;  1QLN A;  3FKS G;  1FAF A;  4JI5 O;  3I5D A;  1SF9 A;  2N74 A;  1OCO C;  3K5O A;  1S5L Z;  4X20 B;  4NXN O;  3JAT A;  3K06 A;  2YSU B;  4KHP O;  1F51 A;  1WPB A;  1B06 A;  3WU2 Z;  4G28 B;  3OR7 C;  2YXL A;  1FJG O;  1N8R W;  1AIL A;  3UO3 A;  4JI0 O;  1SQP H;  5TIS Z;  3K5M A;  1J5E O;  2HFE C;  1GMG A;  2KSD A;  2ZM6 B;  2VWK A;  2FML A;  1NBM G;  1SA0 A;  1NI8 A;  4D7S A;  2O57 A;  1S3J A;  1FFT B;  2RQ6 A;  3GVM A;  4UCU A;  4PDM A;  5CMU A;  4JI7 O;  3STZ C;  2XTA A;  4K0K B;  4I9Q A;  5CBG A;  3JAT B;  3CCV V;  2OWO A;  5EYP B;  1OJH A;  3BCC H;  2AZ2 A;  4DV2 O;  1E1R G;  1E79 G;  2ZDI C;  5FLX N;  4UVA A;  1Q5O A;  1H8H G;  3SYC A;  1N34 B;  3ABM C;  3TXS A;  3O9O A;  4KP4 A;  4GT1 A;  3S3W A;  3MAQ A;  2ADQ B;  1RFY A;  2CTP A;  4DR3 O;  2EZO A;  3T1H O;  3CB2 A;  2KKW A;  4NXM O;  4WCE V;  4Z2W A;  3IC9 A;  5LOV B;  1FYJ A;  5EBW C;  1SA0 B;  2JS3 A;  1EN5 A;  4NR1 A;  5C8Y A;  3FYE B;  4ASU G;  2LJ2 A;  2R72 A;  5H5N A;  4LBE C;  4YY3 B;  3JD0 A;  1HNZ B;  4B3S O;  3ZED A;  4O4J A;  4FVM A;  4BIO A;  3I56 V;  1N33 O;  1V55 B;  1THZ A;  3K57 A;  1G8M A;  1L1F A;  5BY1 A;  3RYC B;  2MW2 B;  3H1L H;  1VQ7 V;  4JI2 B;  4JYB A;  4PV1 B;  2DYR C;  4W4K A;  3W7X A;  4BR6 A;  3FD9 A;  3K3W A;  4UCV A;  5C8Y B;  1Y74 A;  4OX9 B;  2A79 B;  2Z0A A;  4XBF A;  5L3E A;  1H2L A;  1AJQ A;  4EEQ A;  2W0F C;  2QM7 A;  3JAM N;  5LGN A;  4O4J B;  3H1J H;  3OM3 B;  1R3K C;  3BA8 A;  1GN4 A;  2JRI A;  3G80 A;  4E2L A;  3AG3 B;  4LFB O;  4XDK A;  1O9G A;  3HKC A;  2ZIM A;  4PI0 A;  4JF3 A;  4YJ3 A;  4DR5 O;  2JGU A;  4DK1 A;  4B08 A;  5CBH A;  4MTX A;  2Y69 B;  4GX1 A;  1Y74 B;  3C3S A;  3ASO B;  4RQE A;  1GM7 A;  1COW G;  4B3T B;  4YJ2 B;  4MVR A;  2IW5 A;  3JSN A;  2A0L A;  1YJW V;  3ASN B;  3T1Y O;  1A32 A;  2UXN A;  4WF9 V;  2Y4U A;  3SJA C;  1F7Y A;  1KUQ A;  1Q81 W;  4LFC O;  4O4H A;  3CRM A;  2ODM A;  2DYS C;  1R73 A;  4JPR A;  3CRQ A;  3FYI B;  4CBC A;  2BSK B;  3OMA B;  3RVZ A;  2EJR A;  2P90 A;  4X65 B;  2UXB B;  1MMM A;  4EB6 B;  3CCL V;  2QKA A;  5LP6 C;  1R3J C;  2EJ7 A;  1YVW A;  4CC5 A;  4CH6 A;  4LNU A;  3RYF A;  3N2K B;  1I7F A;  4RAI A;  2DQ0 A;  1SKV A;  3L9D A;  5KHK A;  4R7C A;  1JR9 A;  2F1M A;  5LHI A;  4O4H B;  2BTQ A;  1DF5 A;  4EFB A;  4YHH O;  1Y76 A;  1WN7 A;  2ZR2 A;  1PPJ H;  2OYQ A;  1VQM V;  2QGN A;  4X62 O;  4MW8 A;  4P9P A;  1NT2 B;  4LNU B;  3E22 A;  2AHZ A;  2FYU H;  1G6U A;  4OPA A;  1FS0 G;  5CB4 B;  3AG1 C;  4CS4 A;  3UM7 A;  1ARO P;  5D5P A;  3DXR B;  4X89 A;  4X9Q A;  5CA3 A;  1XMQ B;  3IC7 A;  1PNM A;  2GUZ A;  3BA9 A;  1SQG A;  1FXH A;  4RQF A;  2F66 C;  4UV9 A;  2ADP A;  4FFK A;  1SES A;  4JI6 B;  4DR2 B;  2QJ1 A;  1JJO A;  5E79 Z;  1PM9 A;  1Q82 W;  1YJ9 V;  3E22 B;  3G6B A;  4JYY A;  3OMI B;  5IJ9 A;  1MA1 A;  4JV5 O;  4QJF B;  1W0K G;  3AG2 C;  1H2N A;  4N23 A;  3LSU A;  4DV7 O;  1U96 A;  3JAK A;  2WSS G;  2HEP A;  5JQG A;  2CDY A;  1TUB A;  1QLE B;  5IYD O;  4X66 O;  4TV8 B;  4ZKI A;  4LF4 B;  1K33 A;  3JSL A;  1IBM O;  1K97 A;  1L0L H;  2DW4 A;  2F4V B;  4FZ0 A;  3WG7 C;  5IJ9 B;  1ZL8 B;  2WLN A;  4H44 B;  4N21 A;  2Q5Z A;  1PP9 H;  2YI8 A;  2HG5 C;  1I0H A;  1X59 A;  4GKJ B;  2HHH O;  4MVO A;  2WLL A;  2BE3 A;  1N36 B;  3A8T A;  3CCM V;  1RM1 B;  4J11 A;  3E8F A;  4Z1M G;  3K0D A;  1GAX A;  2H3O A;  1TUB B;  4GKK O;  5IJ0 A;  2GTA A;  4LF9 B;  1FFX A;  4DV4 B;  3JAL A;  4ZI7 A;  1P7G A;  2CH7 A;  2WAM A;  4H13 B;  1O9H A;  3OTF A;  2XHB A;  1VF7 A;  5IYZ B;  3IAY A;  3D36 A;  5BMV A;  2BTO A;  1HNW O;  5IE9 A;  1DTO A;  1PL0 A;  4I50 A;  2JIZ G;  2Q7E A;  1VQ4 V;  4I7Z B;  1BL8 A;  1JCH A;  3E8G A;  2P4K A;  2WLL B;  3AK2 A;  1QQC A;  3ETD A;  1GKF A;  1XNR O;  4D6T H;  4X88 A;  4X1I B;  3VBB A;  1VIB A;  1NKD A;  4WFF A;  3A0B Z;  5EC2 C;  1FFX B;  4LF8 B;  4ZI7 B;  2DN9 A;  3E83 A;  4AIL C;  5B3S B;  1XMO O;  1JFF A;  5JCO A;  3RYH A;  4P9O A;  2OIG A;  1MOF A;  1F4M A;  2XAG A;  4TQD A;  2YXH A;  3FB5 C;  4TUY A;  4DV5 B;  4I50 B;  4FLV A;  2LFS A;  3A0R A;  2ETN A;  5LXT A;  1OCO B;  2UUB O;  4TV9 A;  4BWA A;  4X1Y B;  3H1H H;  5EIB C;  1NVP B;  3BAA A;  1Y4M A;  3LNN A;  1BMF G;  3OTO O;  2ZDI A;  2WLM A;  2YIC A;  4QE9 A;  5B1O A;  2X6B A;  1KP2 A;  4JI4 B;  3P32 A;  1JFF B;  5DM6 V;  3SPH A;  1WA8 A;  4JI0 B;  3F5T A;  5KHJ A;  1WJZ A;  2JGD A;  4TUY B;  1XEQ A;  1SQX H;  4BIU A;  4IIJ B;  2B5U A;  3JD4 A;  2JJ1 G;  5IDJ A;  2L35 A;  3ZHS A;  1JJ2 U;  5BR8 O;  1W0J G;  4LF7 O;  4MT8 A;  2EIL C;  4JTA B;  1L8D A;  1XL6 A;  3JCZ A;  1ROP A;  3A2F A;  3ABM B;  3FFQ A;  1AJN A;  4B3R O;  3ABL C;  3ZHU A;  3TK1 A;  5FPR A;  5ITZ A;  1MSW D;  1S0V A;  1WA8 B;  1WPX A;  1AI7 A;  4I9W A;  5IWA O;  1QR9 A;  3QTC A;  4JZG A;  1YZB A;  2Z3Y A;  3DGE A;  4MVU A;  2JS5 A;  2W0X A;  1NU1 H;  5IY5 C;  1IBK B;  2IJJ A;  4IYI A;  4WBN B;  2EIJ C;  4KUM A;  4LF5 O;  2UU9 B;  4AQY O;  4DV0 O;  2VS0 A;  2IU0 A;  4DV3 O;  4PA9 A;  3OEE G;  5J2T A;  4DXW A;  5JH7 B;  2DYR B;  1R6N A;  3CRC A;  3A0H Z;  4KFM A; 
#chains in the Genus database with same CATH homology
 1M5I A;  3ZED A;  4F6R B;  5IJ0 B;  4O4J A;  3QF7 A;  4FVM A;  4I4T A;  3JAL B;  3N2G B;  3K57 A;  5JVD B;  5KX5 B;  4DV1 B;  3HKE B;  4UCO A;  3RYC B;  3WB2 A;  4DR7 B;  3VQY A;  4GYC B;  4DR4 B;  4JI2 B;  5BMV B;  2UUB B;  4ZOL A;  4UCV A;  5FNV A;  4FM1 A;  3JAW A;  5EIB D;  3CSX A;  5C8Y B;  1JMK C;  4OX9 B;  1V9P A;  2ZIN A;  2Q0A A;  4L8J A;  4U3J A;  5KMG A;  4EEQ A;  4JI5 B;  2P22 C;  3HKD B;  4KL1 A;  4HBN A;  4O4J B;  4UCR A;  3RWR D;  3ICX A;  4NXN B;  4I4T B;  3BA8 A;  2JVD A;  4TV8 A;  4KHP B;  4O4L A;  2YIB A;  1HW7 A;  1Q43 A;  1O9G A;  3HKC A;  4LR3 A;  3RYH B;  5BR8 B;  1FJG B;  2ZIM A;  4PI0 A;  1YEW A;  4LF7 B;  4YJ3 A;  1J5E B;  1RSO A;  2JGU A;  4UCS A;  4DK1 A;  4B08 A;  4O2A A;  5FNV B;  3JAW B;  5KHI A;  4O4I A;  3U11 A;  1KMI Z;  3UQ8 A;  1M4U A;  4GLX A;  4B3R B;  5LXT B;  4B3T B;  4YJ2 B;  1TGO A;  4TV9 B;  4U3J B;  3RGB A;  3JSN A;  5JCO C;  4PHZ A;  4JI7 B;  5IWA B;  3DSQ A;  4LFA B;  3SJA C;  4CS3 A;  5LP6 B;  1D5A A;  4DV2 B;  4O4H A;  4LF6 B;  4O2B A;  4O4L B;  5J2U A;  1Q8I A;  4FLW A;  5IYZ A;  5K1P A;  1WNS A;  4EFE A;  4DUY B;  2VQE B;  4DR3 B;  4LF5 B;  3T1H B;  4BW9 A;  4AQY B;  4X65 B;  4NXM B;  4DV3 B;  2UXB B;  4DRX B;  3BHP A;  4EB6 B;  3U10 A;  4O4I B;  5LP6 C;  4CC5 A;  4FLZ A;  1XHX A;  4CH6 A;  2PYJ A;  2PGG A;  4LNU A;  3RYF A;  1P49 A;  3JAR A;  1I7F A;  3N2K B;  4YHH B;  4X1I A;  2UUA B;  1SKV A;  5KHK A;  4PI2 A;  3SJC C;  4B3S B;  2EX3 A;  2ZNJ A;  2F1M A;  1VQ0 A;  3UT5 B;  1XNQ B;  1N33 B;  4O4H B;  2BTQ A;  4O2B B;  4EFB A;  5ITZ B;  2R9A A;  1WN7 A;  4X1K A;  4LH6 A;  3SJB C;  2OYQ A;  4B3M B;  5LA6 A;  1Q3E A;  1M93 A;  1NT2 B;  4LNU B;  3U0Z A;  3E22 A;  3SGI A;  1G6U A;  3JAR B;  2ZNI A;  4X1Y A;  3VQW A;  5CB4 B;  3B2E E;  4CS4 A;  5D5P A;  3BPZ A;  5CA1 A;  5J2T B;  1XMQ B;  5FPO A;  2ZCE A;  4LFB B;  3BA9 A;  1SQG A;  4ZHQ A;  3HKB A;  1VZY A;  2F93 B;  4FFB A;  1TAE A;  2F66 C;  4X20 A;  4DR5 B;  4FLX A;  3RYI A;  3M7M X;  4IIJ A;  4AHC A;  4JI6 B;  4DR2 B;  2QJ1 A;  1JJO A;  1B04 A;  2IM9 A;  3E22 B;  5EZY A;  2VQF B;  4DV7 B;  4ZOL B;  5IJ9 A;  4CH4 A;  3RFR A;  4DV6 B;  3T1Y B;  4HNA A;  2PYL A;  5CA1 B;  2UXD B;  2ZIO A;  4LFC B;  4IHJ A;  1TVK A;  3SR2 C;  5KMG B;  3JAK A;  1ZAU A;  4ZHQ B;  2HEP A;  3HKB B;  3PN1 A;  3JAS A;  5JQG A;  1TUB A;  5LMU B;  4FFB B;  5KHH A;  2VWJ A;  3RYI B;  5EYP A;  1T5E A;  4TV8 B;  2P5O A;  1X4T A;  4LF4 B;  4UFZ A;  4CS2 A;  4D7T A;  3JSL A;  4DUZ B;  4JYA B;  3HKC B;  1XI1 A;  4FLU A;  2F95 B;  4WBN A;  4DR1 B;  5EZY B;  2F4V B;  4YJ3 B;  5IJ9 B;  4JI1 B;  4O2A B;  5LOV A;  2YIB D;  2YI8 A;  5KHG A;  5LYJ A;  3VQV A;  2PY5 A;  4GKJ B;  3QG5 A;  3K5N A;  1N36 B;  4TQF A;  5JH7 A;  1TVK B;  3JAS B;  1TUB B;  3BRC A;  5IJ0 A;  4LF9 B;  1FFX A;  1Z5W A;  5D5Q A;  1SQF A;  4DV4 B;  3JAL A;  3N2G A;  3WB1 A;  4ZI7 A;  5JVD A;  5KX5 A;  4TOI A;  2GV9 A;  1I94 B;  1N32 B;  5J2U B;  2Q7G A;  3HKE A;  4X62 B;  1O9H A;  3RYC A;  3OTF A;  4ZIB A;  2XHB A;  1VF7 A;  5IYZ B;  5K1X A;  3IAY A;  1KU9 A;  2PZS A;  5BMV A;  2UUC B;  2BTO A;  2E3C A;  5JJJ B;  5LMN B;  1QHT A;  4I50 A;  4FM0 A;  2Q7E A;  3K58 A;  1DGS A;  2V4D A;  1QQC A;  3RYF B;  4CH3 A;  5JJE B;  1XMO B;  4X1I B;  4FLT A;  4FM2 A;  3HKD A;  3ETQ A;  4FLY A;  1FFX B;  4K8X A;  4NVP A;  5JJN B;  1H2S B;  4LF8 B;  4ZI7 B;  1TA8 A;  2BTQ B;  4AIL C;  3K59 A;  4CC6 A;  1JFF A;  4X1K B;  5JCO A;  2PTM A;  3RYH A;  4TQD A;  2YIA A;  4JI8 B;  3CHX A;  4TUY A;  4DV5 B;  1S5J A;  4JV5 B;  3OTO B;  4I50 B;  4FLV A;  5LA6 B;  5LXT A;  3K5L A;  2UXC B;  5GON A;  4YJ2 A;  4TV9 A;  4BWA A;  4X1Y B;  5EIB C;  3BAA A;  3LNN A;  1IBL B;  2Q7H A;  5LP6 A;  1Z5V A;  3BAB A;  4I55 A;  4X66 B;  4JI4 B;  4Q6G A;  2CAZ C;  1JFF B;  2RJZ A;  1IBM B;  4DK0 A;  4JI0 B;  3K5O A;  3ZS8 C;  4X20 B;  5KHJ A;  3JAT A;  4TUY B;  4IIJ B;  4DRX A;  1WPB A;  2YI9 A;  4EB6 A;  3THO A;  4DR6 B;  4K8Z A;  2YXL A;  2HHH B;  4UCT A;  5GON B;  1XQ8 A;  3K5M A;  3N2K A;  4LH7 A;  2ZM6 B;  2VWK A;  3WB0 A;  1L8D A;  4JI3 B;  2PUS A;  4HNA B;  3A2F A;  4GKK B;  1SA0 A;  4I55 B;  3FFQ A;  3UT5 A;  5CA0 A;  4D7S A;  5FPR A;  4IHJ B;  3VQX A;  5ITZ A;  3JAK B;  2RQ6 A;  4UCU A;  5JQG B;  3QTC A;  4K0K B;  4I9Q A;  4F6R A;  3JAT B;  2OWO A;  1HNW B;  5EYP B;  2JS5 A;  4DV0 B;  1Q5O A;  1N34 B;  1IBK B;  4X64 B;  4WBN B;  2QM4 A;  1HR0 B;  3MAQ A;  1XNR B;  2UU9 B;  3CB2 A;  2KKW A;  5CB4 A;  5LOV B;  1XHZ A;  5LYJ B;  1SA0 B;  5C8Y A;  5CA0 B;  5J2T A;  1HNX B;  2R72 A;  2R70 A;  5JH7 B;  2E5L B;  4CH5 A;  4YY3 B;  1HNZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...