3M7MX

Crystal structure of monomeric hsp33
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
231
structure length
231
Chain Sequence
IMPQHDQLHRYLFENFAVRGELVTVSETLQQILENHDYPQPVKNVLAELLVATSLLTATLKFDGDITVQLQGDGPMNLAVINGNNNQQMRGVARVQGEIPENADLKTLVGNGYVVITITPSEGERYQGVVGLEGDTLAADLEDYFMRSEELPTRLFIRTGDVDGKPAAGGMLLQVMPAQNAQQDDFDHLATLTETIKTEELLTLPANEVLWRLYHEEEVTVYDPQDVEFKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of monomeric hsp33
rcsb
source organism Escherichia coli
molecule tags Chaperone
molecule keywords 33 kDa chaperonin
total genus 53
structure length 231
sequence length 231
ec nomenclature
pdb deposition date 2010-03-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.480 Mainly Alpha Orthogonal Bundle Helix Hairpins helix hairpin bin 3m7mX02
3.55.30.10 Alpha Beta 3-Layer(bab) Sandwich Hsp33 domain Hsp33 domain 3m7mX01
1VQ0A 1HW7A 1VZYA 1I7FA 3M7MX
chains in the Genus database with same CATH superfamily
4CH5A 4EB6B 1R1BA 3JCZA 1GH6A 1AILA 4CC5A 4U7OA 1XMQB 1OCCB 3ZIAG 2UU9B 3LDEA 4MT8A 2UU9O 5L3GA 1BGYH 5B5EZ 3SJQC 5EK0A 4XDKA 2Q4PA 3MHSC 4O4HB 3CX5F 1QLNA 2IM9A 2ZD9A 3BY6A 1BHAA 2Q69A 3JAMN 3B8NA 3GWKC 1IDSA 1ZL8B 3I56V 3HKDB 1M5IA 3X2QC 3A2FA 4WFAV 4O4IB 4I9WA 1HNWO 1EN5A 4HNAB 2JGUA 1FPOA 4JTAB 1E1QG 4LFAO 4DR2O 4MS2A 3SDLA 2ZE6A 5B1AB 1VQ6V 4CH4A 1BE3H 3N2KB 4ZIBA 4LF5O 3NR7A 1FXHA 2DN9A 2A9HA 4AQYB 1OCZC 2UUBB 3RYHA 5FNVB 4DV7O 1NZ6A 3OE7G 1W0JG 3TJTA 3OM3B 5L3FA 4IT5A 3SGIA 4YY3O 1V54B 3NXSA 3JD4A 3KG2A 1JJOA 2WLJA 2Z5UA 1SETA 2ZIMA 4J7JA 1AI4A 3ZN0A 1MSWD 3OMNB 5BY1A 4DV4B 2YIDA 4B7KA 2BCCH 2IU3A 2K1EA 3AG3C 2QWQB 1NH2D 4XDLA 4X1YA 2WLLB 3KCYA 5C8YB 2A06H 1EZVH 4UXNA 2OCCC 5HFLA 4B08A 2JEXA 2VS0A 1K97A 3SPHA 4DR3O 2GHYA 5IWAO 4JV5B 2R9AA 5FLXN 3PN1A 2YEVB 2W0XA 1VF5B 3WB0A 4MVZA 1IBMO 2JJ1G 3CMAV 2ZQMA 4QIWF 5LXTA 1YJWV 4HYOA 3K9AA 2CTWA 1KMIZ 4UVBA 3R66A 4LF7B 1SRYA 3CCEV 1OHHG 2YC0A 3I5DA 1GM7A 3OTOB 4I7ZB 3G67A 2XTAA 4FLWA 4TUYB 4B3SB 2UXDO 1VQ0A 5JWPA 3TXSA 4X1IB 1T5EA 1J5EO 5CN0A 1K5QA 4Q6GA 3OEHG 3JAKA 3OTOO 1Y6XA 5KLVH 3OGCC 3D3QA 2LW1A 2OTJV 3ZJZA 3K03A 3CXHF 4LF8B 3VOUA 3L74H 2WLMA 5KA5A 2WPDG 3G4SV 4DV6B 1VQ5V 2EZPA 4TQFA 1G6UA 3E89A 4W4LA 1PNMA 1ZLZA 2QR4A 4IGGA 4WFFA 2QA4V 2UUAO 4PA3A 1MABG 1AP5A 5LYJA 3WFVA 1FJGO 4DW1A 5J9PC 1NBMG 2FTKA 5BZBA 1QLEB 4E2LA 2YUAA 2X6AA 3JALB 1JCHA 3CS5A 3E8GA 4JAUA 1TUBA 3CCQV 2CTPA 1PM9A 1JMKC 1AI7A 2RCVA 4LNUB 1TVKB 1I7FA 2DQ3A 4DR4O 2NLJC 1GM9A 3UM7A 2WLNA 5E1AC 4L8JA 3STZC 3ZHTA 1ZTEA 5BR8B 2F66C 4LF9O 5D5QA 1RP3B 2W0FC 3RYFA 3UO3A 5CB4B 4X9QA 2OCHA 4GX1A 2QKSA 4X1KB 1P7BA 2P06A 3ML0A 2HLDG 1QLEC 4YJ2B 2EBOA 4LFAB 1JQ0A 3ZMZA 4G2KA 3JASA 1VMGA 1H2LA 4X1KA 4CC6A 5LMNB 1GN2A 3BVOA 3JARB 3RYFB 3A0HZ 1Q6UA 4JI1O 3K3WA 2RNBA 5IE9A 2ATKC 1R73A 4BIOA 3SJCC 3JD1A 4GLXA 1OCZB 1SC5B 2OWOA 4JI8O 5LA6A 4PA7A 4FLVA 4TQDA 2DWDC 3OTFA 1EZJA 4O4JA 2QJ1A 1YCIA 5H2FZ 1N4CA 3VQWA 2QM7A 3ASOB 4FFKA 4DV2B 4K8ZA 5KAIZ 3S3XA 1NVPB 2JS5A 3K5OA 3C90A 4ZHQA 4O4IA 2UUCO 1VIBA 3JAWB 4NVPA 1V54C 3AK1A 1S3JA 3GVMA 2WLIA 1JFFB 5A9GA 4H33A 1NS1A 2EILB 2WAMA 2EINB 1YZBA 2YXYA 4UCUA 2F95B 1Q3EA 2E75B 4JI2B 3N2GA 4FPPA 4IHJA 5L3CA 1GN6A 2JJ2G 4DUZB 3G6BA 1M4UA 1KP2A 4LCUC 2WLKA 2CAZC 1IBLB 2Q0OC 2E5LO 2FYUH 3SPGA 1N0JA 2GBOA 3WG7B 3SYOA 4N23A 1Q6HA 3SYQA 1RSOB 4JAAA 4PI0A 2HKOA 4TV8A 4LC1A 3IJ4A 3D36A 3BCCH 3QTCA 3A0BZ 3QO5A 4D6TH 5LOVB 4Z1VA 5TISZ 3BA8A 2JGDA 1XNQB 3FD9A 4HAMA 4DV0O 5IWAB 1HDJA 1XMOB 2DW4A 5LP6B 1N34B 3AG7A 3KKYA 1NTKH 1M93A 1XUQA 3U11A 1FFTB 3M99B 1O9GA 4ZKIA 2UUAB 1YI2V 1PL4A 4AILC 2AHYA 2B9ZA 1MOFA 4WF9V 1P84F 3AK3A 2EX3A 2W6IG 3DGEA 4DV5O 3HB3B 1FFXA 3WB2A 4H13B 2QKAA 4MSWC 3QVNA 3OMIB 4MTOA 1F7YA 3W7WA 2H3OA 1NQTA 5ITZA 2GTAA 2CUGA 4FVMA 1HNXB 2HFEC 4ASUG 1QR8A 4X89A 1COWG 4O2BB 1Y76B 3ABKB 2XAFA 4FIPC 2M6YA 4QJFB 2UUCB 5K1XA 1AR1B 2QWPB 1IVSA 5EYPB 4FM1A 1QBZA 5CMUA 4LFBO 1L0NH 2QSAA 3K5LA 1MG1A 1KKDA 5EIBD 3ABLB 3T1CA 4RO2A 3Q4HB 4GX0A 3RW0A 2B5UA 4KXRA 4BWAA 1N34O 4O2AA 4LFCB 5IYCO 1NI8A 1ZSPA 3E2EA 1Y74A 3ETDA 3RYIB 4DR1O 1WN7A 4JI0B 4MTFA 2WSSG 4DV4O 2CDYA 5LA6B 3O65A 4JYAO 4YHHO 1AP6A 4JI7B 3BFRA 2P67A 4UB8Z 4WCEV 2ZR2A 4PDRA 4E4EA 4UVAA 1HR0O 4JI4B 2QGNA 1JOYA 3HPLC 4BR6A 2UXXA 3IGAC 3ABKC 1CPYA 1URFA 3VBBA 3GB7C 3JD3A 5B3SC 2DOSA 2EINC 1ZWIC 2Q7HA 4YJ2A 2YSUB 1P4RA 4J9ZB 2N05A 1OCRB 1TA8A 3ICXA 2XAJA 1XL6A 1R3IC 4JYAB 1XREA 4PELA 3F7YC 2F4VO 5KX5B 1RM1C 1B6QA 2EIJC 2GV9A 4LNUA 2DYRC 4MVOA 3HKCB 3P32A 1JX9A 3JSNA 1K4CC 5LGUA 3G80A 1VP7A 2HHHB 1BQZA 2FMLA 1IZ3A 2Y4UA 3FFQA 3IC7A 5EBLC 3CCRV 1XBLA 4QPKA 3EFFK 3ZMVA 4I9QA 1TUEB 2ZM6O 1N0NA 3WB1A 1L1FA 2CGOA 5LBQA 5EC1C 2KG7A 3LSSA 4UVCA 5LMUB 2JK5C 2XAGA 1B04A 2QDOA 1BL8A 3AG3B 1MA1A 2MK3A 2OIEA 1NT2B 4EFBA 4X66B 1K5SA 4B3RO 2OCCB 1HP8A 3JATA 5J2UB 2ETNA 4WBNA 3CSXA 2M7WA 5EBWC 2JDIG 1FAFA 3ZEDA 2HHHO 1JFFA 5LP6C 2JS3A 3BPZA 1SQGA 1Y67A 4TWKA 2XUMA 1Q81W 3FKSG 1DF4A 1SQVH 1WPBA 2Y4TA 1WB8A 2IJIA 2VQFO 2NR5A 5LHGA 4QPJA 1DK1A 1I94O 1KYOF 1W59A 4QE9A 1XILA 3CCLV 3CEIA 2ILMA 4J10A 2AXTZ 1R6TA 5FNVA 1KC8W 2F23A 2PI5A 2YICA 4IYIA 1IX9A 5LYJB 2X0LA 1E79G 4HBNA 2VQEO 3ETEA 2KKWA 4B3MB 3DSQA 3KCXA 1VQNV 1XQ8A 3P30A 3TXQA 1JR9A 4GKKO 1ROPA 1WB7A 2OIGA 4TV9B 2ZNJA 3RVYA 2LFRA 3FB8C 5D5PA 1YF2A 4NXNB 4J11A 2XAQA 1QVGU 3FX7A 3W7UA 4TSFG 1K92A 1WPXA 1HWYA 3E22B 5JCOA 3UKMA 3A0RA 1XDCA 2LQTA 2ZXWB 3CB2A 1KUQA 1H2NA 4LF5B 1RSOA 4YXWG 1PV0A 4OPHA 3CHXA 5B1OA 3OR7C 4BIUA 1ENVA 5J2UA 1XOUA 1XHXA 1HNXO 3QG5A 4UCVA 4CZZA 4FLZA 2ZCEA 4UCRA 1TVKA 1WP8A 2VWKA 4O4LB 3MAQA 1X59A 2Y0PA 4LF8O 4TOIA 3ZMUA 2RJZA 2PYJA 3IC9A 4B3TO 2Y48A 5GTIZ 1CXZB 4NTXA 2ZNIA 1P49A 4LF4B 4LWSB 4X66O 1L8DA 2YEVA 5IYZB 2Q8VA 5KHHA 4JYYA 4WFHA 3FAVA 3FB6C 1J5EB 2Q9LA 3TGUH 5EZYA 4J80A 2AZ0A 1OCRC 4FMTA 2UXDB 4WFEA 2OTLV 1Q5OA 5L3EA 4R7CA 3ZX6A 2IJKA 2QEXV 1N8RW 1G4YB 1RM1B 2ZXWC 2DE0X 1Q8IA 2L35A 1M9NA 2RDCA 3CP1A 4K0KO 5JQGB 2Y0IA 3OW2U 4JI4O 3TK1A 4JYBA 5B1BC 4U7NA 1JPXA 1SQXH 2XOKG 1DTOA 1F51A 1M90W 3BAAA 1IBKB 3BA9A 4MVQA 1RPOA 4OX9O 3B09A 3N2KA 3RT3C 4JV5O 1KU9A 1N32B 3APQA 1GN3A 3LNNA 5IY5B 1GRJA 1QCEA 5C93A 3ZRXA 3B77A 3ZRSA 3JD0A 1YJNV 2GSMB 4LFBB 2CTQA 3L71H 4PD4F 5CB4A 3H1IH 4YIOA 3SYPA 3OUFA 1W2BU 4DRXA 5LOVA 1K73W 3QNEA 4GX5A 1DGSA 4J41A 2A7WA 3AG1B 2XHBA 2ZE7A 2EULA 3VQYA 3B2EE 4EKWA 3TCUA 5FPOA 4X1YB 4LF9B 1BMFG 1H2GA 3K5NA 4PA9A 1IBKO 2XT9A 4JZ2A 3HKBB 1K9MW 4CS3A 1FD9A 4UV9A 5IYDO 4GKJB 3ZN1A 2VRZA 2HVKC 4K0KB 5CA0B 3ABMC 3D36C 2KSDA 4DV2O 3ZRVA 2P4KA 4FK5C 2V4DA 5H9CA 3RYCB 2UXBO 4UB6Z 1QVFU 4X20A 1I5YA 1FXKC 3LSUA 3C3SA 4P9PA 2PI4A 3QF7A 3OAAG 4DV1B 4KHPO 2WLIB 1I08A 3KZIZ 1SQFA 4RQEA 4MVSA 3JAKB 1Q7YW 4LBEC 3E8FA 3CD6V 4I4TA 4X62O 4X1IA 2EIKB 1NVPD 3OUSA 1R3LC 1KD1W 5DECA 1VQLV 3JSLA 3MDSA 4DV5B 2QKCA 4LP8A 1D5AA 3CRQA 3IFXA 2AZ2A 1S5LZ 1ZAUA 4LH6A 3CMEV 1SQPH 2E74B 5LL6Y 1N36O 3M7MX 4RUEA 3E86A 1OCCC 2IJHA 2AHZA 1YDXA 5E79Z 4FZ1A 2B1IA 2P4VA 4UCSA 2WLHA 4CBCA 1V9PA 4IIJA 1XNQO 3ZRWB 3OMAB 2YI8A 3SJAC 3SPCA 5JQGA 1S5JA 4JI7O 2LW7A 3X2QB 4DV3O 4YJ3B 4DV3B 2WLLA 4U3JB 3FYIB 1XMOO 2QWNB 1ZUQA 1SA0A 1YIJV 3K08A 4DR7B 1J95A 2AW9A 2G38A 3K0DA 3DC5A 3CJHA 5KAFZ 2X6BA 3JATB 5B66Z 4DRXB 2WWWA 3CC2V 5HFMA 4IL6Z 5CA1B 4MTXA 1EN6A 2QWOB 4RQFA 1AVMA 1ZX3A 4ZOLA 2HG5C 1YTFB 1BZKA 4ZHQB 1AJPA 1UPGA 5GTHZ 1H2KA 2IH3C 1NR1A 4O2BA 2XASA 2VQFB 4X62B 2Z3YA 3H1JH 2BE3A 3ZHVA 5IY5C 3SJBC 4LR3A 4KHPB 3K57A 1V55C 3F5WC 2R9IA 5ITZB 3ABUA 1AI6A 3ZHSA 4PDLA 4JI6B 3FB7C 4H44B 2DMXA 1BSMA 2H8PC 4I55A 5LXTB 1SESA 5LHHA 4ABMA 1LR1A 2ARHA 5LMUO 5H6QA 1SQBH 4J7KA 1GN4A 4PV1B 1XNRB 4H0LB 4DV1O 2BTOA 2QM8A 2JVDA 1MNGA 1HNWB 1XMQO 2A3QA 3AG1C 2X7RB 1K8AW 4DR3B 1AR4A 3H1LH 4GUNA 2XAHA 1WLEA 1Q90D 2JRIA 1N33B 4LWSA 5CA3A 5IYBO 4CS2A 1R3KC 5CBHA 3FAVB 1R3JC 2Y69C 4QNHB 4R50A 5JH7A 2V1DA 3AG4B 3FYEB 4DK0A 3L73H 3BRCA 3W7SA 5JJEB 3T1HO 1JA8A 3HKEA 1IBLO 1I5XA 2F43G 5KUMA 5LMNO 1SF9A 2DYRB 2ZT9B 2N04A 4PI2A 4Z2WA 1RFYA 2Q73A 1VF6C 2DQ0A 1SQQH 2OYQA 3HKCA 4X88A 2JEUA 5JVDB 1S77D 3E22A 1W0KG 3LDCA 4Q20A 5F2VO 2IW5A 4LFCO 4PJ0Z 2OT5A 5B1AC 1HNZB 5KHJA 1E1RG 2Q6AA 2VWJA 2HJFC 3MHHC 2O57A 3AG4C 2P6JA 3F7VC 3AEIA 2PY5A 5IJ9A 1S76D 1VF6A 4EB6A 3BABA 2Q0AA 2BSKB 1M57C 2Q7EA 1BHBA 2QM4A 1QQCA 3O9OA 1MZEA 5IJ9B 3RWRD 4PDMA 1GK9A 1VEWA 4XDJA 1FXVA 2YXHA 1MZFA 2E76B 4B3TB 1PNLA 5B3SB 1JJ2U 2LP7A 1H2MA 2CK3G 2ITDC 3K9SA 3SR2C 3GWOA 4NKGB 4UCOA 1WA8B 1AR5A 2XNDG 5DN6G 4X20B 1VZYA 2F4VB 5LGNA 3K79A 3ETGA 1P7GA 4G28B 1AJQA 1H38A 4MVRA 2UUBO 2CE4A 1N32O 1V55B 3JYCA 4X65B 1OZ0A 1Y74B 3RYIA 1SERA 3EVKA 1U96A 2LFSA 2ZM6B 2FL4A 4J9YB 3RN4A 4FM2A 3H9VA 1TUBB 2R9RB 4NXNO 1IXBA 2N74A 1TAEA 3PJSK 5A2QN 3C3TA 2CH7A 1XL4A 3UO2A 1KECA 1G8MA 3SYCA 3CE2A 2GDSA 4DUYO 1PD3A 5EIBC 2ADPA 1VQMV 4WFBV 2VQEB 4DR6O 3M8AA 4RWUA 4KL1A 5B1NA 4JI3O 4DW0A 1VQ7V 1OJHA 2LGQA 2QTSA 3DXRB 4X65O 4AQYO 1SKVA 4D7TA 5B1BB 1MMMA 1FXKB 1GKFA 2IU0A 4U3JA 5CA1A 2E3CA 1PKXA 4YJ3A 4ZBMA 2DWEC 2HVJC 4DUZO 1VQ8V 1SZXA 5GW7A 4DO2A 1HR0B 2ITCC 3CXCU 4LH7A 2ZR3A 4JI5O 3EHBB 4MW3A 2QE7G 2P7TC 2WA4A 2P5OA 2CGNA 2EIMC 1U97A 2FB5A 1OCOB 2YIBA 4GZRB 3CCVV 3L72H 3W7TA 3QO7A 2ZE5A 2Z0AA 3U10A 1K7DA 4HZ3A 1ORQC 1UFIA 1X4TA 2PYLA 2UXBB 1THZA 4F6RB 4J7ZA 2UXCO 1US6A 2LJ2A 1S5HC 4JYCA 3UT5B 4I50B 1GAXA 1VQOV 2BOBC 2L6LA 3JAWA 4FLUA 3K58A 4YIPA 2ZDIC 1NKDA 5KA6A 1NJIW 4JI1B 3ZRWA 3D8CA 1GTOA 3JALA 2MW2B 1M57B 1KBHA 3G6EV 2Q7GA 3E8HA 2RQ6A 1TGOA 2RN9A 3K04A 5L3BA 2QTOA 1GM8A 1IXMA 2ZINA 2EZOA 3N2GB 4IHJB 4JI3B 2HJDA 4L87A 5BXZA 1I94B 1RPRA 4B7EA 1B06A 2W6JG 4DR5O 2E5LB 3T1HB 2YXLA 4DV7B 2D2CB 3J7AU 2B1GA 3ETQA 4DK1A 1B3QA 3HKBA 3LDDA 5EC2C 5KMGB 2Q68A 4DR6B 4DR4B 2V7QG 1FXKA 2LO1A 3ASOC 5FL7G 1H2SB 5LP6A 4FJCC 3FB5C 5LGTA 4LF6B 1DLBA 2YDEA 3T1YB 1YXBA 4DR7O 2F93B 4JTDB 4BW9A 3K06A 1VARA 2PZSA 1OV9A 4MTGA 3E8BA 2JIZG 4B3MO 3VQVA 1GMGA 4H37A 4MVMA 3WU2Z 3D3IA 2BTQB 4TV8B 3W7XA 1I0HA 2PUSA 3OD4A 4JASA 5KX5A 3ZMTA 1HW7A 4PHZA 4OPAA 5CBGA 1XNRO 4NYKA 3WG7C 3LNMB 3JCUZ 2ZE8A 3JASB 1WA8A 1HNZO 3CYOA 4JI6O 3U0ZA 2F1MA 4FZ0A 1M56C 4JI2O 1LUVA 3ASNB 4D7SA 4LF7O 2GUZB 1Y66A 1H8HG 3E35A 5JVDA 1YVWA 2X6CA 4I0XA 3T4ZA 1S72V 1XI1A 3CRCA 1YHQV 5JJJB 4KUMA 1PNKA 2EJRA 1S0VA 5J2TA 1NTMH 2A79B 5IJ0A 2CH7B 1VQ4V 3SPIA 3B8MA 4YHHB 3UQ8A 5H5NA 3A8TA 1QR9A 4JI8B 3F5TA 3H1KH 4N21A 1WJZA 3CRAA 2IBZH 4FFBB 4K35A 3HKEB 1NU1H 3ZHQA 3JARA 3RFRA 4O4LA 1OCOC 2ADQB 1N36B 3LUTB 4YY3B 3CCUV 2EIKC 4K3AA 3THOA 4DV0B 4JF3A 1F23A 1R6KA 5C8YA 4NXMB 2ZDIA 1JVMA 1AI5A 4OXSA 3L75H 1BT8A 4I5SA 4IYHA 4FLXA 2D3OW 1BS3A 4AI8A 3S3WA 2KB1A 1K4DC 4DR2B 2YIBD 1PP9H 4P2ZA 4K8XA 1AB3A 4I55B 4IIJB 3IAYA 1YITV 4P9OA 4ZI7A 1QU7A 5BR8O 4DYLA 1DF5A 4KFMA 4MVUA 2UXNA 2DYSB 1EBOA 1FFXB 5KUKA 2YI9A 2BSKA 4X64B 3OGIB 3J81N 4X64O 1BQ0A 4AHCA 1XHZA 1PPJH 2RMKB 2HEPA 2IJJA 5LHIA 4FLTA 5JH7B 1LNQA 3ZHUA 4UCTA 3L9DA 4QE7A 4BAYA 4I50A 4ZI7B 5IT9N 3CCSV 5CBFA 3AG2C 2CTRA 2YS8A 4PA4A 1K3EA 3AK2A 2KQXA 1EFRG 4DV6O 4GYCB 1IBMB 2DYSC 1NH2B 1O9HA 2PGGA 5KHIA 3CCJV 2GUZA 3EXAA 3HKDA 5KMGA 3SYAA 4CH3A 3P3PA 3QO8A 1Y4MA 5KHGA 1Y76A 4GKJO 5JCOC 4R8CA 3K59A 1YEWA 4GT1A 1NR7A 2Q5ZA 4O4HA 1G1XB 1MSDA 2C2AA 3JD2A 1AJNA 1D5NA 3ZHRA 3LSQA 1QNMA 2ZIOA 3G71V 2WA3A 5EZYB 5KHKA 3RVZA 1WAZA 2BTQA 5DM6V 1KKCA 1WP7A 3ABTA 4LF6O 1CP9A 4LF4O 1FKAO 3ABMB 4GKKB 5BMVB 3ZCCA 4PA6A 1SZTA 5K1PA 1EN4A 2EIJB 4JAVA 5H6RA 4EEQA 4F4LA 4B3SO 4TUYA 3UCSC 3J80N 3Q4HA 3RGBA 1YTFD 4WFGA 3H1HH 3CC7V 3BEHA 1WNSA 4ZOLB 4X8AA 5IJ0B 3DTUB 4FM0A 2FKXA 2PF4E 4C7UA 1Z5VA 3R65A 3L70H 1Q6IA 4I4TB 4NXMO 1FYJA 1Q43A 1D2DA 1L0LH 1SA0B 4NB5A 4NTYA 4UV8A 4F6RA 2JGDB 4OX9B 4WBNB 4FLYA 3K5MA 3ZBHA 4JPRA 4B3RB 1GO3F 4JGSA 2EILC 4UUJC 4EFEA 1XEQA 3ASNC 5CA0A 1M1KW 2KG7B 1F4MA 2BOCC 3OR6C 4NR1A 2HR3A 1UJWB 2ODMA 3DC6A 1CEZA 1VQKV 4NTWA 3CC4V 3SPJA 3B40A 2YIAA 4JTCB 1YSCA 1A32A 3I55V 1R6NA 3T1YO 2NNUA 5J2TB 3HR0A 4OGQB 1NTZH 3ZS8C 2PTMA 5IDJA 3CRRA 3BHPA 1ZL8A 1PL0A 4O2AB 3DXRA 3T4DA 4HNAA 3TETA 1F4NA 4XBFA 4J42A 3E83A 4P30A 1KB9F 2NN4A 4KP4A 3T2MA 1LUWA 4BW5A 5IYZA 3CJHB 4RUFA 3STLC 5EBMC 1K33A 5EYPA 4BIZA 5L3DA 4TT3G 4O4JB 1VF7A 2LGWA 4PDVA 4CH6A 1Q82W 1AROP 3H01A 4GX2A 1Z5WA 4QGPA 3RBZA 5GONB 3B4SA 4G27B 5GONA 3APOA 4JZGA 1H8EG 4CS4A 5BMVA 2K9PA 2P90A 1FJGB 4F6EA 4Z1MG 2GTSA 3RYHB 2HP8A 5DEDA 3ZMSA 4FFBA 3CRMA 4JI0O 4DR1B 2P22C 3P3NA 1KQSU 3N27A 2DJVA 4GCZA 2H94A 1EM1A 3CCMV 1BCCH 1VQPV 2UXCB 3MD0A 4DR5B 1VQ9V 3UT5A 2A0LA 3OFNG 3OT7A 1K34A 2QWRB 2EIMB 2EJ7A 4R6ZA 1Q86W 2IH1C 5FPRA 4TV9A 1FS0G 4A5UB 2Q67A 2R72A 2AGAA 1M56B 1QHTA 3AG2B 1Z2GA 4I0XB 1KP3A 4UFZA 1IURA 1YJ9V 4DUYB 3CWBH 1SS3A 3VQXA 3CPWU 2R70A 4ICGA 3RYCA 4MW8A 3ABLC 4JI5B 4W4KA 3K0GA 4RAIA 3OEEG 4DXWA 2Y69B 2ZKOA 4U3FH 5AG2A 5JJNB 1N33O
chains in the Genus database with same CATH topology
4CH5A 4EB6B 1V9PA 4IIJA 3T1YB 2F93B 3K5LA 4BW9A 4CC5A 5EIBD 2YI8A 3SJAC 1XMQB 5JQGA 1S5JA 2UU9B 2PZSA 4YJ3B 4DV3B 4BWAA 4O2AA 4LFCB 4U3JB 3VQVA 1SA0A 4O4HB 3RYIB 2IM9A 4DR7B 4JI0B 1WN7A 2BTQB 4TV8B 2PUSA 5LA6B 3JATB 4DRXB 3HKDB 1M5IA 3A2FA 5CA1B 4O4IB 5KX5A 4JI7B 1HW7A 4PHZA 4HNAB 2JGUA 4JI4B 3JASB 4ZOLA 3U0ZA 4ZHQB 2F1MA 4O2BA 2VQFB 4CH4A 4X62B 3N2KB 4ZIBA 4D7SA 3SJBC 4LR3A 4AQYB 5JVDA 3RYHA 2Q7HA 2UUBB 5FNVB 4YJ2A 4KHPB 3K57A 5ITZB 3SGIA 1XI1A 1TA8A 3ICXA 1JJOA 4JI6B 5JJJB 4JYAB 2ZIMA 4I55A 5LXTB 5KX5B 4DV4B 5J2TA 2GV9A 4LNUA 3HKCB 5IJ0A 3JSNA 2HHHB 1XNRB 4YHHB 2BTOA 2JVDA 3FFQA 3UQ8A 1HNWB 4X1YA 5C8YB 4JI8B 4I9QA 4B08A 4FFBB 3WB1A 4DR3B 5LMUB 4JV5B 2R9AA 3HKEB 3PN1A 3JARA 1N33B 1B04A 3WB0A 3RFRA 4O4LA 4CS2A 1NT2B 1N36B 5LXTA 4EFBA 4YY3B 3THOA 5JH7A 4X66B 4DV0B 1KMIZ 3JATA 4DK0A 5J2UB 5C8YA 4WBNA 4NXMB 3BRCA 3CSXA 4LF7B 5JJEB 3HKEA 3ZEDA 1JFFA 5LP6C 3OTOB 4FLXA 3BPZA 1SQGA 4FLWA 4TUYB 4B3SB 1VQ0A 4DR2B 2YIBD 1WPBA 4K8XA 4PI2A 4X1IB 1T5EA 4I55B 4IIJB 3IAYA 4Q6GA 4ZI7A 3JAKA 2OYQA 3HKCA 1FFXB 5FNVA 2YI9A 5JVDB 4X64B 4AHCA 1XHZA 5LYJB 2HEPA 3E22A 4FLTA 4HBNA 5JH7B 4LF8B 2KKWA 4B3MB 3DSQA 4UCTA 1HNZB 1XQ8A 5KHJA 4DV6B 2VWJA 4TQFA 4I50A 4ZI7B 1G6UA 4TV9B 2ZNJA 2PY5A 5IJ9A 5D5PA 4EB6A 5LYJA 3BABA 4NXNB 4GYCB 1IBMB 2Q0AA 1O9HA 2PGGA 5KHIA 3JALB 2Q7EA 1TUBA 3HKDA 1JMKC 2QM4A 3E22B 1QQCA 4CH3A 5JCOA 4LNUB 5KMGA 1TVKB 5KHGA 5IJ9B 5JCOC 1I7FA 3CB2A 3K59A 1YEWA 4LF5B 3RWRD 1RSOA 4O4HA 3CHXA 2ZIOA 4L8JA 5BR8B 5EZYB 5KHKA 2BTQA 2F66C 5J2UA 5D5QA 1XHXA 4B3TB 4GKKB 5BMVB 3QG5A 4UCVA 5K1PA 4EEQA 2ZCEA 4FLZA 3RYFA 5CB4B 4UCRA 1TVKA 4TUYA 4FM1A 2VWKA 4O4LB 3MAQA 4X1KB 3RGBA 4TOIA 3SR2C 2RJZA 4UCOA 2PYJA 4YJ2B 4LFAB 1WNSA 3JASA 4ZOLB 2ZNIA 1P49A 4X20B 4X1KA 1VZYA 4CC6A 5IJ0B 2F4VB 4FM0A 4LF4B 5LMNB 1L8DA 3JARB 3RYFB 5IYZB 1Z5VA 5KHHA 1J5EB 4I4TB 5EZYA 4X65B 1Q43A 3RYIA 2UXDB 1SA0B 3SJCC 1Q5OA 4GLXA 2ZM6B 4F6RA 4OX9B 4WBNB 4FLYA 2OWOA 3K5MA 5LA6A 1Q8IA 4FM2A 1TUBB 5JQGB 4FLVA 4TQDA 3OTFA 4O4JA 1TAEA 4B3RB 2QJ1A 4EFEA 3VQWA 4DV2B 4K8ZA 5CA0A 5EIBC 3BAAA 1IBKB 2JS5A 3BA9A 3K5OA 4ZHQA 2VQEB 4O4IA 3JAWB 3N2KA 4NVPA 4KL1A 1KU9A 1N32B 1JFFB 1SKVA 3LNNA 4D7TA 2YIAA 4U3JA 5CA1A 2E3CA 4UCUA 4YJ3A 2F95B 1Q3EA 4JI2B 4LFBB 3N2GA 4IHJA 5J2TB 5CB4A 3ZS8C 2PTMA 4DUZB 1M4UA 3BHPA 4DRXA 2CAZC 4O2AB 1IBLB 5LOVA 1HR0B 4HNAA 1DGSA 4LH7A 2XHBA 4PI0A 3VQYA 3B2EE 5IYZA 2P5OA 4TV8A 5FPOA 4X1YB 5EYPA 2YIBA 4LF9B 3K5NA 3QTCA 4O4JB 3U10A 1VF7A 4CH6A 3HKBB 5LOVB 4CS3A 1X4TA 2PYLA 2UXBB 4GKJB 1Z5WA 5GONB 3BA8A 1XNQB 4F6RB 5GONA 5IWAB 1XMOB 4CS4A 4K0KB 5BMVA 1FJGB 5LP6B 5CA0B 1N34B 3UT5B 4I50B 3RYHB 1M93A 3JAWA 4FLUA 3U11A 4FFBA 4DR1B 3K58A 1O9GA 2UUAB 2V4DA 2P22C 4AILC 3RYCB 4JI1B 4X20A 3JALA 2EX3A 2UXCB 3QF7A 4DV1B 2Q7GA 4DR5B 1FFXA 3UT5A 3WB2A 2RQ6A 1TGOA 1SQFA 3JAKB 4I4TA 4X1IA 5FPRA 2ZINA 4TV9A 2R72A 3N2GB 4IHJB 4JI3B 1QHTA 5ITZA 1I94B 3JSLA 4DV5B 2E5LB 4UFZA 3T1HB 4FVMA 2YXLA 1D5AA 4DUYB 1HNXB 3VQXA 4DV7B 2R70A 3ETQA 4O2BB 4DK1A 1ZAUA 3RYCA 4LH6A 4JI5B 3HKBA 5KMGB 3M7MX 2UUCB 5K1XA 4DR6B 4DR4B 5JJNB 1H2SB 5EYPB 4UCSA 5LP6A 4LF6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ0 A;  1HW7 A;  1VZY A;  1I7F A;  3M7M X; 
#chains in the Genus database with same CATH topology
 4CH5 A;  4EB6 B;  1R1B A;  3JCZ A;  1GH6 A;  1AIL A;  4CC5 A;  4U7O A;  1XMQ B;  1OCC B;  3ZIA G;  2UU9 B;  3LDE A;  4MT8 A;  2UU9 O;  5L3G A;  1BGY H;  5B5E Z;  3SJQ C;  5EK0 A;  4XDK A;  2Q4P A;  3MHS C;  4O4H B;  3CX5 F;  1QLN A;  2IM9 A;  2ZD9 A;  3BY6 A;  1BHA A;  2Q69 A;  3JAM N;  3B8N A;  3GWK C;  1IDS A;  1ZL8 B;  3I56 V;  3HKD B;  1M5I A;  3X2Q C;  3A2F A;  4WFA V;  4O4I B;  4I9W A;  1HNW O;  1EN5 A;  4HNA B;  2JGU A;  1FPO A;  4JTA B;  1E1Q G;  4LFA O;  4DR2 O;  4MS2 A;  3SDL A;  2ZE6 A;  5B1A B;  1VQ6 V;  4CH4 A;  1BE3 H;  3N2K B;  4ZIB A;  4LF5 O;  3NR7 A;  1FXH A;  2DN9 A;  2A9H A;  4AQY B;  1OCZ C;  2UUB B;  3RYH A;  5FNV B;  4DV7 O;  1NZ6 A;  3OE7 G;  1W0J G;  3TJT A;  3OM3 B;  5L3F A;  4IT5 A;  3SGI A;  4YY3 O;  1V54 B;  3NXS A;  3JD4 A;  3KG2 A;  1JJO A;  2WLJ A;  2Z5U A;  1SET A;  2ZIM A;  4J7J A;  1AI4 A;  3ZN0 A;  1MSW D;  3OMN B;  5BY1 A;  4DV4 B;  2YID A;  4B7K A;  2BCC H;  2IU3 A;  2K1E A;  3AG3 C;  2QWQ B;  1NH2 D;  4XDL A;  4X1Y A;  2WLL B;  3KCY A;  5C8Y B;  2A06 H;  1EZV H;  4UXN A;  2OCC C;  5HFL A;  4B08 A;  2JEX A;  2VS0 A;  1K97 A;  3SPH A;  4DR3 O;  2GHY A;  5IWA O;  4JV5 B;  2R9A A;  5FLX N;  3PN1 A;  2YEV B;  2W0X A;  1VF5 B;  3WB0 A;  4MVZ A;  1IBM O;  2JJ1 G;  3CMA V;  2ZQM A;  4QIW F;  5LXT A;  1YJW V;  4HYO A;  3K9A A;  2CTW A;  1KMI Z;  4UVB A;  3R66 A;  4LF7 B;  1SRY A;  3CCE V;  1OHH G;  2YC0 A;  3I5D A;  1GM7 A;  3OTO B;  4I7Z B;  3G67 A;  2XTA A;  4FLW A;  4TUY B;  4B3S B;  2UXD O;  1VQ0 A;  5JWP A;  3TXS A;  4X1I B;  1T5E A;  1J5E O;  5CN0 A;  1K5Q A;  4Q6G A;  3OEH G;  3JAK A;  3OTO O;  1Y6X A;  5KLV H;  3OGC C;  3D3Q A;  2LW1 A;  2OTJ V;  3ZJZ A;  3K03 A;  3CXH F;  4LF8 B;  3VOU A;  3L74 H;  2WLM A;  5KA5 A;  2WPD G;  3G4S V;  4DV6 B;  1VQ5 V;  2EZP A;  4TQF A;  1G6U A;  3E89 A;  4W4L A;  1PNM A;  1ZLZ A;  2QR4 A;  4IGG A;  4WFF A;  2QA4 V;  2UUA O;  4PA3 A;  1MAB G;  1AP5 A;  5LYJ A;  3WFV A;  1FJG O;  4DW1 A;  5J9P C;  1NBM G;  2FTK A;  5BZB A;  1QLE B;  4E2L A;  2YUA A;  2X6A A;  3JAL B;  1JCH A;  3CS5 A;  3E8G A;  4JAU A;  1TUB A;  3CCQ V;  2CTP A;  1PM9 A;  1JMK C;  1AI7 A;  2RCV A;  4LNU B;  1TVK B;  1I7F A;  2DQ3 A;  4DR4 O;  2NLJ C;  1GM9 A;  3UM7 A;  2WLN A;  5E1A C;  4L8J A;  3STZ C;  3ZHT A;  1ZTE A;  5BR8 B;  2F66 C;  4LF9 O;  5D5Q A;  1RP3 B;  2W0F C;  3RYF A;  3UO3 A;  5CB4 B;  4X9Q A;  2OCH A;  4GX1 A;  2QKS A;  4X1K B;  1P7B A;  2P06 A;  3ML0 A;  2HLD G;  1QLE C;  4YJ2 B;  2EBO A;  4LFA B;  1JQ0 A;  3ZMZ A;  4G2K A;  3JAS A;  1VMG A;  1H2L A;  4X1K A;  4CC6 A;  5LMN B;  1GN2 A;  3BVO A;  3JAR B;  3RYF B;  3A0H Z;  1Q6U A;  4JI1 O;  3K3W A;  2RNB A;  5IE9 A;  2ATK C;  1R73 A;  4BIO A;  3SJC C;  3JD1 A;  4GLX A;  1OCZ B;  1SC5 B;  2OWO A;  4JI8 O;  5LA6 A;  4PA7 A;  4FLV A;  4TQD A;  2DWD C;  3OTF A;  1EZJ A;  4O4J A;  2QJ1 A;  1YCI A;  5H2F Z;  1N4C A;  3VQW A;  2QM7 A;  3ASO B;  4FFK A;  4DV2 B;  4K8Z A;  5KAI Z;  3S3X A;  1NVP B;  2JS5 A;  3K5O A;  3C90 A;  4ZHQ A;  4O4I A;  2UUC O;  1VIB A;  3JAW B;  4NVP A;  1V54 C;  3AK1 A;  1S3J A;  3GVM A;  2WLI A;  1JFF B;  5A9G A;  4H33 A;  1NS1 A;  2EIL B;  2WAM A;  2EIN B;  1YZB A;  2YXY A;  4UCU A;  2F95 B;  1Q3E A;  2E75 B;  4JI2 B;  3N2G A;  4FPP A;  4IHJ A;  5L3C A;  1GN6 A;  2JJ2 G;  4DUZ B;  3G6B A;  1M4U A;  1KP2 A;  4LCU C;  2WLK A;  2CAZ C;  1IBL B;  2Q0O C;  2E5L O;  2FYU H;  3SPG A;  1N0J A;  2GBO A;  3WG7 B;  3SYO A;  4N23 A;  1Q6H A;  3SYQ A;  1RSO B;  4JAA A;  4PI0 A;  2HKO A;  4TV8 A;  4LC1 A;  3IJ4 A;  3D36 A;  3BCC H;  3QTC A;  3A0B Z;  3QO5 A;  4D6T H;  5LOV B;  4Z1V A;  5TIS Z;  3BA8 A;  2JGD A;  1XNQ B;  3FD9 A;  4HAM A;  4DV0 O;  5IWA B;  1HDJ A;  1XMO B;  2DW4 A;  5LP6 B;  1N34 B;  3AG7 A;  3KKY A;  1NTK H;  1M93 A;  1XUQ A;  3U11 A;  1FFT B;  3M99 B;  1O9G A;  4ZKI A;  2UUA B;  1YI2 V;  1PL4 A;  4AIL C;  2AHY A;  2B9Z A;  1MOF A;  4WF9 V;  1P84 F;  3AK3 A;  2EX3 A;  2W6I G;  3DGE A;  4DV5 O;  3HB3 B;  1FFX A;  3WB2 A;  4H13 B;  2QKA A;  4MSW C;  3QVN A;  3OMI B;  4MTO A;  1F7Y A;  3W7W A;  2H3O A;  1NQT A;  5ITZ A;  2GTA A;  2CUG A;  4FVM A;  1HNX B;  2HFE C;  4ASU G;  1QR8 A;  4X89 A;  1COW G;  4O2B B;  1Y76 B;  3ABK B;  2XAF A;  4FIP C;  2M6Y A;  4QJF B;  2UUC B;  5K1X A;  1AR1 B;  2QWP B;  1IVS A;  5EYP B;  4FM1 A;  1QBZ A;  5CMU A;  4LFB O;  1L0N H;  2QSA A;  3K5L A;  1MG1 A;  1KKD A;  5EIB D;  3ABL B;  3T1C A;  4RO2 A;  3Q4H B;  4GX0 A;  3RW0 A;  2B5U A;  4KXR A;  4BWA A;  1N34 O;  4O2A A;  4LFC B;  5IYC O;  1NI8 A;  1ZSP A;  3E2E A;  1Y74 A;  3ETD A;  3RYI B;  4DR1 O;  1WN7 A;  4JI0 B;  4MTF A;  2WSS G;  4DV4 O;  2CDY A;  5LA6 B;  3O65 A;  4JYA O;  4YHH O;  1AP6 A;  4JI7 B;  3BFR A;  2P67 A;  4UB8 Z;  4WCE V;  2ZR2 A;  4PDR A;  4E4E A;  4UVA A;  1HR0 O;  4JI4 B;  2QGN A;  1JOY A;  3HPL C;  4BR6 A;  2UXX A;  3IGA C;  3ABK C;  1CPY A;  1URF A;  3VBB A;  3GB7 C;  3JD3 A;  5B3S C;  2DOS A;  2EIN C;  1ZWI C;  2Q7H A;  4YJ2 A;  2YSU B;  1P4R A;  4J9Z B;  2N05 A;  1OCR B;  1TA8 A;  3ICX A;  2XAJ A;  1XL6 A;  1R3I C;  4JYA B;  1XRE A;  4PEL A;  3F7Y C;  2F4V O;  5KX5 B;  1RM1 C;  1B6Q A;  2EIJ C;  2GV9 A;  4LNU A;  2DYR C;  4MVO A;  3HKC B;  3P32 A;  1JX9 A;  3JSN A;  1K4C C;  5LGU A;  3G80 A;  1VP7 A;  2HHH B;  1BQZ A;  2FML A;  1IZ3 A;  2Y4U A;  3FFQ A;  3IC7 A;  5EBL C;  3CCR V;  1XBL A;  4QPK A;  3EFF K;  3ZMV A;  4I9Q A;  1TUE B;  2ZM6 O;  1N0N A;  3WB1 A;  1L1F A;  2CGO A;  5LBQ A;  5EC1 C;  2KG7 A;  3LSS A;  4UVC A;  5LMU B;  2JK5 C;  2XAG A;  1B04 A;  2QDO A;  1BL8 A;  3AG3 B;  1MA1 A;  2MK3 A;  2OIE A;  1NT2 B;  4EFB A;  4X66 B;  1K5S A;  4B3R O;  2OCC B;  1HP8 A;  3JAT A;  5J2U B;  2ETN A;  4WBN A;  3CSX A;  2M7W A;  5EBW C;  2JDI G;  1FAF A;  3ZED A;  2HHH O;  1JFF A;  5LP6 C;  2JS3 A;  3BPZ A;  1SQG A;  1Y67 A;  4TWK A;  2XUM A;  1Q81 W;  3FKS G;  1DF4 A;  1SQV H;  1WPB A;  2Y4T A;  1WB8 A;  2IJI A;  2VQF O;  2NR5 A;  5LHG A;  4QPJ A;  1DK1 A;  1I94 O;  1KYO F;  1W59 A;  4QE9 A;  1XIL A;  3CCL V;  3CEI A;  2ILM A;  4J10 A;  2AXT Z;  1R6T A;  5FNV A;  1KC8 W;  2F23 A;  2PI5 A;  2YIC A;  4IYI A;  1IX9 A;  5LYJ B;  2X0L A;  1E79 G;  4HBN A;  2VQE O;  3ETE A;  2KKW A;  4B3M B;  3DSQ A;  3KCX A;  1VQN V;  1XQ8 A;  3P30 A;  3TXQ A;  1JR9 A;  4GKK O;  1ROP A;  1WB7 A;  2OIG A;  4TV9 B;  2ZNJ A;  3RVY A;  2LFR A;  3FB8 C;  5D5P A;  1YF2 A;  4NXN B;  4J11 A;  2XAQ A;  1QVG U;  3FX7 A;  3W7U A;  4TSF G;  1K92 A;  1WPX A;  1HWY A;  3E22 B;  5JCO A;  3UKM A;  3A0R A;  1XDC A;  2LQT A;  2ZXW B;  3CB2 A;  1KUQ A;  1H2N A;  4LF5 B;  1RSO A;  4YXW G;  1PV0 A;  4OPH A;  3CHX A;  5B1O A;  3OR7 C;  4BIU A;  1ENV A;  5J2U A;  1XOU A;  1XHX A;  1HNX O;  3QG5 A;  4UCV A;  4CZZ A;  4FLZ A;  2ZCE A;  4UCR A;  1TVK A;  1WP8 A;  2VWK A;  4O4L B;  3MAQ A;  1X59 A;  2Y0P A;  4LF8 O;  4TOI A;  3ZMU A;  2RJZ A;  2PYJ A;  3IC9 A;  4B3T O;  2Y48 A;  5GTI Z;  1CXZ B;  4NTX A;  2ZNI A;  1P49 A;  4LF4 B;  4LWS B;  4X66 O;  1L8D A;  2YEV A;  5IYZ B;  2Q8V A;  5KHH A;  4JYY A;  4WFH A;  3FAV A;  3FB6 C;  1J5E B;  2Q9L A;  3TGU H;  5EZY A;  4J80 A;  2AZ0 A;  1OCR C;  4FMT A;  2UXD B;  4WFE A;  2OTL V;  1Q5O A;  5L3E A;  4R7C A;  3ZX6 A;  2IJK A;  2QEX V;  1N8R W;  1G4Y B;  1RM1 B;  2ZXW C;  2DE0 X;  1Q8I A;  2L35 A;  1M9N A;  2RDC A;  3CP1 A;  4K0K O;  5JQG B;  2Y0I A;  3OW2 U;  4JI4 O;  3TK1 A;  4JYB A;  5B1B C;  4U7N A;  1JPX A;  1SQX H;  2XOK G;  1DTO A;  1F51 A;  1M90 W;  3BAA A;  1IBK B;  3BA9 A;  4MVQ A;  1RPO A;  4OX9 O;  3B09 A;  3N2K A;  3RT3 C;  4JV5 O;  1KU9 A;  1N32 B;  3APQ A;  1GN3 A;  3LNN A;  5IY5 B;  1GRJ A;  1QCE A;  5C93 A;  3ZRX A;  3B77 A;  3ZRS A;  3JD0 A;  1YJN V;  2GSM B;  4LFB B;  2CTQ A;  3L71 H;  4PD4 F;  5CB4 A;  3H1I H;  4YIO A;  3SYP A;  3OUF A;  1W2B U;  4DRX A;  5LOV A;  1K73 W;  3QNE A;  4GX5 A;  1DGS A;  4J41 A;  2A7W A;  3AG1 B;  2XHB A;  2ZE7 A;  2EUL A;  3VQY A;  3B2E E;  4EKW A;  3TCU A;  5FPO A;  4X1Y B;  4LF9 B;  1BMF G;  1H2G A;  3K5N A;  4PA9 A;  1IBK O;  2XT9 A;  4JZ2 A;  3HKB B;  1K9M W;  4CS3 A;  1FD9 A;  4UV9 A;  5IYD O;  4GKJ B;  3ZN1 A;  2VRZ A;  2HVK C;  4K0K B;  5CA0 B;  3ABM C;  3D36 C;  2KSD A;  4DV2 O;  3ZRV A;  2P4K A;  4FK5 C;  2V4D A;  5H9C A;  3RYC B;  2UXB O;  4UB6 Z;  1QVF U;  4X20 A;  1I5Y A;  1FXK C;  3LSU A;  3C3S A;  4P9P A;  2PI4 A;  3QF7 A;  3OAA G;  4DV1 B;  4KHP O;  2WLI B;  1I08 A;  3KZI Z;  1SQF A;  4RQE A;  4MVS A;  3JAK B;  1Q7Y W;  4LBE C;  3E8F A;  3CD6 V;  4I4T A;  4X62 O;  4X1I A;  2EIK B;  1NVP D;  3OUS A;  1R3L C;  1KD1 W;  5DEC A;  1VQL V;  3JSL A;  3MDS A;  4DV5 B;  2QKC A;  4LP8 A;  1D5A A;  3CRQ A;  3IFX A;  2AZ2 A;  1S5L Z;  1ZAU A;  4LH6 A;  3CME V;  1SQP H;  2E74 B;  5LL6 Y;  1N36 O;  3M7M X;  4RUE A;  3E86 A;  1OCC C;  2IJH A;  2AHZ A;  1YDX A;  5E79 Z;  4FZ1 A;  2B1I A;  2P4V A;  4UCS A;  2WLH A;  4CBC A;  1V9P A;  4IIJ A;  1XNQ O;  3ZRW B;  3OMA B;  2YI8 A;  3SJA C;  3SPC A;  5JQG A;  1S5J A;  4JI7 O;  2LW7 A;  3X2Q B;  4DV3 O;  4YJ3 B;  4DV3 B;  2WLL A;  4U3J B;  3FYI B;  1XMO O;  2QWN B;  1ZUQ A;  1SA0 A;  1YIJ V;  3K08 A;  4DR7 B;  1J95 A;  2AW9 A;  2G38 A;  3K0D A;  3DC5 A;  3CJH A;  5KAF Z;  2X6B A;  3JAT B;  5B66 Z;  4DRX B;  2WWW A;  3CC2 V;  5HFM A;  4IL6 Z;  5CA1 B;  4MTX A;  1EN6 A;  2QWO B;  4RQF A;  1AVM A;  1ZX3 A;  4ZOL A;  2HG5 C;  1YTF B;  1BZK A;  4ZHQ B;  1AJP A;  1UPG A;  5GTH Z;  1H2K A;  2IH3 C;  1NR1 A;  4O2B A;  2XAS A;  2VQF B;  4X62 B;  2Z3Y A;  3H1J H;  2BE3 A;  3ZHV A;  5IY5 C;  3SJB C;  4LR3 A;  4KHP B;  3K57 A;  1V55 C;  3F5W C;  2R9I A;  5ITZ B;  3ABU A;  1AI6 A;  3ZHS A;  4PDL A;  4JI6 B;  3FB7 C;  4H44 B;  2DMX A;  1BSM A;  2H8P C;  4I55 A;  5LXT B;  1SES A;  5LHH A;  4ABM A;  1LR1 A;  2ARH A;  5LMU O;  5H6Q A;  1SQB H;  4J7K A;  1GN4 A;  4PV1 B;  1XNR B;  4H0L B;  4DV1 O;  2BTO A;  2QM8 A;  2JVD A;  1MNG A;  1HNW B;  1XMQ O;  2A3Q A;  3AG1 C;  2X7R B;  1K8A W;  4DR3 B;  1AR4 A;  3H1L H;  4GUN A;  2XAH A;  1WLE A;  1Q90 D;  2JRI A;  1N33 B;  4LWS A;  5CA3 A;  5IYB O;  4CS2 A;  1R3K C;  5CBH A;  3FAV B;  1R3J C;  2Y69 C;  4QNH B;  4R50 A;  5JH7 A;  2V1D A;  3AG4 B;  3FYE B;  4DK0 A;  3L73 H;  3BRC A;  3W7S A;  5JJE B;  3T1H O;  1JA8 A;  3HKE A;  1IBL O;  1I5X A;  2F43 G;  5KUM A;  5LMN O;  1SF9 A;  2DYR B;  2ZT9 B;  2N04 A;  4PI2 A;  4Z2W A;  1RFY A;  2Q73 A;  1VF6 C;  2DQ0 A;  1SQQ H;  2OYQ A;  3HKC A;  4X88 A;  2JEU A;  5JVD B;  1S77 D;  3E22 A;  1W0K G;  3LDC A;  4Q20 A;  5F2V O;  2IW5 A;  4LFC O;  4PJ0 Z;  2OT5 A;  5B1A C;  1HNZ B;  5KHJ A;  1E1R G;  2Q6A A;  2VWJ A;  2HJF C;  3MHH C;  2O57 A;  3AG4 C;  2P6J A;  3F7V C;  3AEI A;  2PY5 A;  5IJ9 A;  1S76 D;  1VF6 A;  4EB6 A;  3BAB A;  2Q0A A;  2BSK B;  1M57 C;  2Q7E A;  1BHB A;  2QM4 A;  1QQC A;  3O9O A;  1MZE A;  5IJ9 B;  3RWR D;  4PDM A;  1GK9 A;  1VEW A;  4XDJ A;  1FXV A;  2YXH A;  1MZF A;  2E76 B;  4B3T B;  1PNL A;  5B3S B;  1JJ2 U;  2LP7 A;  1H2M A;  2CK3 G;  2ITD C;  3K9S A;  3SR2 C;  3GWO A;  4NKG B;  4UCO A;  1WA8 B;  1AR5 A;  2XND G;  5DN6 G;  4X20 B;  1VZY A;  2F4V B;  5LGN A;  3K79 A;  3ETG A;  1P7G A;  4G28 B;  1AJQ A;  1H38 A;  4MVR A;  2UUB O;  2CE4 A;  1N32 O;  1V55 B;  3JYC A;  4X65 B;  1OZ0 A;  1Y74 B;  3RYI A;  1SER A;  3EVK A;  1U96 A;  2LFS A;  2ZM6 B;  2FL4 A;  4J9Y B;  3RN4 A;  4FM2 A;  3H9V A;  1TUB B;  2R9R B;  4NXN O;  1IXB A;  2N74 A;  1TAE A;  3PJS K;  5A2Q N;  3C3T A;  2CH7 A;  1XL4 A;  3UO2 A;  1KEC A;  1G8M A;  3SYC A;  3CE2 A;  2GDS A;  4DUY O;  1PD3 A;  5EIB C;  2ADP A;  1VQM V;  4WFB V;  2VQE B;  4DR6 O;  3M8A A;  4RWU A;  4KL1 A;  5B1N A;  4JI3 O;  4DW0 A;  1VQ7 V;  1OJH A;  2LGQ A;  2QTS A;  3DXR B;  4X65 O;  4AQY O;  1SKV A;  4D7T A;  5B1B B;  1MMM A;  1FXK B;  1GKF A;  2IU0 A;  4U3J A;  5CA1 A;  2E3C A;  1PKX A;  4YJ3 A;  4ZBM A;  2DWE C;  2HVJ C;  4DUZ O;  1VQ8 V;  1SZX A;  5GW7 A;  4DO2 A;  1HR0 B;  2ITC C;  3CXC U;  4LH7 A;  2ZR3 A;  4JI5 O;  3EHB B;  4MW3 A;  2QE7 G;  2P7T C;  2WA4 A;  2P5O A;  2CGN A;  2EIM C;  1U97 A;  2FB5 A;  1OCO B;  2YIB A;  4GZR B;  3CCV V;  3L72 H;  3W7T A;  3QO7 A;  2ZE5 A;  2Z0A A;  3U10 A;  1K7D A;  4HZ3 A;  1ORQ C;  1UFI A;  1X4T A;  2PYL A;  2UXB B;  1THZ A;  4F6R B;  4J7Z A;  2UXC O;  1US6 A;  2LJ2 A;  1S5H C;  4JYC A;  3UT5 B;  4I50 B;  1GAX A;  1VQO V;  2BOB C;  2L6L A;  3JAW A;  4FLU A;  3K58 A;  4YIP A;  2ZDI C;  1NKD A;  5KA6 A;  1NJI W;  4JI1 B;  3ZRW A;  3D8C A;  1GTO A;  3JAL A;  2MW2 B;  1M57 B;  1KBH A;  3G6E V;  2Q7G A;  3E8H A;  2RQ6 A;  1TGO A;  2RN9 A;  3K04 A;  5L3B A;  2QTO A;  1GM8 A;  1IXM A;  2ZIN A;  2EZO A;  3N2G B;  4IHJ B;  4JI3 B;  2HJD A;  4L87 A;  5BXZ A;  1I94 B;  1RPR A;  4B7E A;  1B06 A;  2W6J G;  4DR5 O;  2E5L B;  3T1H B;  2YXL A;  4DV7 B;  2D2C B;  3J7A U;  2B1G A;  3ETQ A;  4DK1 A;  1B3Q A;  3HKB A;  3LDD A;  5EC2 C;  5KMG B;  2Q68 A;  4DR6 B;  4DR4 B;  2V7Q G;  1FXK A;  2LO1 A;  3ASO C;  5FL7 G;  1H2S B;  5LP6 A;  4FJC C;  3FB5 C;  5LGT A;  4LF6 B;  1DLB A;  2YDE A;  3T1Y B;  1YXB A;  4DR7 O;  2F93 B;  4JTD B;  4BW9 A;  3K06 A;  1VAR A;  2PZS A;  1OV9 A;  4MTG A;  3E8B A;  2JIZ G;  4B3M O;  3VQV A;  1GMG A;  4H37 A;  4MVM A;  3WU2 Z;  3D3I A;  2BTQ B;  4TV8 B;  3W7X A;  1I0H A;  2PUS A;  3OD4 A;  4JAS A;  5KX5 A;  3ZMT A;  1HW7 A;  4PHZ A;  4OPA A;  5CBG A;  1XNR O;  4NYK A;  3WG7 C;  3LNM B;  3JCU Z;  2ZE8 A;  3JAS B;  1WA8 A;  1HNZ O;  3CYO A;  4JI6 O;  3U0Z A;  2F1M A;  4FZ0 A;  1M56 C;  4JI2 O;  1LUV A;  3ASN B;  4D7S A;  4LF7 O;  2GUZ B;  1Y66 A;  1H8H G;  3E35 A;  5JVD A;  1YVW A;  2X6C A;  4I0X A;  3T4Z A;  1S72 V;  1XI1 A;  3CRC A;  1YHQ V;  5JJJ B;  4KUM A;  1PNK A;  2EJR A;  1S0V A;  5J2T A;  1NTM H;  2A79 B;  5IJ0 A;  2CH7 B;  1VQ4 V;  3SPI A;  3B8M A;  4YHH B;  3UQ8 A;  5H5N A;  3A8T A;  1QR9 A;  4JI8 B;  3F5T A;  3H1K H;  4N21 A;  1WJZ A;  3CRA A;  2IBZ H;  4FFB B;  4K35 A;  3HKE B;  1NU1 H;  3ZHQ A;  3JAR A;  3RFR A;  4O4L A;  1OCO C;  2ADQ B;  1N36 B;  3LUT B;  4YY3 B;  3CCU V;  2EIK C;  4K3A A;  3THO A;  4DV0 B;  4JF3 A;  1F23 A;  1R6K A;  5C8Y A;  4NXM B;  2ZDI A;  1JVM A;  1AI5 A;  4OXS A;  3L75 H;  1BT8 A;  4I5S A;  4IYH A;  4FLX A;  2D3O W;  1BS3 A;  4AI8 A;  3S3W A;  2KB1 A;  1K4D C;  4DR2 B;  2YIB D;  1PP9 H;  4P2Z A;  4K8X A;  1AB3 A;  4I55 B;  4IIJ B;  3IAY A;  1YIT V;  4P9O A;  4ZI7 A;  1QU7 A;  5BR8 O;  4DYL A;  1DF5 A;  4KFM A;  4MVU A;  2UXN A;  2DYS B;  1EBO A;  1FFX B;  5KUK A;  2YI9 A;  2BSK A;  4X64 B;  3OGI B;  3J81 N;  4X64 O;  1BQ0 A;  4AHC A;  1XHZ A;  1PPJ H;  2RMK B;  2HEP A;  2IJJ A;  5LHI A;  4FLT A;  5JH7 B;  1LNQ A;  3ZHU A;  4UCT A;  3L9D A;  4QE7 A;  4BAY A;  4I50 A;  4ZI7 B;  5IT9 N;  3CCS V;  5CBF A;  3AG2 C;  2CTR A;  2YS8 A;  4PA4 A;  1K3E A;  3AK2 A;  2KQX A;  1EFR G;  4DV6 O;  4GYC B;  1IBM B;  2DYS C;  1NH2 B;  1O9H A;  2PGG A;  5KHI A;  3CCJ V;  2GUZ A;  3EXA A;  3HKD A;  5KMG A;  3SYA A;  4CH3 A;  3P3P A;  3QO8 A;  1Y4M A;  5KHG A;  1Y76 A;  4GKJ O;  5JCO C;  4R8C A;  3K59 A;  1YEW A;  4GT1 A;  1NR7 A;  2Q5Z A;  4O4H A;  1G1X B;  1MSD A;  2C2A A;  3JD2 A;  1AJN A;  1D5N A;  3ZHR A;  3LSQ A;  1QNM A;  2ZIO A;  3G71 V;  2WA3 A;  5EZY B;  5KHK A;  3RVZ A;  1WAZ A;  2BTQ A;  5DM6 V;  1KKC A;  1WP7 A;  3ABT A;  4LF6 O;  1CP9 A;  4LF4 O;  1FKA O;  3ABM B;  4GKK B;  5BMV B;  3ZCC A;  4PA6 A;  1SZT A;  5K1P A;  1EN4 A;  2EIJ B;  4JAV A;  5H6R A;  4EEQ A;  4F4L A;  4B3S O;  4TUY A;  3UCS C;  3J80 N;  3Q4H A;  3RGB A;  1YTF D;  4WFG A;  3H1H H;  3CC7 V;  3BEH A;  1WNS A;  4ZOL B;  4X8A A;  5IJ0 B;  3DTU B;  4FM0 A;  2FKX A;  2PF4 E;  4C7U A;  1Z5V A;  3R65 A;  3L70 H;  1Q6I A;  4I4T B;  4NXM O;  1FYJ A;  1Q43 A;  1D2D A;  1L0L H;  1SA0 B;  4NB5 A;  4NTY A;  4UV8 A;  4F6R A;  2JGD B;  4OX9 B;  4WBN B;  4FLY A;  3K5M A;  3ZBH A;  4JPR A;  4B3R B;  1GO3 F;  4JGS A;  2EIL C;  4UUJ C;  4EFE A;  1XEQ A;  3ASN C;  5CA0 A;  1M1K W;  2KG7 B;  1F4M A;  2BOC C;  3OR6 C;  4NR1 A;  2HR3 A;  1UJW B;  2ODM A;  3DC6 A;  1CEZ A;  1VQK V;  4NTW A;  3CC4 V;  3SPJ A;  3B40 A;  2YIA A;  4JTC B;  1YSC A;  1A32 A;  3I55 V;  1R6N A;  3T1Y O;  2NNU A;  5J2T B;  3HR0 A;  4OGQ B;  1NTZ H;  3ZS8 C;  2PTM A;  5IDJ A;  3CRR A;  3BHP A;  1ZL8 A;  1PL0 A;  4O2A B;  3DXR A;  3T4D A;  4HNA A;  3TET A;  1F4N A;  4XBF A;  4J42 A;  3E83 A;  4P30 A;  1KB9 F;  2NN4 A;  4KP4 A;  3T2M A;  1LUW A;  4BW5 A;  5IYZ A;  3CJH B;  4RUF A;  3STL C;  5EBM C;  1K33 A;  5EYP A;  4BIZ A;  5L3D A;  4TT3 G;  4O4J B;  1VF7 A;  2LGW A;  4PDV A;  4CH6 A;  1Q82 W;  1ARO P;  3H01 A;  4GX2 A;  1Z5W A;  4QGP A;  3RBZ A;  5GON B;  3B4S A;  4G27 B;  5GON A;  3APO A;  4JZG A;  1H8E G;  4CS4 A;  5BMV A;  2K9P A;  2P90 A;  1FJG B;  4F6E A;  4Z1M G;  2GTS A;  3RYH B;  2HP8 A;  5DED A;  3ZMS A;  4FFB A;  3CRM A;  4JI0 O;  4DR1 B;  2P22 C;  3P3N A;  1KQS U;  3N27 A;  2DJV A;  4GCZ A;  2H94 A;  1EM1 A;  3CCM V;  1BCC H;  1VQP V;  2UXC B;  3MD0 A;  4DR5 B;  1VQ9 V;  3UT5 A;  2A0L A;  3OFN G;  3OT7 A;  1K34 A;  2QWR B;  2EIM B;  2EJ7 A;  4R6Z A;  1Q86 W;  2IH1 C;  5FPR A;  4TV9 A;  1FS0 G;  4A5U B;  2Q67 A;  2R72 A;  2AGA A;  1M56 B;  1QHT A;  3AG2 B;  1Z2G A;  4I0X B;  1KP3 A;  4UFZ A;  1IUR A;  1YJ9 V;  4DUY B;  3CWB H;  1SS3 A;  3VQX A;  3CPW U;  2R70 A;  4ICG A;  3RYC A;  4MW8 A;  3ABL C;  4JI5 B;  4W4K A;  3K0G A;  4RAI A;  3OEE G;  4DXW A;  2Y69 B;  2ZKO A;  4U3F H;  5AG2 A;  5JJN B;  1N33 O; 
#chains in the Genus database with same CATH homology
 4CH5 A;  4EB6 B;  1V9P A;  4IIJ A;  3T1Y B;  2F93 B;  3K5L A;  4BW9 A;  4CC5 A;  5EIB D;  2YI8 A;  3SJA C;  1XMQ B;  5JQG A;  1S5J A;  2UU9 B;  2PZS A;  4YJ3 B;  4DV3 B;  4BWA A;  4O2A A;  4LFC B;  4U3J B;  3VQV A;  1SA0 A;  4O4H B;  3RYI B;  2IM9 A;  4DR7 B;  4JI0 B;  1WN7 A;  2BTQ B;  4TV8 B;  2PUS A;  5LA6 B;  3JAT B;  4DRX B;  3HKD B;  1M5I A;  3A2F A;  5CA1 B;  4O4I B;  5KX5 A;  4JI7 B;  1HW7 A;  4PHZ A;  4HNA B;  2JGU A;  4JI4 B;  3JAS B;  4ZOL A;  3U0Z A;  4ZHQ B;  2F1M A;  4O2B A;  2VQF B;  4CH4 A;  4X62 B;  3N2K B;  4ZIB A;  4D7S A;  3SJB C;  4LR3 A;  4AQY B;  5JVD A;  3RYH A;  2Q7H A;  2UUB B;  5FNV B;  4YJ2 A;  4KHP B;  3K57 A;  5ITZ B;  3SGI A;  1XI1 A;  1TA8 A;  3ICX A;  1JJO A;  4JI6 B;  5JJJ B;  4JYA B;  2ZIM A;  4I55 A;  5LXT B;  5KX5 B;  4DV4 B;  5J2T A;  2GV9 A;  4LNU A;  3HKC B;  5IJ0 A;  3JSN A;  2HHH B;  1XNR B;  4YHH B;  2BTO A;  2JVD A;  3FFQ A;  3UQ8 A;  1HNW B;  4X1Y A;  5C8Y B;  4JI8 B;  4I9Q A;  4B08 A;  4FFB B;  3WB1 A;  4DR3 B;  5LMU B;  4JV5 B;  2R9A A;  3HKE B;  3PN1 A;  3JAR A;  1N33 B;  1B04 A;  3WB0 A;  3RFR A;  4O4L A;  4CS2 A;  1NT2 B;  1N36 B;  5LXT A;  4EFB A;  4YY3 B;  3THO A;  5JH7 A;  4X66 B;  4DV0 B;  1KMI Z;  3JAT A;  4DK0 A;  5J2U B;  5C8Y A;  4WBN A;  4NXM B;  3BRC A;  3CSX A;  4LF7 B;  5JJE B;  3HKE A;  3ZED A;  1JFF A;  5LP6 C;  3OTO B;  4FLX A;  3BPZ A;  1SQG A;  4FLW A;  4TUY B;  4B3S B;  1VQ0 A;  4DR2 B;  2YIB D;  1WPB A;  4K8X A;  4PI2 A;  4X1I B;  1T5E A;  4I55 B;  4IIJ B;  3IAY A;  4Q6G A;  4ZI7 A;  3JAK A;  2OYQ A;  3HKC A;  1FFX B;  5FNV A;  2YI9 A;  5JVD B;  4X64 B;  4AHC A;  1XHZ A;  5LYJ B;  2HEP A;  3E22 A;  4FLT A;  4HBN A;  5JH7 B;  4LF8 B;  2KKW A;  4B3M B;  3DSQ A;  4UCT A;  1HNZ B;  1XQ8 A;  5KHJ A;  4DV6 B;  2VWJ A;  4TQF A;  4I50 A;  4ZI7 B;  1G6U A;  4TV9 B;  2ZNJ A;  2PY5 A;  5IJ9 A;  5D5P A;  4EB6 A;  5LYJ A;  3BAB A;  4NXN B;  4GYC B;  1IBM B;  2Q0A A;  1O9H A;  2PGG A;  5KHI A;  3JAL B;  2Q7E A;  1TUB A;  3HKD A;  1JMK C;  2QM4 A;  3E22 B;  1QQC A;  4CH3 A;  5JCO A;  4LNU B;  5KMG A;  1TVK B;  5KHG A;  5IJ9 B;  5JCO C;  1I7F A;  3CB2 A;  3K59 A;  1YEW A;  4LF5 B;  3RWR D;  1RSO A;  4O4H A;  3CHX A;  2ZIO A;  4L8J A;  5BR8 B;  5EZY B;  5KHK A;  2BTQ A;  2F66 C;  5J2U A;  5D5Q A;  1XHX A;  4B3T B;  4GKK B;  5BMV B;  3QG5 A;  4UCV A;  5K1P A;  4EEQ A;  2ZCE A;  4FLZ A;  3RYF A;  5CB4 B;  4UCR A;  1TVK A;  4TUY A;  4FM1 A;  2VWK A;  4O4L B;  3MAQ A;  4X1K B;  3RGB A;  4TOI A;  3SR2 C;  2RJZ A;  4UCO A;  2PYJ A;  4YJ2 B;  4LFA B;  1WNS A;  3JAS A;  4ZOL B;  2ZNI A;  1P49 A;  4X20 B;  4X1K A;  1VZY A;  4CC6 A;  5IJ0 B;  2F4V B;  4FM0 A;  4LF4 B;  5LMN B;  1L8D A;  3JAR B;  3RYF B;  5IYZ B;  1Z5V A;  5KHH A;  1J5E B;  4I4T B;  5EZY A;  4X65 B;  1Q43 A;  3RYI A;  2UXD B;  1SA0 B;  3SJC C;  1Q5O A;  4GLX A;  2ZM6 B;  4F6R A;  4OX9 B;  4WBN B;  4FLY A;  2OWO A;  3K5M A;  5LA6 A;  1Q8I A;  4FM2 A;  1TUB B;  5JQG B;  4FLV A;  4TQD A;  3OTF A;  4O4J A;  1TAE A;  4B3R B;  2QJ1 A;  4EFE A;  3VQW A;  4DV2 B;  4K8Z A;  5CA0 A;  5EIB C;  3BAA A;  1IBK B;  2JS5 A;  3BA9 A;  3K5O A;  4ZHQ A;  2VQE B;  4O4I A;  3JAW B;  3N2K A;  4NVP A;  4KL1 A;  1KU9 A;  1N32 B;  1JFF B;  1SKV A;  3LNN A;  4D7T A;  2YIA A;  4U3J A;  5CA1 A;  2E3C A;  4UCU A;  4YJ3 A;  2F95 B;  1Q3E A;  4JI2 B;  4LFB B;  3N2G A;  4IHJ A;  5J2T B;  5CB4 A;  3ZS8 C;  2PTM A;  4DUZ B;  1M4U A;  3BHP A;  4DRX A;  2CAZ C;  4O2A B;  1IBL B;  5LOV A;  1HR0 B;  4HNA A;  1DGS A;  4LH7 A;  2XHB A;  4PI0 A;  3VQY A;  3B2E E;  5IYZ A;  2P5O A;  4TV8 A;  5FPO A;  4X1Y B;  5EYP A;  2YIB A;  4LF9 B;  3K5N A;  3QTC A;  4O4J B;  3U10 A;  1VF7 A;  4CH6 A;  3HKB B;  5LOV B;  4CS3 A;  1X4T A;  2PYL A;  2UXB B;  4GKJ B;  1Z5W A;  5GON B;  3BA8 A;  1XNQ B;  4F6R B;  5GON A;  5IWA B;  1XMO B;  4CS4 A;  4K0K B;  5BMV A;  1FJG B;  5LP6 B;  5CA0 B;  1N34 B;  3UT5 B;  4I50 B;  3RYH B;  1M93 A;  3JAW A;  4FLU A;  3U11 A;  4FFB A;  4DR1 B;  3K58 A;  1O9G A;  2UUA B;  2V4D A;  2P22 C;  4AIL C;  3RYC B;  4JI1 B;  4X20 A;  3JAL A;  2EX3 A;  2UXC B;  3QF7 A;  4DV1 B;  2Q7G A;  4DR5 B;  1FFX A;  3UT5 A;  3WB2 A;  2RQ6 A;  1TGO A;  1SQF A;  3JAK B;  4I4T A;  4X1I A;  5FPR A;  2ZIN A;  4TV9 A;  2R72 A;  3N2G B;  4IHJ B;  4JI3 B;  1QHT A;  5ITZ A;  1I94 B;  3JSL A;  4DV5 B;  2E5L B;  4UFZ A;  3T1H B;  4FVM A;  2YXL A;  1D5A A;  4DUY B;  1HNX B;  3VQX A;  4DV7 B;  2R70 A;  3ETQ A;  4O2B B;  4DK1 A;  1ZAU A;  3RYC A;  4LH6 A;  4JI5 B;  3HKB A;  5KMG B;  3M7M X;  2UUC B;  5K1X A;  4DR6 B;  4DR4 B;  5JJN B;  1H2S B;  5EYP B;  4UCS A;  5LP6 A;  4LF6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...