3M7MX

Crystal structure of monomeric hsp33
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
231
structure length
231
Chain Sequence
IMPQHDQLHRYLFENFAVRGELVTVSETLQQILENHDYPQPVKNVLAELLVATSLLTATLKFDGDITVQLQGDGPMNLAVINGNNNQQMRGVARVQGEIPENADLKTLVGNGYVVITITPSEGERYQGVVGLEGDTLAADLEDYFMRSEELPTRLFIRTGDVDGKPAAGGMLLQVMPAQNAQQDDFDHLATLTETIKTEELLTLPANEVLWRLYHEEEVTVYDPQDVEFKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords 33 kDa chaperonin
publication title Crystal structure of monomeric hsp33
rcsb
source organism Escherichia coli
total genus 53
structure length 231
sequence length 231
ec nomenclature
pdb deposition date 2010-03-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.480 Mainly Alpha Orthogonal Bundle Helix Hairpins helix hairpin bin 3m7mX02
3.55.30.10 Alpha Beta 3-Layer(bab) Sandwich Hsp33 domain Hsp33 domain 3m7mX01
1VZYA 1HW7A 1VQ0A 3M7MX 1I7FA
chains in the Genus database with same CATH superfamily
2BOCC 1XQ8A 5B3SC 2ZXWC 4F6RA 4KP4A 1M5IA 4TSFG 4Z1VA 1ENVA 3RYCA 3B4SA 2NNUA 5CA3A 3HKBA 5IYBO 5IYDO 3UQ8A 1K33A 4DR1B 2JIZG 3JAWB 1GN4A 4FLTA 2BTOA 5B66Z 1KD1W 2Q0OC 2QSAA 2YIBA 3RYHB 4UCUA 3M99B 4LF6O 1S0VA 2LQTA 1WNSA 1V55B 3DSQA 4YJ2A 2UXNA 1J5EB 4LH6A 5TISZ 1BZKA 4X20A 3GVMA 4A5UB 4Q6GA 1BHBA 2OIEA 1X59A 2IJHA 4ZKIA 3K59A 2OIGA 3APOA 3A0HZ 2WLIB 1YJWV 4LCUC 5EYPB 4I50A 3ZMZA 4R50A 3LSSA 1PL4A 4LF9O 1Q6HA 4O4HB 1G4YB 2ZDIA 2E5LO 3HKEB 5B1BB 4TV8A 1S72V 1T5EA 4LWSB 2YIAA 2PI5A 4FK5C 5B1BC 5LHIA 3D3IA 2X6AA 1N33B 1E79G 2FMLA 3IC9A 3DC6A 4LF5O 4GX2A 1AI4A 3CCUV 1M9NA 2Q7HA 3U10A 2YS8A 1J95A 2UXCB 5HFLA 2YXLA 4X1KB 3H01A 1GAXA 5LGUA 3FB6C 1TUEB 5E79Z 4FFBA 3K5MA 4H37A 3D36C 3KZIZ 1M56B 1P84F 1JOYA 4NYKA 1AI5A 2QWRB 2CTRA 1TVKB 5H5NA 4MVRA 3G4SV 4DV7O 4FZ0A 1VQ0A 1PD3A 1NQTA 2A7WA 1B6QA 4JI3O 3L71H 1ZL8B 1OCOB 5LOVB 3UT5A 4L87A 3F5TA 4JI7O 3AK1A 3ZN1A 4YY3O 3ZHQA 3J80N 4UCOA 1PKXA 2P06A 2P67A 2B1GA 2ZQMA 4X65B 2Q7EA 4O2AA 3AG3B 4MVUA 3IJ4A 3CPWU 2ZE6A 2EIMC 1I94B 3A0BZ 2QWQB 1VARA 4HNAA 1W0KG 4R7CA 2D3OW 2EIKC 3AG3C 1FXVA 5LP6A 2ZE7A 1HR0O 5GW7A 1WP7A 2N04A 1FFXA 2AZ0A 2RNBA 4LFCB 2LGWA 2WPDG 4FM2A 5JJJB 2E75B 2W6JG 5EBWC 4JGSA 4YIOA 3U11A 3E35A 4I9QA 2YSUB 3MHSC 4J9ZB 3RYIA 3JAKB 4ASUG 5KHIA 1RP3B 4P9PA 4DV3O 4QJFB 1FXKB 3AG4B 3VBBA 3AG2B 1H2NA 3JD4A 4ZBMA 3JAMN 1BS3A 4BIUA 1HNXB 3ABMB 4JYYA 1FXKC 4X64B 3ZBHA 3W7WA 5L3BA 3AG2C 3N2KA 1MZFA 2ATKC 2HEPA 2L35A 4O4LA 1BL8A 3QF7A 4H33A 3OAAG 4JTCB 3ABMC 1PNMA 3ABKC 1WP8A 4MVQA 1GM9A 2PF4E 4RQFA 2PGGA 5KMGB 1SA0A 4WFAV 4DXWA 1PV0A 3RVYA 5L3FA 2EULA 3CCSV 1MSWD 2GDSA 5BR8O 1L8DA 3ABUA 4MS2A 2YXHA 3K0GA 4ZIBA 4JI5B 2F93B 2FTKA 2E74B 1N0JA 1VIBA 2JGUA 3WFVA 2BTQB 3FKSG 1XHXA 3G6EV 4CH6A 3GWOA 1OJHA 4JASA 1YJNV 4DK0A 1Y76A 3H1KH 4I4TB 4U3JA 3KCYA 4KFMA 3TK1A 3T1HO 2ZINA 2JS3A 5KX5B 4PA6A 2F4VO 1Z5WA 4JZGA 5E1AC 4IYIA 4GUNA 3WB1A 1OHHG 5DEDA 2KG7A 1M93A 2F23A 4LF7O 2R9RB 3OGCC 1F7YA 3RN4A 2RCVA 1D5AA 3B2EE 4IYHA 1QBZA 3L72H 5AG2A 3ETQA 2M6YA 4EB6B 3OR6C 4MVSA 3CJHA 1VQPV 2A06H 2Q67A 3ASNB 2ITCC 2CE4A 1N32O 1M90W 2ZM6O 4O4IB 5KUMA 5KHGA 5CA0B 2DYRB 2GUZA 3QG5A 3ZHUA 3ASNC 1HNWO 2ZD9A 4DR5B 5GTHZ 3ZN0A 1BT8A 2DYRC 3JD2A 5J2TB 5JCOC 3EHBB 4FVMA 5LMNB 4JAUA 5C8YB 3UCSC 1XEQA 1R6KA 2DJVA 4TQFA 3C90A 2X0LA 2IJJA 3CHXA 5EZYA 3S3XA 1SQFA 2Y48A 2BSKA 1CXZB 2V7QG 4JTAB 1XNQB 1SQXH 2EX3A 3CCRV 1NTZH 4GYCB 4NKGB 2DN9A 5B5EZ 1HWYA 1URFA 1ZUQA 4JPRA 4RWUA 4X89A 1FAFA 2KKWA 1ZX3A 2QM7A 3FAVA 3FFQA 1H2LA 2W0FC 4HZ3A 4UCVA 1EM1A 4TV9B 4WBNA 3OUFA 4X1IA 4B3MB 4XBFA 4GX1A 4JI8O 3CXHF 3JALA 1JX9A 3ZMVA 4F6EA 1J5EO 4X66O 3W7UA 2UU9O 2MW2B 2DYSC 1XUQA 2R9AA 4FFKA 3OEEG 3LNMB 2EINB 3FYIB 1AI7A 3H9VA 1QVFU 3N27A 3OGIB 2B1IA 2N74A 5ITZB 2CTWA 1GN2A 1P7GA 5D5PA 3K0DA 3IGAC 3O65A 4X62O 5EC1C 2IU3A 1IBMO 2WSSG 4I9WA 5LMUB 4DV2B 1EZVH 4K8XA 5CA1B 3SYOA 4LNUA 3SPJA 1FXHA 2DQ0A 2UXDO 3JASA 4LF8B 3AK2A 4ABMA 4JI0B 2V4DA 2Q8VA 1L1FA 1N33O 2IM9A 3CRMA 5LYJA 3CRRA 3SPGA 4BAYA 5CBFA 1YSCA 3JSLA 4J7JA 5J2UB 4HBNA 1SERA 2Z5UA 4J9YB 1OZ0A 4Q20A 2UXCO 3SYQA 4JYBA 4NR1A 2P4KA 2AHZA 3JD0A 3P3NA 3WG7C 1XREA 3L9DA 3LDDA 3SR2C 1DGSA 2WLMA 1QNMA 4LFBB 3RYFA 1JJOA 4PDMA 2ZKOA 4EFBA 4KHPO 4NTYA 4F6RB 2UUAB 3RYCB 3K5OA 5EK0A 3C3TA 3AG1C 4P2ZA 1QLEC 1X4TA 3CC4V 2A3QA 2HVJC 3HKBB 2VQFB 1XOUA 2CGOA 3LNNA 4IL6Z 1VQKV 1M4UA 1DF5A 4K0KO 2V1DA 4E2LA 1QHTA 4UXNA 3UM7A 4GLXA 1I08A 4IGGA 3A0RA 2CH7A 1RSOA 2EZOA 1FYJA 4YJ2B 4B7KA 4X20B 5A2QN 3CCQV 1GO3F 5L3DA 3ASOB 1LNQA 1WPXA 1I94O 4GX0A 2ILMA 3ZMTA 1Q86W 5IY5C 4UB6Z 2HFEC 4JTDB 4I50B 4LFCO 4HYOA 4B3RO 3HPLC 2P22C 5LL6Y 4I7ZB 4TV8B 3JD3A 1FS0G 4GKKB 1R3LC 1SQPH 2PUSA 4LH7A 2ZDIC 3CX5F 3ZHTA 1SQQH 3RT3C 2DQ3A 4JI1B 1QLNA 2A9HA 2GV9A 1HNXO 1K34A 3TGUH 2RMKB 4X64O 1S3JA 2PYJA 2ZT9B 4FLUA 2ODMA 4UV9A 4DRXA 1XL4A 3B8NA 4N21A 1DLBA 1N36O 4CBCA 1KUQA 1B3QA 1Y4MA 2YUAA 3OT7A 1MOFA 5DN6G 2JDIG 4FM0A 4FFBB 2QKCA 1IXMA 1QQCA 5CBHA 1OCRC 2WWWA 4DYLA 3SYCA 2LGQA 4WFBV 3THOA 5LHGA 2RQ6A 3AEIA 3RWRD 5B3SB 4JI5O 4AQYB 2Q9LA 2ZXWB 1WB8A 1XBLA 5DM6V 5FLXN 3MDSA 4K35A 3K9AA 2X6CA 1Q82W 3UT5B 2RN9A 4UVCA 1EFRG 1NJIW 2Y0IA 2CGNA 1NR1A 2H94A 3CS5A 3BCCH 1ORQC 4NTWA 1YEWA 1OCCB 2RDCA 2Q7GA 1IBLB 3L75H 3OEHG 4O2AB 3UO3A 1YJ9V 4GZRB 1EN4A 4HNAB 1OCCC 4CS3A 3SDLA 4GX5A 4LFAB 5BMVA 3CYOA 2HVKC 5LP6B 1VQNV 2M7WA 2XHBA 3U0ZA 2AGAA 4YJ3A 1FFXB 3VQYA 3AG7A 3OR7C 1MMMA 4DUZB 3K06A 4HAMA 3CSXA 5LP6C 4G2KA 2F95B 4J7ZA 1SKVA 3BY6A 3N2GA 2HHHO 1F4NA 5JJNB 3TXQA 3RYIB 3KKYA 3HB3B 4MVZA 4BW5A 3SJQC 3E22A 4LF4O 2QA4V 1IX9A 2EJRA 3B09A 5FPOA 4PELA 4DR7B 4J7KA 4IHJA 1EN6A 2KQXA 1AR4A 3N2KB 4O4LB 4KL1A 1Y6XA 4DW1A 1VF7A 4DR3B 5IYCO 2P90A 2ZIMA 4E4EA 5IWAB 4B3TO 1SA0B 3APQA 5LGNA 4G28B 2FL4A 3JYCA 3ABTA 1AROP 4PA7A 3EFFK 2DMXA 2FYUH 3WB2A 1JR9A 5B1NA 4QE9A 5B1OA 5KHHA 2IU0A 1Y76B 4WF9V 4U3JB 4NXNB 2L6LA 2IW5A 2ETNA 4UV8A 3SYAA 3ZRSA 3HKDA 4FJCC 3ABLC 2NN4A 3K5NA 1IXBA 1S5HC 1V9PA 2QR4A 1XMQB 1BGYH 1R73A 1JPXA 3LSUA 1D2DA 2KG7B 2EIMB 2Z0AA 2N05A 1YTFD 2YI8A 1VQ9V 3ETDA 2ADQB 4DR4O 4MTGA 2Z3YA 1H2GA 1GRJA 3G67A 2EIKB 5LMUO 1YHQV 3LUTB 3VQWA 3ICXA 4RUFA 4J11A 2O57A 1QR8A 1WAZA 5KHJA 3CJHB 4UCSA 5F2VO 5IJ0A 3FB8C 3ZJZA 3T1YB 3RGBA 2QEXV 1B04A 3EVKA 2QM8A 4D6TH 1H2MA 4FLWA 4H0LB 3CCEV 1VP7A 4J41A 4FIPC 1H8EG 2GUZB 1O9HA 3CMEV 4DV4B 1HDJA 1NU1H 4MTOA 2IBZH 3E89A 2LJ2A 4JAAA 3E8BA 4NXMB 1GN3A 1VQ8V 1WPBA 4DV6O 5IJ9A 2DWDC 3OUSA 2D2CB 4D7SA 3STLC 1XNRB 4W4KA 5EZYB 2R72A 1NT2B 1P49A 1KP3A 4DO2A 4LFBO 1NTMH 2BSKB 1SZTA 1COWG 1K92A 3T4ZA 1F51A 3SJBC 3ABKB 1DTOA 2YC0A 4NVPA 1SZXA 3CMAV 1EZJA 2E76B 3RBZA 1H8HG 2XAQA 5EC2C 2VQFO 3FAVB 4OPHA 1R3JC 2ITDC 1NZ6A 2JS5A 3WB0A 1KYOF 1IVSA 2Q0AA 1AB3A 4QGPA 1VQLV 2PI4A 1B06A 1W59A 4ZOLA 3TJTA 3GWKC 4WBNB 1KQSU 2OTLV 4X1IB 4FPPA 3BPZA 4KUMA 2QTSA 4B3SB 3JALB 2FB5A 4J10A 1BSMA 1YF2A 2EZPA 2ZNJA 3ZEDA 4JZ2A 3QTCA 2EIJB 1NVPD 1GH6A 1US6A 4MVMA 1IDSA 1FJGB 4ICGA 3M7MX 2EIJC 1EN5A 3LDEA 5IYZA 1F23A 4LNUB 3HR0A 4GKKO 3JASB 5FNVA 4Z1MG 1SQGA 4EFEA 4ZI7A 2B9ZA 1N34O 1XL6A 5CB4A 3ZIAG 1IZ3A 5KHKA 2HJDA 4I5SA 4X9QA 1QCEA 2YI9A 1TAEA 1KU9A 2K1EA 5LYJB 4OXSA 3K3WA 4MTFA 5H6QA 4DUYO 4FLVA 1R6TA 1S5LZ 3CD6V 1D5NA 1JMKC 4LF6B 2P4VA 2LFRA 4UVBA 1HW7A 1XDCA 4WFFA 1CEZA 5EIBD 4WFGA 1NH2D 1JCHA 3JATA 2CTPA 3A2FA 3RYFB 2WLJA 4LBEC 2OCHA 2JRIA 1Q6IA 1Q81W 2DW4A 3DGEA 1PP9H 1HNZO 3K57A 5K1XA 4LF9B 5IE9A 3FYEB 1RPRA 1E1QG 2E5LB 1KECA 3OMNB 4LP8A 2AW9A 3QO7A 3Q4HA 2Q5ZA 2CH7B 4I0XA 1RSOB 1IBLO 2JEXA 3UKMA 4DR1O 4YIPA 1Q90D 3JCUZ 3M8AA 4X88A 2ZR2A 1FPOA 2X7RB 3OTFA 4QPKA 4LF5B 4U7NA 2XAJA 3CC2V 2DYSB 3TETA 2XNDG 4MSWC 5EBLC 1ZLZA 3K08A 3A8TA 1VF5B 1MG1A 1TUBA 2WA3A 5CN0A 5GONA 4DUZO 1O9GA 3P3PA 4DV1B 1AJNA 4FLZA 2JGDA 2BE3A 1E1RG 1K3EA 1Q6UA 4XDKA 3F7YC 1K4CC 1SETA 4CH4A 3H1LH 5JH7A 4O4JA 4RQEA 4AHCA 2CTQA 1L0NH 5C93A 4DRXB 5CMUA 4JI7B 1S76D 2WLLA 2PY5A 4YY3B 4UCTA 3ZHRA 1YITV 1YCIA 5BY1A 4JYCA 5EIBC 1R3KC 1GN6A 4UVAA 1OCZC 2GTSA 2MK3A 3CB2A 4JI2B 2CAZC 3RW0A 3WG7B 4IIJA 2LO1A 4YXWG 1TGOA 2QWNB 3ZRWA 1DK1A 4PI0A 4JI4B 1AR5A 3O9OA 3QNEA 4UCRA 2HJFC 4TT3G 3MD0A 1SC5B 1AP6A 1HP8A 4FM1A 1PM9A 2HP8A 4PJ0Z 3VQVA 3AG1B 1QLEB 3BHPA 4NB5A 2A0LA 1VZYA 1K5QA 2ZE8A 1CP9A 4NXNO 5LGTA 1G1XB 4CZZA 4I55A 3FB7C 4JV5B 3T1CA 3DC5A 4XDJA 1Y74A 5J9PC 3ETGA 3FX7A 1AVMA 1YIJV 1XMQO 5JVDA 2KSDA 1PNLA 2WLNA 5BMVB 3P30A 4X65O 4YJ3B 4BW9A 5IY5B 4YHHB 5JQGA 5BZBA 2DE0X 4PHZA 2XT9A 3CCLV 4JYAB 3N2GB 5LHHA 3T1YO 4RAIA 2F43G 2UXBB 3OMAB 5KA6A 1K7DA 5BR8B 3E22B 4DV5B 1BQZA 5JJEB 1GTOA 1KKDA 4NXMO 3SJCC 4IHJB 4UFZA 4OGQB 2K9PA 3J7AU 3BAAA 3OM3B 2YIDA 3H1JH 2YXYA 4TWKA 3STZC 3LDCA 3K79A 3B8MA 2VS0A 2VWKA 5BXZA 3CC7V 3T1HB 4UB8Z 1JFFA 1WA8A 5H9CA 4MTXA 1I7FA 1I0HA 1S5JA 4BIOA 2F4VB 3W7TA 4PA9A 1AJQA 2VWJA 4X1YA 2XAHA 4LF7B 4O2BA 1OCRB 4CC5A 1IBKB 5CBGA 3CCJV 1PNKA 2ARHA 2F66C 3UO2A 1VF6A 1VQOV 4JAVA 5D5QA 2C2AA 3CP1A 4B3SO 1N32B 2YEVA 2QGNA 2ZM6B 1JA8A 2UUCB 4GKJB 1Q8IA 4W4LA 3CXCU 1HNWB 3HKDB 2Y0PA 3JSNA 1UPGA 1JJ2U 1M57C 4LC1A 1WJZA 1FJGO 2IJIA 2QE7G 2P6JA 1PPJH 3SJAC 1BE3H 3JCZA 4R8CA 1Y67A 1S77D 3D3QA 3GB7C 3RFRA 3ZMSA 2W6IG 5IJ0B 1JQ0A 4QPJA 3DTUB 3RVZA 3BA9A 2RJZA 1GM7A 4OX9B 2ADPA 4UUJC 2B5UA 2XASA 5LA6A 3SPHA 5IJ9B 2WAMA 4P30A 4R6ZA 3FD9A 1RFYA 5H6RA 4JI8B 2VQEB 2P7TC 4X66B 2UU9B 4DR5O 4X8AA 3ZHSA 3JARA 1V55C 2IH3C 4MVOA 5LMNO 1MNGA 3OTOB 4ZHQA 3J81N 1LUVA 1QU7A 4RO2A 3SYPA 1K73W 2BCCH 5HFMA 3L74H 4X62B 2ZNIA 1IBMB 4B7EA 2YICA 5LXTA 1XNQO 5H2FZ 3T2MA 4ZOLB 2AZ2A 2A79B 2CK3G 2OWOA 2JK5C 2UXDB 4DV0B 3CEIA 1KMIZ 4B08A 1XHZA 2BOBC 3CRQA 3CE2A 1FFTB 1VQ7V 3AK3A 1XILA 4TUYA 4CH5A 1QR9A 1SS3A 3BVOA 2EJ7A 1P7BA 3ZHVA 4B3MO 1R6NA 1SESA 3ABLB 3MAQA 4DV1O 3NXSA 2GSMB 5IYZB 4FLXA 4FMTA 2CUGA 5FNVB 4KHPB 4ZI7B 1BQ0A 2EBOA 1CPYA 1N0NA 3TXSA 3DXRA 3IFXA 5CB4B 2NLJC 4CS2A 1ZAUA 5DECA 1M56C 4DV2O 1MA1A 4C7UA 1AI6A 3HKCA 4F4LA 1U97A 3EXAA 4LF8O 1UJWB 4K0KB 3VQXA 1N4CA 4JI0O 1SQBH 1OCOC 1W2BU 3W7SA 2GBOA 3JATB 3JAWA 1YI2V 1PL0A 4JI2O 3BEHA 1I5YA 1AP5A 3RYHA 4DK1A 2KB1A 3BABA 2QM4A 3F5WC 4JI4O 3TCUA 3CRAA 1Q3EA 1QVGU 3K58A 2G38A 2QTOA 2OCCB 4DR2B 1FKAO 4B3RB 1VEWA 1DF4A 1MZEA 1W0JG 3L70H 2UUBB 1R1BA 2JJ1G 2UUAO 1KB9F 2OCCC 3Q4HB 3K5LA 1XMOB 3WU2Z 2WLIA 4I0XB 5EYPA 3CCVV 4JV5O 2JEUA 2LP7A 2HLDG 3PN1A 1K97A 3QVNA 3X2QB 2HR3A 3OMIB 4O4HA 1I5XA 3HKEA 4CH3A 5B1AB 3AG4C 3B40A 3E86A 1SF9A 3I5DA 1Y66A 4LWSA 3X2QC 2HG5C 1G8MA 3ZCCA 1OV9A 4YHHO 1N36B 1TUBB 4MW8A 3QO8A 5GONB 5B1AC 5JWPA 1ZWIC 1THZA 3K03A 4MT8A 5IDJA 2JGDB 1YTFB 1GKFA 4JYAO 3OW2U 1KKCA 3SPCA 4FLYA 3SPIA 5JH7B 3IAYA 1TA8A 2UXBO 2QKSA 4O4JB 4JI6B 3ML0A 1FD9A 1AILA 4DV5O 1RPOA 3KCXA 4K3AA 2OTJV 3D36A 1BHAA 4PI2A 4X1KA 3NR7A 4DR6B 2OT5A 1GK9A 4PV1B 2WLLB 2NR5A 4L8JA 4GCZA 2YDEA 1TVKA 2Q73A 1K4DC 4JI1O 3I56V 4J42A 4BIZA 3OFNG 4LR3A 1H2SB 1NR7A 1GMGA 1ZL8A 5LOVA 1Q43A 1XI1A 1EBOA 1Q7YW 4IIJB 2ZCEA 2Q6AA 5KAIZ 3ZRWB 2DWEC 4QIWF 1IBKO 1AJPA 4QE7A 2PZSA 4IT5A 2F1MA 1ROPA 2IH1C 3LSQA 4AILC 5KLVH 5KUKA 3CCMV 3G6BA 1N8RW 1BCCH 2HHHB 4AQYO 2X6BA 2UUCO 4GKJO 4I55B 2DOSA 4G27B 3ZRVA 3BA8A 4CC6A 4LF4B 1Y74B 4D7TA 1Z5VA 2GTAA 3R65A 3MHHC 4U7OA 1SQVH 5EBMC 4J80A 4PDLA 5JVDB 2W0XA 4PA4A 4JF3A 3B77A 2VRZA 3K04A 3JAKA 3I55V 1FXKA 1Z2GA 2GHYA 1NVPB 5JQGB 2LW1A 1YZBA 3F7VC 4B3TB 3G71V 2XTAA 1A32A 3H1HH 2JJ2G 4KXRA 4EKWA 4LFAO 1UFIA 1NTKH 2XAGA 3E2EA 1ZTEA 5LBQA 4OX9O 4MW3A 5GTIZ 2LFSA 2WLHA 5KMGA 2QDOA 4TQDA 1KP2A 1IURA 2AHYA 5L3EA 1K9MW 3FB5C 1WLEA 2Q68A 4H44B 2JVDA 3JD1A 3T4DA 2YIBD 4GT1A 4BR6A 2VQEO 4DV7B 2QJ1A 3C3SA 1WN7A 4XDLA 1VQ5V 1JFFB 1WA8B 3ZMUA 4DR7O 2R70A 4JI3B 2BTQA 3OTOO 3CRCA 1NBMG 2QKAA 1NH2B 1BMFG 1OCZB 4PDRA 4X1YB 2EINC 4I4TA 4O2BB 4DR3O 3OD4A 4DR4B 2Y4TA 4P9OA 3ZRXA 5IWAO 5L3CA 5KX5A 1GM8A 4PD4F 2PTMA 4DV0O 1LUWA 4WFHA 2LW7A 3ETEA 3G80A 2YEVB 1HR0B 3SGIA 1NI8A 1VF6C 3ZX6A 4WCEV 3R66A 4AI8A 2Y4UA 4EB6A 1YXBA 2EILB 5K1PA 2QWPB 2P5OA 2ZIOA 1VQMV 1U96A 4DV6B 1MABG 4RUEA 1WB7A 4O4IA 2EILC 5CA0A 2R9IA 1YVWA 1Q5OA 1YDXA 1SRYA 5FPRA 3P32A 1KC8W 4DV3B 5JCOA 1KBHA 1RM1B 3E83A 2FKXA 1VQ4V 3E8GA 1R3IC 2ZR3A 1V54B 5L3GA 5J2TA 3CWBH 2WLKA 5C8YA 1RM1C 1M1KW 3OE7G 1VQ6V 4DW0A 1V54C 3K9SA 2WA4A 5LA6B 3E8HA 1F4MA 4WFEA 2Q4PA 2XUMA 1JVMA 1H38A 3S3WA 4DV4O 3E8FA 2PYLA 4NTXA 2Q69A 3JARB 1H2KA 3KG2A 5FL7G 4TV9A 4ZHQB 3ZS8C 2AXTZ 3ASOC 4Z2WA 2XOKG 1XNRO 4DR2O 4PDVA 2HKOA 4OPAA 4PA3A 4CS4A 5LXTB 5KA5A 2UUBO 1LR1A 2H8PC 3H1IH 1AR1B 5KAFZ 2ZE5A 1XMOO 3IC7A 5ITZA 4N23A 2XAFA 1N34B 3W7XA 5A9GA 5CA1A 1MSDA 4TUYB 1G6UA 4DUYB 3BRCA 1P4RA 4QNHB 1NS1A 2E3CA 2H3OA 2QWOB 3PJSK 3QO5A 2UXXA 3BFRA 2OYQA 1M57B 2Y69B 4K8ZA 3D8CA 2CDYA 5J2UA 4BWAA 4H13B 4U3FH 5IT9N 2Y69C 1K8AW 4JI6O 3DXRB 2IJKA 3L73H 1HNZB 1ZSPA 4FZ1A 1NKDA 4TOIA 3VOUA 1L0LH 1K5SA 4DR6O 3HKCB 4EEQA 1VMGA
chains in the Genus database with same CATH topology
3SR2C 1HW7A 1XQ8A 1DGSA 5EIBD 4F6RA 4LFBB 3RYFA 1M5IA 1JJOA 3JATA 3RYCA 4EFBA 4F6RB 3A2FA 3RYFB 2UUAB 3JATB 3RYCB 3HKBA 3JAWA 3K5OA 3UQ8A 4DR1B 1X4TA 3HKBB 3JAWB 4FLTA 2VQFB 2BTOA 3RYHA 4DK1A 2YIBA 3BABA 3K57A 2QM4A 3RYHB 3LNNA 4UCUA 1M4UA 5K1XA 1WNSA 1Q3EA 4LF9B 3K58A 1QHTA 3DSQA 4YJ2A 4DR2B 4GLXA 2E5LB 1J5EB 4LH6A 4B3RB 4X20A 1RSOA 4YJ2B 2UUBB 4Q6GA 4X20B 3K5LA 1XMOB 5EYPA 3K59A 5EYPB 3PN1A 4I50A 3OTFA 4LF5B 4O4HA 4I50B 3HKEA 4CH3A 4O4HB 3HKEB 1TUBA 4TV8A 5GONA 1O9GA 4DV1B 2P22C 1T5EA 1N36B 1TUBB 4TV8B 2YIAA 4FLZA 5GONB 4GKKB 2PUSA 4LH7A 1N33B 4CH4A 5JH7A 4O4JA 4FLYA 4JI1B 5JH7B 3IAYA 1TA8A 2GV9A 4O4JB 4AHCA 4JI6B 2PYJA 2Q7HA 3U10A 4FLUA 4PI2A 2UXCB 4DRXA 4X1KA 4DR6B 4DRXB 4JI7B 2YXLA 4X1KB 2PY5A 4YY3B 4UCTA 4FFBA 3K5MA 4L8JA 4FM0A 5EIBC 1TVKA 4FFBB 1QQCA 1TVKB 3CB2A 4JI2B 4LR3A 2CAZC 1H2SB 3THOA 1VQ0A 5LOVA 2RQ6A 4IIJA 3RWRD 1TGOA 1Q43A 4AQYB 1XI1A 5LOVB 4PI0A 4IIJB 2ZCEA 3UT5A 4JI4B 4UCRA 3UT5B 4FM1A 2PZSA 3VQVA 4UCOA 2F1MA 4X65B 2Q7EA 3BHPA 4O2AA 1YEWA 2Q7GA 4AILC 1IBLB 1VZYA 1I94B 4O2AB 2HHHB 4HNAA 4I55A 4JV5B 4HNAB 4I55B 4CS3A 5LP6A 3BA8A 4CC6A 4LF4B 4D7TA 4LFAB 1Z5VA 5BMVA 5LP6B 5JVDA 1FFXA 4LFCB 2XHBA 3U0ZA 4YJ3A 4FM2A 5BMVB 5JJJB 5JVDB 1FFXB 3VQYA 4DUZB 4YJ3B 4BW9A 4YHHB 3CSXA 3JAKA 5LP6C 3U11A 2F95B 5JQGA 4I9QA 3RYIA 1SKVA 3JAKB 5KHIA 3N2GA 4PHZA 5JQGB 5JJNB 3RYIB 4JYAB 3N2GB 4B3TB 2UXBB 3E22A 1HNXB 5BR8B 4X64B 3E22B 4DV5B 3N2KA 5FPOA 2HEPA 4DR7B 4O4LA 5JJEB 4IHJA 3QF7A 3N2KB 4O4LB 3SJCC 4IHJB 4UFZA 5KMGA 4KL1A 4TQDA 3BAAA 1VF7A 2PGGA 5KMGB 1SA0A 4DR3B 2ZIMA 5IWAB 1SA0B 2JVDA 2VWKA 2YIBD 3T1HB 1JFFA 4DV7B 1L8DA 2QJ1A 1I7FA 1WN7A 1S5JA 4ZIBA 1JFFB 2F4VB 2R70A 4JI5B 2F93B 4JI3B 2BTQA 2JGUA 2VWJA 2BTQB 4X1YA 4LF7B 1XHXA 4O2BA 4CH6A 3WB2A 4X1YB 4CC5A 1IBKB 4I4TA 4O2BB 4DK0A 4DR4B 4I4TB 4U3JA 5KHHA 2F66C 5KX5A 5D5QA 2PTMA 4U3JB 4NXNB 2ZINA 5KX5B 1N32B 2ZM6B 1Z5WA 2UUCB 4GKJB 3HKDA 1Q8IA 3WB1A 1HR0B 3SGIA 3K5NA 1M93A 1HNWB 3HKDB 1V9PA 1XMQB 3JSNA 1D5AA 3B2EE 4EB6A 2YI8A 5K1PA 3ETQA 2P5OA 2ZIOA 4EB6B 3SJAC 4DV6B 3VQWA 3ICXA 4O4IA 5CA0A 1Q5OA 5FPRA 5KHJA 4DV3B 4UCSA 4O4IB 5JCOA 5KHGA 5CA0B 5IJ0A 3T1YB 3RGBA 3RFRA 1B04A 3QG5A 5IJ0B 4FLWA 4DR5B 1O9HA 5J2TA 4DV4B 5C8YA 3BA9A 5J2TB 2RJZA 5JCOC 4FVMA 5LMNB 5C8YB 4NXMB 4OX9B 1WPBA 5LA6A 4TQFA 5IJ9A 4D7SA 3CHXA 5LA6B 5EZYA 5IJ9B 1SQFA 1XNRB 5EZYB 4JI8B 2R72A 1XNQB 1NT2B 1P49A 2EX3A 2VQEB 4X66B 4GYCB 2UU9B 3SJBC 3JARA 2KKWA 4NVPA 2PYLA 3OTOB 3JARB 3FFQA 4ZHQA 4UCVA 2JS5A 4TV9A 3ZS8C 4ZHQB 3WB0A 2Q0AA 4TV9B 4X62B 2ZNIA 1IBMB 4WBNA 4ZOLA 4X1IA 5LXTA 4B3MB 3JALA 4WBNB 4ZOLB 4X1IB 4CS4A 3BPZA 5LXTB 2OWOA 4B3SB 3JALB 2UXDB 4DV0B 2R9AA 1KMIZ 4B08A 1XHZA 2ZNJA 3ZEDA 5ITZA 3QTCA 5ITZB 1N34B 5D5PA 4TUYA 4CH5A 1FJGB 5CA1A 3M7MX 5LMUB 4TUYB 1G6UA 4DV2B 4K8XA 4DUYB 3BRCA 5CA1B 4LNUA 3MAQA 5IYZA 2E3CA 3JASA 4LF8B 4LNUB 5IYZB 4FLXA 3JASB 5FNVA 4JI0B 2OYQA 2V4DA 1SQGA 4EFEA 4ZI7A 4K8ZA 5FNVB 2IM9A 4KHPB 4ZI7B 5CB4A 5J2UA 5LYJA 5KHKA 4BWAA 5CB4B 2YI9A 1TAEA 5J2UB 4CS2A 3JSLA 1ZAUA 1KU9A 5LYJB 4HBNA 1HNZB 4FLVA 4TOIA 3HKCA 1JMKC 4LF6B 3HKCB 4EEQA 4K0KB 3VQXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VZY A;  1HW7 A;  1VQ0 A;  3M7M X;  1I7F A; 
#chains in the Genus database with same CATH topology
 2BOC C;  1XQ8 A;  5B3S C;  2ZXW C;  4F6R A;  4KP4 A;  1M5I A;  4TSF G;  4Z1V A;  1ENV A;  3RYC A;  3B4S A;  2NNU A;  5CA3 A;  3HKB A;  5IYB O;  5IYD O;  3UQ8 A;  1K33 A;  4DR1 B;  2JIZ G;  3JAW B;  1GN4 A;  4FLT A;  2BTO A;  5B66 Z;  1KD1 W;  2Q0O C;  2QSA A;  2YIB A;  3RYH B;  4UCU A;  3M99 B;  4LF6 O;  1S0V A;  2LQT A;  1WNS A;  1V55 B;  3DSQ A;  4YJ2 A;  2UXN A;  1J5E B;  4LH6 A;  5TIS Z;  1BZK A;  4X20 A;  3GVM A;  4A5U B;  4Q6G A;  1BHB A;  2OIE A;  1X59 A;  2IJH A;  4ZKI A;  3K59 A;  2OIG A;  3APO A;  3A0H Z;  2WLI B;  1YJW V;  4LCU C;  5EYP B;  4I50 A;  3ZMZ A;  4R50 A;  3LSS A;  1PL4 A;  4LF9 O;  1Q6H A;  4O4H B;  1G4Y B;  2ZDI A;  2E5L O;  3HKE B;  5B1B B;  4TV8 A;  1S72 V;  1T5E A;  4LWS B;  2YIA A;  2PI5 A;  4FK5 C;  5B1B C;  5LHI A;  3D3I A;  2X6A A;  1N33 B;  1E79 G;  2FML A;  3IC9 A;  3DC6 A;  4LF5 O;  4GX2 A;  1AI4 A;  3CCU V;  1M9N A;  2Q7H A;  3U10 A;  2YS8 A;  1J95 A;  2UXC B;  5HFL A;  2YXL A;  4X1K B;  3H01 A;  1GAX A;  5LGU A;  3FB6 C;  1TUE B;  5E79 Z;  4FFB A;  3K5M A;  4H37 A;  3D36 C;  3KZI Z;  1M56 B;  1P84 F;  1JOY A;  4NYK A;  1AI5 A;  2QWR B;  2CTR A;  1TVK B;  5H5N A;  4MVR A;  3G4S V;  4DV7 O;  4FZ0 A;  1VQ0 A;  1PD3 A;  1NQT A;  2A7W A;  1B6Q A;  4JI3 O;  3L71 H;  1ZL8 B;  1OCO B;  5LOV B;  3UT5 A;  4L87 A;  3F5T A;  4JI7 O;  3AK1 A;  3ZN1 A;  4YY3 O;  3ZHQ A;  3J80 N;  4UCO A;  1PKX A;  2P06 A;  2P67 A;  2B1G A;  2ZQM A;  4X65 B;  2Q7E A;  4O2A A;  3AG3 B;  4MVU A;  3IJ4 A;  3CPW U;  2ZE6 A;  2EIM C;  1I94 B;  3A0B Z;  2QWQ B;  1VAR A;  4HNA A;  1W0K G;  4R7C A;  2D3O W;  2EIK C;  3AG3 C;  1FXV A;  5LP6 A;  2ZE7 A;  1HR0 O;  5GW7 A;  1WP7 A;  2N04 A;  1FFX A;  2AZ0 A;  2RNB A;  4LFC B;  2LGW A;  2WPD G;  4FM2 A;  5JJJ B;  2E75 B;  2W6J G;  5EBW C;  4JGS A;  4YIO A;  3U11 A;  3E35 A;  4I9Q A;  2YSU B;  3MHS C;  4J9Z B;  3RYI A;  3JAK B;  4ASU G;  5KHI A;  1RP3 B;  4P9P A;  4DV3 O;  4QJF B;  1FXK B;  3AG4 B;  3VBB A;  3AG2 B;  1H2N A;  3JD4 A;  4ZBM A;  3JAM N;  1BS3 A;  4BIU A;  1HNX B;  3ABM B;  4JYY A;  1FXK C;  4X64 B;  3ZBH A;  3W7W A;  5L3B A;  3AG2 C;  3N2K A;  1MZF A;  2ATK C;  2HEP A;  2L35 A;  4O4L A;  1BL8 A;  3QF7 A;  4H33 A;  3OAA G;  4JTC B;  3ABM C;  1PNM A;  3ABK C;  1WP8 A;  4MVQ A;  1GM9 A;  2PF4 E;  4RQF A;  2PGG A;  5KMG B;  1SA0 A;  4WFA V;  4DXW A;  1PV0 A;  3RVY A;  5L3F A;  2EUL A;  3CCS V;  1MSW D;  2GDS A;  5BR8 O;  1L8D A;  3ABU A;  4MS2 A;  2YXH A;  3K0G A;  4ZIB A;  4JI5 B;  2F93 B;  2FTK A;  2E74 B;  1N0J A;  1VIB A;  2JGU A;  3WFV A;  2BTQ B;  3FKS G;  1XHX A;  3G6E V;  4CH6 A;  3GWO A;  1OJH A;  4JAS A;  1YJN V;  4DK0 A;  1Y76 A;  3H1K H;  4I4T B;  4U3J A;  3KCY A;  4KFM A;  3TK1 A;  3T1H O;  2ZIN A;  2JS3 A;  5KX5 B;  4PA6 A;  2F4V O;  1Z5W A;  4JZG A;  5E1A C;  4IYI A;  4GUN A;  3WB1 A;  1OHH G;  5DED A;  2KG7 A;  1M93 A;  2F23 A;  4LF7 O;  2R9R B;  3OGC C;  1F7Y A;  3RN4 A;  2RCV A;  1D5A A;  3B2E E;  4IYH A;  1QBZ A;  3L72 H;  5AG2 A;  3ETQ A;  2M6Y A;  4EB6 B;  3OR6 C;  4MVS A;  3CJH A;  1VQP V;  2A06 H;  2Q67 A;  3ASN B;  2ITC C;  2CE4 A;  1N32 O;  1M90 W;  2ZM6 O;  4O4I B;  5KUM A;  5KHG A;  5CA0 B;  2DYR B;  2GUZ A;  3QG5 A;  3ZHU A;  3ASN C;  1HNW O;  2ZD9 A;  4DR5 B;  5GTH Z;  3ZN0 A;  1BT8 A;  2DYR C;  3JD2 A;  5J2T B;  5JCO C;  3EHB B;  4FVM A;  5LMN B;  4JAU A;  5C8Y B;  3UCS C;  1XEQ A;  1R6K A;  2DJV A;  4TQF A;  3C90 A;  2X0L A;  2IJJ A;  3CHX A;  5EZY A;  3S3X A;  1SQF A;  2Y48 A;  2BSK A;  1CXZ B;  2V7Q G;  4JTA B;  1XNQ B;  1SQX H;  2EX3 A;  3CCR V;  1NTZ H;  4GYC B;  4NKG B;  2DN9 A;  5B5E Z;  1HWY A;  1URF A;  1ZUQ A;  4JPR A;  4RWU A;  4X89 A;  1FAF A;  2KKW A;  1ZX3 A;  2QM7 A;  3FAV A;  3FFQ A;  1H2L A;  2W0F C;  4HZ3 A;  4UCV A;  1EM1 A;  4TV9 B;  4WBN A;  3OUF A;  4X1I A;  4B3M B;  4XBF A;  4GX1 A;  4JI8 O;  3CXH F;  3JAL A;  1JX9 A;  3ZMV A;  4F6E A;  1J5E O;  4X66 O;  3W7U A;  2UU9 O;  2MW2 B;  2DYS C;  1XUQ A;  2R9A A;  4FFK A;  3OEE G;  3LNM B;  2EIN B;  3FYI B;  1AI7 A;  3H9V A;  1QVF U;  3N27 A;  3OGI B;  2B1I A;  2N74 A;  5ITZ B;  2CTW A;  1GN2 A;  1P7G A;  5D5P A;  3K0D A;  3IGA C;  3O65 A;  4X62 O;  5EC1 C;  2IU3 A;  1IBM O;  2WSS G;  4I9W A;  5LMU B;  4DV2 B;  1EZV H;  4K8X A;  5CA1 B;  3SYO A;  4LNU A;  3SPJ A;  1FXH A;  2DQ0 A;  2UXD O;  3JAS A;  4LF8 B;  3AK2 A;  4ABM A;  4JI0 B;  2V4D A;  2Q8V A;  1L1F A;  1N33 O;  2IM9 A;  3CRM A;  5LYJ A;  3CRR A;  3SPG A;  4BAY A;  5CBF A;  1YSC A;  3JSL A;  4J7J A;  5J2U B;  4HBN A;  1SER A;  2Z5U A;  4J9Y B;  1OZ0 A;  4Q20 A;  2UXC O;  3SYQ A;  4JYB A;  4NR1 A;  2P4K A;  2AHZ A;  3JD0 A;  3P3N A;  3WG7 C;  1XRE A;  3L9D A;  3LDD A;  3SR2 C;  1DGS A;  2WLM A;  1QNM A;  4LFB B;  3RYF A;  1JJO A;  4PDM A;  2ZKO A;  4EFB A;  4KHP O;  4NTY A;  4F6R B;  2UUA B;  3RYC B;  3K5O A;  5EK0 A;  3C3T A;  3AG1 C;  4P2Z A;  1QLE C;  1X4T A;  3CC4 V;  2A3Q A;  2HVJ C;  3HKB B;  2VQF B;  1XOU A;  2CGO A;  3LNN A;  4IL6 Z;  1VQK V;  1M4U A;  1DF5 A;  4K0K O;  2V1D A;  4E2L A;  1QHT A;  4UXN A;  3UM7 A;  4GLX A;  1I08 A;  4IGG A;  3A0R A;  2CH7 A;  1RSO A;  2EZO A;  1FYJ A;  4YJ2 B;  4B7K A;  4X20 B;  5A2Q N;  3CCQ V;  1GO3 F;  5L3D A;  3ASO B;  1LNQ A;  1WPX A;  1I94 O;  4GX0 A;  2ILM A;  3ZMT A;  1Q86 W;  5IY5 C;  4UB6 Z;  2HFE C;  4JTD B;  4I50 B;  4LFC O;  4HYO A;  4B3R O;  3HPL C;  2P22 C;  5LL6 Y;  4I7Z B;  4TV8 B;  3JD3 A;  1FS0 G;  4GKK B;  1R3L C;  1SQP H;  2PUS A;  4LH7 A;  2ZDI C;  3CX5 F;  3ZHT A;  1SQQ H;  3RT3 C;  2DQ3 A;  4JI1 B;  1QLN A;  2A9H A;  2GV9 A;  1HNX O;  1K34 A;  3TGU H;  2RMK B;  4X64 O;  1S3J A;  2PYJ A;  2ZT9 B;  4FLU A;  2ODM A;  4UV9 A;  4DRX A;  1XL4 A;  3B8N A;  4N21 A;  1DLB A;  1N36 O;  4CBC A;  1KUQ A;  1B3Q A;  1Y4M A;  2YUA A;  3OT7 A;  1MOF A;  5DN6 G;  2JDI G;  4FM0 A;  4FFB B;  2QKC A;  1IXM A;  1QQC A;  5CBH A;  1OCR C;  2WWW A;  4DYL A;  3SYC A;  2LGQ A;  4WFB V;  3THO A;  5LHG A;  2RQ6 A;  3AEI A;  3RWR D;  5B3S B;  4JI5 O;  4AQY B;  2Q9L A;  2ZXW B;  1WB8 A;  1XBL A;  5DM6 V;  5FLX N;  3MDS A;  4K35 A;  3K9A A;  2X6C A;  1Q82 W;  3UT5 B;  2RN9 A;  4UVC A;  1EFR G;  1NJI W;  2Y0I A;  2CGN A;  1NR1 A;  2H94 A;  3CS5 A;  3BCC H;  1ORQ C;  4NTW A;  1YEW A;  1OCC B;  2RDC A;  2Q7G A;  1IBL B;  3L75 H;  3OEH G;  4O2A B;  3UO3 A;  1YJ9 V;  4GZR B;  1EN4 A;  4HNA B;  1OCC C;  4CS3 A;  3SDL A;  4GX5 A;  4LFA B;  5BMV A;  3CYO A;  2HVK C;  5LP6 B;  1VQN V;  2M7W A;  2XHB A;  3U0Z A;  2AGA A;  4YJ3 A;  1FFX B;  3VQY A;  3AG7 A;  3OR7 C;  1MMM A;  4DUZ B;  3K06 A;  4HAM A;  3CSX A;  5LP6 C;  4G2K A;  2F95 B;  4J7Z A;  1SKV A;  3BY6 A;  3N2G A;  2HHH O;  1F4N A;  5JJN B;  3TXQ A;  3RYI B;  3KKY A;  3HB3 B;  4MVZ A;  4BW5 A;  3SJQ C;  3E22 A;  4LF4 O;  2QA4 V;  1IX9 A;  2EJR A;  3B09 A;  5FPO A;  4PEL A;  4DR7 B;  4J7K A;  4IHJ A;  1EN6 A;  2KQX A;  1AR4 A;  3N2K B;  4O4L B;  4KL1 A;  1Y6X A;  4DW1 A;  1VF7 A;  4DR3 B;  5IYC O;  2P90 A;  2ZIM A;  4E4E A;  5IWA B;  4B3T O;  1SA0 B;  3APQ A;  5LGN A;  4G28 B;  2FL4 A;  3JYC A;  3ABT A;  1ARO P;  4PA7 A;  3EFF K;  2DMX A;  2FYU H;  3WB2 A;  1JR9 A;  5B1N A;  4QE9 A;  5B1O A;  5KHH A;  2IU0 A;  1Y76 B;  4WF9 V;  4U3J B;  4NXN B;  2L6L A;  2IW5 A;  2ETN A;  4UV8 A;  3SYA A;  3ZRS A;  3HKD A;  4FJC C;  3ABL C;  2NN4 A;  3K5N A;  1IXB A;  1S5H C;  1V9P A;  2QR4 A;  1XMQ B;  1BGY H;  1R73 A;  1JPX A;  3LSU A;  1D2D A;  2KG7 B;  2EIM B;  2Z0A A;  2N05 A;  1YTF D;  2YI8 A;  1VQ9 V;  3ETD A;  2ADQ B;  4DR4 O;  4MTG A;  2Z3Y A;  1H2G A;  1GRJ A;  3G67 A;  2EIK B;  5LMU O;  1YHQ V;  3LUT B;  3VQW A;  3ICX A;  4RUF A;  4J11 A;  2O57 A;  1QR8 A;  1WAZ A;  5KHJ A;  3CJH B;  4UCS A;  5F2V O;  5IJ0 A;  3FB8 C;  3ZJZ A;  3T1Y B;  3RGB A;  2QEX V;  1B04 A;  3EVK A;  2QM8 A;  4D6T H;  1H2M A;  4FLW A;  4H0L B;  3CCE V;  1VP7 A;  4J41 A;  4FIP C;  1H8E G;  2GUZ B;  1O9H A;  3CME V;  4DV4 B;  1HDJ A;  1NU1 H;  4MTO A;  2IBZ H;  3E89 A;  2LJ2 A;  4JAA A;  3E8B A;  4NXM B;  1GN3 A;  1VQ8 V;  1WPB A;  4DV6 O;  5IJ9 A;  2DWD C;  3OUS A;  2D2C B;  4D7S A;  3STL C;  1XNR B;  4W4K A;  5EZY B;  2R72 A;  1NT2 B;  1P49 A;  1KP3 A;  4DO2 A;  4LFB O;  1NTM H;  2BSK B;  1SZT A;  1COW G;  1K92 A;  3T4Z A;  1F51 A;  3SJB C;  3ABK B;  1DTO A;  2YC0 A;  4NVP A;  1SZX A;  3CMA V;  1EZJ A;  2E76 B;  3RBZ A;  1H8H G;  2XAQ A;  5EC2 C;  2VQF O;  3FAV B;  4OPH A;  1R3J C;  2ITD C;  1NZ6 A;  2JS5 A;  3WB0 A;  1KYO F;  1IVS A;  2Q0A A;  1AB3 A;  4QGP A;  1VQL V;  2PI4 A;  1B06 A;  1W59 A;  4ZOL A;  3TJT A;  3GWK C;  4WBN B;  1KQS U;  2OTL V;  4X1I B;  4FPP A;  3BPZ A;  4KUM A;  2QTS A;  4B3S B;  3JAL B;  2FB5 A;  4J10 A;  1BSM A;  1YF2 A;  2EZP A;  2ZNJ A;  3ZED A;  4JZ2 A;  3QTC A;  2EIJ B;  1NVP D;  1GH6 A;  1US6 A;  4MVM A;  1IDS A;  1FJG B;  4ICG A;  3M7M X;  2EIJ C;  1EN5 A;  3LDE A;  5IYZ A;  1F23 A;  4LNU B;  3HR0 A;  4GKK O;  3JAS B;  5FNV A;  4Z1M G;  1SQG A;  4EFE A;  4ZI7 A;  2B9Z A;  1N34 O;  1XL6 A;  5CB4 A;  3ZIA G;  1IZ3 A;  5KHK A;  2HJD A;  4I5S A;  4X9Q A;  1QCE A;  2YI9 A;  1TAE A;  1KU9 A;  2K1E A;  5LYJ B;  4OXS A;  3K3W A;  4MTF A;  5H6Q A;  4DUY O;  4FLV A;  1R6T A;  1S5L Z;  3CD6 V;  1D5N A;  1JMK C;  4LF6 B;  2P4V A;  2LFR A;  4UVB A;  1HW7 A;  1XDC A;  4WFF A;  1CEZ A;  5EIB D;  4WFG A;  1NH2 D;  1JCH A;  3JAT A;  2CTP A;  3A2F A;  3RYF B;  2WLJ A;  4LBE C;  2OCH A;  2JRI A;  1Q6I A;  1Q81 W;  2DW4 A;  3DGE A;  1PP9 H;  1HNZ O;  3K57 A;  5K1X A;  4LF9 B;  5IE9 A;  3FYE B;  1RPR A;  1E1Q G;  2E5L B;  1KEC A;  3OMN B;  4LP8 A;  2AW9 A;  3QO7 A;  3Q4H A;  2Q5Z A;  2CH7 B;  4I0X A;  1RSO B;  1IBL O;  2JEX A;  3UKM A;  4DR1 O;  4YIP A;  1Q90 D;  3JCU Z;  3M8A A;  4X88 A;  2ZR2 A;  1FPO A;  2X7R B;  3OTF A;  4QPK A;  4LF5 B;  4U7N A;  2XAJ A;  3CC2 V;  2DYS B;  3TET A;  2XND G;  4MSW C;  5EBL C;  1ZLZ A;  3K08 A;  3A8T A;  1VF5 B;  1MG1 A;  1TUB A;  2WA3 A;  5CN0 A;  5GON A;  4DUZ O;  1O9G A;  3P3P A;  4DV1 B;  1AJN A;  4FLZ A;  2JGD A;  2BE3 A;  1E1R G;  1K3E A;  1Q6U A;  4XDK A;  3F7Y C;  1K4C C;  1SET A;  4CH4 A;  3H1L H;  5JH7 A;  4O4J A;  4RQE A;  4AHC A;  2CTQ A;  1L0N H;  5C93 A;  4DRX B;  5CMU A;  4JI7 B;  1S76 D;  2WLL A;  2PY5 A;  4YY3 B;  4UCT A;  3ZHR A;  1YIT V;  1YCI A;  5BY1 A;  4JYC A;  5EIB C;  1R3K C;  1GN6 A;  4UVA A;  1OCZ C;  2GTS A;  2MK3 A;  3CB2 A;  4JI2 B;  2CAZ C;  3RW0 A;  3WG7 B;  4IIJ A;  2LO1 A;  4YXW G;  1TGO A;  2QWN B;  3ZRW A;  1DK1 A;  4PI0 A;  4JI4 B;  1AR5 A;  3O9O A;  3QNE A;  4UCR A;  2HJF C;  4TT3 G;  3MD0 A;  1SC5 B;  1AP6 A;  1HP8 A;  4FM1 A;  1PM9 A;  2HP8 A;  4PJ0 Z;  3VQV A;  3AG1 B;  1QLE B;  3BHP A;  4NB5 A;  2A0L A;  1VZY A;  1K5Q A;  2ZE8 A;  1CP9 A;  4NXN O;  5LGT A;  1G1X B;  4CZZ A;  4I55 A;  3FB7 C;  4JV5 B;  3T1C A;  3DC5 A;  4XDJ A;  1Y74 A;  5J9P C;  3ETG A;  3FX7 A;  1AVM A;  1YIJ V;  1XMQ O;  5JVD A;  2KSD A;  1PNL A;  2WLN A;  5BMV B;  3P30 A;  4X65 O;  4YJ3 B;  4BW9 A;  5IY5 B;  4YHH B;  5JQG A;  5BZB A;  2DE0 X;  4PHZ A;  2XT9 A;  3CCL V;  4JYA B;  3N2G B;  5LHH A;  3T1Y O;  4RAI A;  2F43 G;  2UXB B;  3OMA B;  5KA6 A;  1K7D A;  5BR8 B;  3E22 B;  4DV5 B;  1BQZ A;  5JJE B;  1GTO A;  1KKD A;  4NXM O;  3SJC C;  4IHJ B;  4UFZ A;  4OGQ B;  2K9P A;  3J7A U;  3BAA A;  3OM3 B;  2YID A;  3H1J H;  2YXY A;  4TWK A;  3STZ C;  3LDC A;  3K79 A;  3B8M A;  2VS0 A;  2VWK A;  5BXZ A;  3CC7 V;  3T1H B;  4UB8 Z;  1JFF A;  1WA8 A;  5H9C A;  4MTX A;  1I7F A;  1I0H A;  1S5J A;  4BIO A;  2F4V B;  3W7T A;  4PA9 A;  1AJQ A;  2VWJ A;  4X1Y A;  2XAH A;  4LF7 B;  4O2B A;  1OCR B;  4CC5 A;  1IBK B;  5CBG A;  3CCJ V;  1PNK A;  2ARH A;  2F66 C;  3UO2 A;  1VF6 A;  1VQO V;  4JAV A;  5D5Q A;  2C2A A;  3CP1 A;  4B3S O;  1N32 B;  2YEV A;  2QGN A;  2ZM6 B;  1JA8 A;  2UUC B;  4GKJ B;  1Q8I A;  4W4L A;  3CXC U;  1HNW B;  3HKD B;  2Y0P A;  3JSN A;  1UPG A;  1JJ2 U;  1M57 C;  4LC1 A;  1WJZ A;  1FJG O;  2IJI A;  2QE7 G;  2P6J A;  1PPJ H;  3SJA C;  1BE3 H;  3JCZ A;  4R8C A;  1Y67 A;  1S77 D;  3D3Q A;  3GB7 C;  3RFR A;  3ZMS A;  2W6I G;  5IJ0 B;  1JQ0 A;  4QPJ A;  3DTU B;  3RVZ A;  3BA9 A;  2RJZ A;  1GM7 A;  4OX9 B;  2ADP A;  4UUJ C;  2B5U A;  2XAS A;  5LA6 A;  3SPH A;  5IJ9 B;  2WAM A;  4P30 A;  4R6Z A;  3FD9 A;  1RFY A;  5H6R A;  4JI8 B;  2VQE B;  2P7T C;  4X66 B;  2UU9 B;  4DR5 O;  4X8A A;  3ZHS A;  3JAR A;  1V55 C;  2IH3 C;  4MVO A;  5LMN O;  1MNG A;  3OTO B;  4ZHQ A;  3J81 N;  1LUV A;  1QU7 A;  4RO2 A;  3SYP A;  1K73 W;  2BCC H;  5HFM A;  3L74 H;  4X62 B;  2ZNI A;  1IBM B;  4B7E A;  2YIC A;  5LXT A;  1XNQ O;  5H2F Z;  3T2M A;  4ZOL B;  2AZ2 A;  2A79 B;  2CK3 G;  2OWO A;  2JK5 C;  2UXD B;  4DV0 B;  3CEI A;  1KMI Z;  4B08 A;  1XHZ A;  2BOB C;  3CRQ A;  3CE2 A;  1FFT B;  1VQ7 V;  3AK3 A;  1XIL A;  4TUY A;  4CH5 A;  1QR9 A;  1SS3 A;  3BVO A;  2EJ7 A;  1P7B A;  3ZHV A;  4B3M O;  1R6N A;  1SES A;  3ABL B;  3MAQ A;  4DV1 O;  3NXS A;  2GSM B;  5IYZ B;  4FLX A;  4FMT A;  2CUG A;  5FNV B;  4KHP B;  4ZI7 B;  1BQ0 A;  2EBO A;  1CPY A;  1N0N A;  3TXS A;  3DXR A;  3IFX A;  5CB4 B;  2NLJ C;  4CS2 A;  1ZAU A;  5DEC A;  1M56 C;  4DV2 O;  1MA1 A;  4C7U A;  1AI6 A;  3HKC A;  4F4L A;  1U97 A;  3EXA A;  4LF8 O;  1UJW B;  4K0K B;  3VQX A;  1N4C A;  4JI0 O;  1SQB H;  1OCO C;  1W2B U;  3W7S A;  2GBO A;  3JAT B;  3JAW A;  1YI2 V;  1PL0 A;  4JI2 O;  3BEH A;  1I5Y A;  1AP5 A;  3RYH A;  4DK1 A;  2KB1 A;  3BAB A;  2QM4 A;  3F5W C;  4JI4 O;  3TCU A;  3CRA A;  1Q3E A;  1QVG U;  3K58 A;  2G38 A;  2QTO A;  2OCC B;  4DR2 B;  1FKA O;  4B3R B;  1VEW A;  1DF4 A;  1MZE A;  1W0J G;  3L70 H;  2UUB B;  1R1B A;  2JJ1 G;  2UUA O;  1KB9 F;  2OCC C;  3Q4H B;  3K5L A;  1XMO B;  3WU2 Z;  2WLI A;  4I0X B;  5EYP A;  3CCV V;  4JV5 O;  2JEU A;  2LP7 A;  2HLD G;  3PN1 A;  1K97 A;  3QVN A;  3X2Q B;  2HR3 A;  3OMI B;  4O4H A;  1I5X A;  3HKE A;  4CH3 A;  5B1A B;  3AG4 C;  3B40 A;  3E86 A;  1SF9 A;  3I5D A;  1Y66 A;  4LWS A;  3X2Q C;  2HG5 C;  1G8M A;  3ZCC A;  1OV9 A;  4YHH O;  1N36 B;  1TUB B;  4MW8 A;  3QO8 A;  5GON B;  5B1A C;  5JWP A;  1ZWI C;  1THZ A;  3K03 A;  4MT8 A;  5IDJ A;  2JGD B;  1YTF B;  1GKF A;  4JYA O;  3OW2 U;  1KKC A;  3SPC A;  4FLY A;  3SPI A;  5JH7 B;  3IAY A;  1TA8 A;  2UXB O;  2QKS A;  4O4J B;  4JI6 B;  3ML0 A;  1FD9 A;  1AIL A;  4DV5 O;  1RPO A;  3KCX A;  4K3A A;  2OTJ V;  3D36 A;  1BHA A;  4PI2 A;  4X1K A;  3NR7 A;  4DR6 B;  2OT5 A;  1GK9 A;  4PV1 B;  2WLL B;  2NR5 A;  4L8J A;  4GCZ A;  2YDE A;  1TVK A;  2Q73 A;  1K4D C;  4JI1 O;  3I56 V;  4J42 A;  4BIZ A;  3OFN G;  4LR3 A;  1H2S B;  1NR7 A;  1GMG A;  1ZL8 A;  5LOV A;  1Q43 A;  1XI1 A;  1EBO A;  1Q7Y W;  4IIJ B;  2ZCE A;  2Q6A A;  5KAI Z;  3ZRW B;  2DWE C;  4QIW F;  1IBK O;  1AJP A;  4QE7 A;  2PZS A;  4IT5 A;  2F1M A;  1ROP A;  2IH1 C;  3LSQ A;  4AIL C;  5KLV H;  5KUK A;  3CCM V;  3G6B A;  1N8R W;  1BCC H;  2HHH B;  4AQY O;  2X6B A;  2UUC O;  4GKJ O;  4I55 B;  2DOS A;  4G27 B;  3ZRV A;  3BA8 A;  4CC6 A;  4LF4 B;  1Y74 B;  4D7T A;  1Z5V A;  2GTA A;  3R65 A;  3MHH C;  4U7O A;  1SQV H;  5EBM C;  4J80 A;  4PDL A;  5JVD B;  2W0X A;  4PA4 A;  4JF3 A;  3B77 A;  2VRZ A;  3K04 A;  3JAK A;  3I55 V;  1FXK A;  1Z2G A;  2GHY A;  1NVP B;  5JQG B;  2LW1 A;  1YZB A;  3F7V C;  4B3T B;  3G71 V;  2XTA A;  1A32 A;  3H1H H;  2JJ2 G;  4KXR A;  4EKW A;  4LFA O;  1UFI A;  1NTK H;  2XAG A;  3E2E A;  1ZTE A;  5LBQ A;  4OX9 O;  4MW3 A;  5GTI Z;  2LFS A;  2WLH A;  5KMG A;  2QDO A;  4TQD A;  1KP2 A;  1IUR A;  2AHY A;  5L3E A;  1K9M W;  3FB5 C;  1WLE A;  2Q68 A;  4H44 B;  2JVD A;  3JD1 A;  3T4D A;  2YIB D;  4GT1 A;  4BR6 A;  2VQE O;  4DV7 B;  2QJ1 A;  3C3S A;  1WN7 A;  4XDL A;  1VQ5 V;  1JFF B;  1WA8 B;  3ZMU A;  4DR7 O;  2R70 A;  4JI3 B;  2BTQ A;  3OTO O;  3CRC A;  1NBM G;  2QKA A;  1NH2 B;  1BMF G;  1OCZ B;  4PDR A;  4X1Y B;  2EIN C;  4I4T A;  4O2B B;  4DR3 O;  3OD4 A;  4DR4 B;  2Y4T A;  4P9O A;  3ZRX A;  5IWA O;  5L3C A;  5KX5 A;  1GM8 A;  4PD4 F;  2PTM A;  4DV0 O;  1LUW A;  4WFH A;  2LW7 A;  3ETE A;  3G80 A;  2YEV B;  1HR0 B;  3SGI A;  1NI8 A;  1VF6 C;  3ZX6 A;  4WCE V;  3R66 A;  4AI8 A;  2Y4U A;  4EB6 A;  1YXB A;  2EIL B;  5K1P A;  2QWP B;  2P5O A;  2ZIO A;  1VQM V;  1U96 A;  4DV6 B;  1MAB G;  4RUE A;  1WB7 A;  4O4I A;  2EIL C;  5CA0 A;  2R9I A;  1YVW A;  1Q5O A;  1YDX A;  1SRY A;  5FPR A;  3P32 A;  1KC8 W;  4DV3 B;  5JCO A;  1KBH A;  1RM1 B;  3E83 A;  2FKX A;  1VQ4 V;  3E8G A;  1R3I C;  2ZR3 A;  1V54 B;  5L3G A;  5J2T A;  3CWB H;  2WLK A;  5C8Y A;  1RM1 C;  1M1K W;  3OE7 G;  1VQ6 V;  4DW0 A;  1V54 C;  3K9S A;  2WA4 A;  5LA6 B;  3E8H A;  1F4M A;  4WFE A;  2Q4P A;  2XUM A;  1JVM A;  1H38 A;  3S3W A;  4DV4 O;  3E8F A;  2PYL A;  4NTX A;  2Q69 A;  3JAR B;  1H2K A;  3KG2 A;  5FL7 G;  4TV9 A;  4ZHQ B;  3ZS8 C;  2AXT Z;  3ASO C;  4Z2W A;  2XOK G;  1XNR O;  4DR2 O;  4PDV A;  2HKO A;  4OPA A;  4PA3 A;  4CS4 A;  5LXT B;  5KA5 A;  2UUB O;  1LR1 A;  2H8P C;  3H1I H;  1AR1 B;  5KAF Z;  2ZE5 A;  1XMO O;  3IC7 A;  5ITZ A;  4N23 A;  2XAF A;  1N34 B;  3W7X A;  5A9G A;  5CA1 A;  1MSD A;  4TUY B;  1G6U A;  4DUY B;  3BRC A;  1P4R A;  4QNH B;  1NS1 A;  2E3C A;  2H3O A;  2QWO B;  3PJS K;  3QO5 A;  2UXX A;  3BFR A;  2OYQ A;  1M57 B;  2Y69 B;  4K8Z A;  3D8C A;  2CDY A;  5J2U A;  4BWA A;  4H13 B;  4U3F H;  5IT9 N;  2Y69 C;  1K8A W;  4JI6 O;  3DXR B;  2IJK A;  3L73 H;  1HNZ B;  1ZSP A;  4FZ1 A;  1NKD A;  4TOI A;  3VOU A;  1L0L H;  1K5S A;  4DR6 O;  3HKC B;  4EEQ A;  1VMG A; 
#chains in the Genus database with same CATH homology
 3SR2 C;  1HW7 A;  1XQ8 A;  1DGS A;  5EIB D;  4F6R A;  4LFB B;  3RYF A;  1M5I A;  1JJO A;  3JAT A;  3RYC A;  4EFB A;  4F6R B;  3A2F A;  3RYF B;  2UUA B;  3JAT B;  3RYC B;  3HKB A;  3JAW A;  3K5O A;  3UQ8 A;  4DR1 B;  1X4T A;  3HKB B;  3JAW B;  4FLT A;  2VQF B;  2BTO A;  3RYH A;  4DK1 A;  2YIB A;  3BAB A;  3K57 A;  2QM4 A;  3RYH B;  3LNN A;  4UCU A;  1M4U A;  5K1X A;  1WNS A;  1Q3E A;  4LF9 B;  3K58 A;  1QHT A;  3DSQ A;  4YJ2 A;  4DR2 B;  4GLX A;  2E5L B;  1J5E B;  4LH6 A;  4B3R B;  4X20 A;  1RSO A;  4YJ2 B;  2UUB B;  4Q6G A;  4X20 B;  3K5L A;  1XMO B;  5EYP A;  3K59 A;  5EYP B;  3PN1 A;  4I50 A;  3OTF A;  4LF5 B;  4O4H A;  4I50 B;  3HKE A;  4CH3 A;  4O4H B;  3HKE B;  1TUB A;  4TV8 A;  5GON A;  1O9G A;  4DV1 B;  2P22 C;  1T5E A;  1N36 B;  1TUB B;  4TV8 B;  2YIA A;  4FLZ A;  5GON B;  4GKK B;  2PUS A;  4LH7 A;  1N33 B;  4CH4 A;  5JH7 A;  4O4J A;  4FLY A;  4JI1 B;  5JH7 B;  3IAY A;  1TA8 A;  2GV9 A;  4O4J B;  4AHC A;  4JI6 B;  2PYJ A;  2Q7H A;  3U10 A;  4FLU A;  4PI2 A;  2UXC B;  4DRX A;  4X1K A;  4DR6 B;  4DRX B;  4JI7 B;  2YXL A;  4X1K B;  2PY5 A;  4YY3 B;  4UCT A;  4FFB A;  3K5M A;  4L8J A;  4FM0 A;  5EIB C;  1TVK A;  4FFB B;  1QQC A;  1TVK B;  3CB2 A;  4JI2 B;  4LR3 A;  2CAZ C;  1H2S B;  3THO A;  1VQ0 A;  5LOV A;  2RQ6 A;  4IIJ A;  3RWR D;  1TGO A;  1Q43 A;  4AQY B;  1XI1 A;  5LOV B;  4PI0 A;  4IIJ B;  2ZCE A;  3UT5 A;  4JI4 B;  4UCR A;  3UT5 B;  4FM1 A;  2PZS A;  3VQV A;  4UCO A;  2F1M A;  4X65 B;  2Q7E A;  3BHP A;  4O2A A;  1YEW A;  2Q7G A;  4AIL C;  1IBL B;  1VZY A;  1I94 B;  4O2A B;  2HHH B;  4HNA A;  4I55 A;  4JV5 B;  4HNA B;  4I55 B;  4CS3 A;  5LP6 A;  3BA8 A;  4CC6 A;  4LF4 B;  4D7T A;  4LFA B;  1Z5V A;  5BMV A;  5LP6 B;  5JVD A;  1FFX A;  4LFC B;  2XHB A;  3U0Z A;  4YJ3 A;  4FM2 A;  5BMV B;  5JJJ B;  5JVD B;  1FFX B;  3VQY A;  4DUZ B;  4YJ3 B;  4BW9 A;  4YHH B;  3CSX A;  3JAK A;  5LP6 C;  3U11 A;  2F95 B;  5JQG A;  4I9Q A;  3RYI A;  1SKV A;  3JAK B;  5KHI A;  3N2G A;  4PHZ A;  5JQG B;  5JJN B;  3RYI B;  4JYA B;  3N2G B;  4B3T B;  2UXB B;  3E22 A;  1HNX B;  5BR8 B;  4X64 B;  3E22 B;  4DV5 B;  3N2K A;  5FPO A;  2HEP A;  4DR7 B;  4O4L A;  5JJE B;  4IHJ A;  3QF7 A;  3N2K B;  4O4L B;  3SJC C;  4IHJ B;  4UFZ A;  5KMG A;  4KL1 A;  4TQD A;  3BAA A;  1VF7 A;  2PGG A;  5KMG B;  1SA0 A;  4DR3 B;  2ZIM A;  5IWA B;  1SA0 B;  2JVD A;  2VWK A;  2YIB D;  3T1H B;  1JFF A;  4DV7 B;  1L8D A;  2QJ1 A;  1I7F A;  1WN7 A;  1S5J A;  4ZIB A;  1JFF B;  2F4V B;  2R70 A;  4JI5 B;  2F93 B;  4JI3 B;  2BTQ A;  2JGU A;  2VWJ A;  2BTQ B;  4X1Y A;  4LF7 B;  1XHX A;  4O2B A;  4CH6 A;  3WB2 A;  4X1Y B;  4CC5 A;  1IBK B;  4I4T A;  4O2B B;  4DK0 A;  4DR4 B;  4I4T B;  4U3J A;  5KHH A;  2F66 C;  5KX5 A;  5D5Q A;  2PTM A;  4U3J B;  4NXN B;  2ZIN A;  5KX5 B;  1N32 B;  2ZM6 B;  1Z5W A;  2UUC B;  4GKJ B;  3HKD A;  1Q8I A;  3WB1 A;  1HR0 B;  3SGI A;  3K5N A;  1M93 A;  1HNW B;  3HKD B;  1V9P A;  1XMQ B;  3JSN A;  1D5A A;  3B2E E;  4EB6 A;  2YI8 A;  5K1P A;  3ETQ A;  2P5O A;  2ZIO A;  4EB6 B;  3SJA C;  4DV6 B;  3VQW A;  3ICX A;  4O4I A;  5CA0 A;  1Q5O A;  5FPR A;  5KHJ A;  4DV3 B;  4UCS A;  4O4I B;  5JCO A;  5KHG A;  5CA0 B;  5IJ0 A;  3T1Y B;  3RGB A;  3RFR A;  1B04 A;  3QG5 A;  5IJ0 B;  4FLW A;  4DR5 B;  1O9H A;  5J2T A;  4DV4 B;  5C8Y A;  3BA9 A;  5J2T B;  2RJZ A;  5JCO C;  4FVM A;  5LMN B;  5C8Y B;  4NXM B;  4OX9 B;  1WPB A;  5LA6 A;  4TQF A;  5IJ9 A;  4D7S A;  3CHX A;  5LA6 B;  5EZY A;  5IJ9 B;  1SQF A;  1XNR B;  5EZY B;  4JI8 B;  2R72 A;  1XNQ B;  1NT2 B;  1P49 A;  2EX3 A;  2VQE B;  4X66 B;  4GYC B;  2UU9 B;  3SJB C;  3JAR A;  2KKW A;  4NVP A;  2PYL A;  3OTO B;  3JAR B;  3FFQ A;  4ZHQ A;  4UCV A;  2JS5 A;  4TV9 A;  3ZS8 C;  4ZHQ B;  3WB0 A;  2Q0A A;  4TV9 B;  4X62 B;  2ZNI A;  1IBM B;  4WBN A;  4ZOL A;  4X1I A;  5LXT A;  4B3M B;  3JAL A;  4WBN B;  4ZOL B;  4X1I B;  4CS4 A;  3BPZ A;  5LXT B;  2OWO A;  4B3S B;  3JAL B;  2UXD B;  4DV0 B;  2R9A A;  1KMI Z;  4B08 A;  1XHZ A;  2ZNJ A;  3ZED A;  5ITZ A;  3QTC A;  5ITZ B;  1N34 B;  5D5P A;  4TUY A;  4CH5 A;  1FJG B;  5CA1 A;  3M7M X;  5LMU B;  4TUY B;  1G6U A;  4DV2 B;  4K8X A;  4DUY B;  3BRC A;  5CA1 B;  4LNU A;  3MAQ A;  5IYZ A;  2E3C A;  3JAS A;  4LF8 B;  4LNU B;  5IYZ B;  4FLX A;  3JAS B;  5FNV A;  4JI0 B;  2OYQ A;  2V4D A;  1SQG A;  4EFE A;  4ZI7 A;  4K8Z A;  5FNV B;  2IM9 A;  4KHP B;  4ZI7 B;  5CB4 A;  5J2U A;  5LYJ A;  5KHK A;  4BWA A;  5CB4 B;  2YI9 A;  1TAE A;  5J2U B;  4CS2 A;  3JSL A;  1ZAU A;  1KU9 A;  5LYJ B;  4HBN A;  1HNZ B;  4FLV A;  4TOI A;  3HKC A;  1JMK C;  4LF6 B;  3HKC B;  4EEQ A;  4K0K B;  3VQX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...