1I7FA

Crystal structure of the hsp33 domain with constitutive chaperone activity
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
228
structure length
228
Chain Sequence
HDQLHRYLFENFAVRGELVTVSETLQQILENHDYPQPVKNVLAELLVATSLLTATLKFDGDITVQLQGDGPMNLAVINGNNNQQMRGVARVQGEIPENADLKTLVGNGYVVITITPSEGERYQGVVGLEGDTLAADLEDYFMRSEQLPTRLFIRTGDVDGKPAAGGMLLQVMPAQNAQQDDFDHLATLTETIKTEELLTLPANEVLWRLYHEEEVTVYDPQDVEFKCT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords HEAT SHOCK PROTEIN 33
publication title Crystal structure of proteolytic fragments of the redox-sensitive Hsp33 with constitutive chaperone activity
pubmed doi rcsb
source organism Escherichia coli
total genus 45
structure length 228
sequence length 228
ec nomenclature
pdb deposition date 2001-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01430 HSP33 Hsp33 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.480 Mainly Alpha Orthogonal Bundle Helix Hairpins helix hairpin bin 1i7fA02
3.55.30.10 Alpha Beta 3-Layer(bab) Sandwich Hsp33 domain Hsp33 domain 1i7fA01
1VZYA 1VQ0A 1I7FA 3M7MX 1HW7A
chains in the Genus database with same CATH superfamily
4EEQA 3PJSK 3T2MA 2CTQA 2XOKG 4WF9V 4XDKA 2CTRA 4MVZA 3BVOA 1W0JG 5GTIZ 5FPRA 3VQXA 2QJ1A 5IE9A 2DE0X 5LMUO 2HVKC 4RUEA 4PD4F 1EN5A 1QQCA 4LH7A 1PP9H 1XL4A 5EIBC 4LR3A 4DW0A 4DV3O 4JI8B 2JS5A 1SQQH 2DYRC 3RVYA 4B3RO 1FFTB 4JTCB 5LMNO 1WAZA 5KX5B 4AILC 4WFGA 2CDYA 5EK0A 1YTFB 4RWUA 2LJ2A 1JQ0A 1QCEA 4B08A 2EILB 4LFAB 4H33A 3ZIAG 1IZ3A 1M57B 3UT5A 2Y0IA 2R9AA 3E8HA 2PF4E 3K9AA 1Y76B 1FD9A 4UB8Z 4B3TO 4YJ3B 3JAKA 1W2BU 2Q7GA 4FK5C 5KMGA 2ZNIA 3CJHB 4NXNB 1WLEA 1SQPH 2QM7A 1L1FA 5IY5B 4PDMA 1VQ7V 5B5EZ 3R66A 3C90A 5DN6G 4KXRA 5IYZB 4YHHO 3EVKA 4O4JA 1NZ6A 1TUEB 4DV6O 1TA8A 1MA1A 4JI3O 4F6EA 1NR1A 5FNVB 3EHBB 4MW8A 4NTYA 4FLTA 5EBWC 1H2NA 3FD9A 4PA4A 2Q67A 2YEVB 3D3QA 1JFFA 4K3AA 4CZZA 3FAVA 3JATA 2ZDIC 4U3JB 2Q9LA 4QNHB 2W0XA 5LP6C 4JI0B 2X6BA 4DV7B 1MNGA 3L9DA 2XAFA 5J2TA 1R73A 1M90W 2UXDB 3OMAB 3H1LH 3MHHC 4JI8O 1KKCA 4KP4A 4G28B 3QO5A 1PL4A 3U0ZA 2LP7A 1BGYH 2XAJA 5C93A 3GWOA 3EXAA 3GVMA 1Q43A 4GKJO 4IYHA 1DF5A 2LW7A 1K73W 4BAYA 4LFAO 3A8TA 4B3SO 4K8XA 5E1AC 1MZEA 5KA6A 4TV9B 4ZHQA 1S77D 3FB8C 3H1IH 3CCSV 3HKCB 4DUYB 4IL6Z 3G80A 4NXNO 4LNUA 3JASA 4JV5B 2YUAA 3SJAC 1TUBA 3ABTA 1X4TA 5IT9N 3DSQA 1CPYA 4LF6O 1RPRA 3RYIA 4CBCA 1ZAUA 4BIOA 1QR8A 2RNBA 2FMLA 2Y0PA 3U11A 4DR1B 3CS5A 1K33A 1URFA 3SJBC 1N33B 4MVOA 2DYSC 2ZIOA 2PI4A 3W7XA 1IXMA 5IWAO 1F4NA 2Y4UA 2PY5A 3N2GB 1FJGB 3CCLV 3AG3B 1M1KW 4I9QA 4JI0O 1VQLV 5LGNA 5JCOA 5AG2A 4DV7O 1S5HC 4FPPA 4GUNA 4FFBA 1E1QG 2CAZC 4DR2B 5H6QA 2L6LA 2CH7B 4GX5A 2NLJC 4TOIA 3RT3C 3LDEA 3G67A 2Z3YA 5E79Z 3CC4V 1QVGU 1AI7A 2AGAA 3ZEDA 4X20A 5B3SC 1GN4A 2ZE6A 3CCEV 4LF7O 4UV8A 3B2EE 3ZMTA 4F4LA 4JASA 2EIMC 2XHBA 1GM8A 5JQGA 1ZSPA 2BTOA 1E79G 1VQNV 3OTFA 5J9PC 4J41A 3ZRXA 3CCQV 5LA6B 4I4TA 3SPIA 1B04A 4DW1A 5C8YB 3JALA 3MAQA 4UCVA 1HR0B 4JV5O 3LUTB 1QHTA 3X2QC 1QU7A 4I55A 3FB5C 2VQFB 1AVMA 2PTMA 4QJFB 3OTOO 3HB3B 1HDJA 4DV5B 4PDVA 3ETQA 5CA1B 2ZKOA 2BOCC 5LXTA 3CCMV 4DR1O 4FLUA 4Z1VA 2DWDC 1OCRC 4DV0O 2M6YA 1N33O 1QLNA 5F2VO 2EX3A 2NN4A 4QPJA 3ZHQA 1X59A 2Q0OC 2R9RB 1PM9A 3J7AU 1FJGO 1FFXA 5B1AC 4O2AA 4ZKIA 3K06A 5J2UA 5IDJA 5L3FA 5CN0A 2F93B 5CA3A 4X1IA 4BW9A 1PV0A 4RQEA 2DN9A 4UCSA 4DR2O 3ZMVA 3ZS8C 4BIUA 1DF4A 1ZLZA 2IU3A 2V1DA 3MDSA 1JJOA 2OT5A 1N4CA 2N04A 2CGOA 1AJNA 1SA0A 1V54B 2P4KA 1IBMB 4MVMA 2CK3G 1QBZA 3TJTA 4GKKO 2HFEC 4MVRA 4TV8A 2PZSA 5EYPA 3E8BA 2YIDA 2WSSG 4QIWF 3ZRWA 3OD4A 1OCOC 2ETNA 3UO2A 2Y69B 3ASOB 3SJQC 3UT5B 5K1XA 4I50A 1R3KC 2IW5A 2V4DA 4CH3A 4G2KA 2YIBD 3JAKB 1FXKA 1VZYA 2X0LA 4GX2A 5KMGB 2YI9A 5L3DA 1K7DA 4DV5O 4X65B 2UUBB 2QGNA 2EILC 3LSUA 2PI5A 1NI8A 4IYIA 4IIJA 1M57C 4R8CA 3S3WA 4O4JB 4PDRA 4UXNA 1GN6A 1IBLO 5LGTA 5IY5C 5BMVA 2EIJB 1S3JA 4W4LA 3CXHF 2Z5UA 2X6CA 2ADQB 3S3XA 1H2KA 3FAVB 3JATB 3G6EV 2QWRB 3LNNA 1L0LH 1DLBA 5BR8B 4JI4B 1SESA 5J2TB 1YHQV 5H9CA 1W0KG 3ICXA 1IBMO 2HLDG 3MHSC 3HKBA 1Z5VA 4DR3O 1AROP 2QKSA 4TT3G 1GN2A 1D5AA 3OEHG 3SPHA 1SQBH 1J95A 2WWWA 1VQKV 1YDXA 1GMGA 2WLLB 3E2EA 4NYKA 1US6A 3I55V 1WPXA 4ICGA 1TVKA 2A0LA 3CX5F 1B6QA 1R3IC 1VF6A 5H5NA 2ZM6O 4DR4B 1Q7YW 4NR1A 2Q7HA 3DC6A 3ZCCA 3QF7A 4YJ2A 3CRQA 2HG5C 4OPHA 4LNUB 4DV4O 1K97A 2ZE5A 2UXBO 2BOBC 2R72A 1CEZA 3JD2A 1N0NA 1TUBB 3ZMSA 5IYDO 5LHIA 4J7ZA 2QEXV 3K58A 2OIEA 1VQ0A 1GK9A 4K8ZA 3G6BA 2EIKB 5KHIA 4TQDA 3K08A 4EB6A 1KKDA 3IC9A 4Z1MG 1XNQO 5EBMC 1KC8W 1Q82W 1M5IA 3ZHVA 3KG2A 3PN1A 1PNMA 4DRXA 4XBFA 4Q6GA 1EN4A 1AR5A 1G6UA 1JX9A 2HJFC 5LHHA 5FLXN 2EZOA 5BR8O 4JI4O 1ZTEA 3TXQA 4FFBB 4A5UB 4B7KA 4P30A 2JGDB 1L8DA 2LO1A 2DWEC 1NBMG 2P22C 1YEWA 1EN6A 3CYOA 2IH3C 3P30A 3ZHUA 4FIPC 1COWG 3JD3A 3AG3C 1SQVH 4HZ3A 1K34A 2CGNA 3E8FA 3G71V 5GONB 4X20B 3W7WA 1R3JC 4NXMB 1HNWB 1MZFA 4JI6B 4DO2A 3K79A 2IJHA 2YXLA 2W0FC 5JQGB 4DR4O 3RGBA 4IGGA 2BCCH 2JEUA 4K35A 1V9PA 4IT5A 2QKCA 4K0KB 4UUJC 1NT2B 4I4TB 1NU1H 4DR5B 3SPJA 3JALB 3ZBHA 4JGSA 1I5YA 3ABKB 2RN9A 4HBNA 2P67A 4I55B 4O2BA 4FM0A 1GKFA 2ZE8A 2JK5C 3TGUH 3M8AA 4I7ZB 1HWYA 2QKAA 2OTLV 2UXCB 3HKEA 5LXTB 5KHJA 1RM1B 2ZR3A 1YVWA 1ORQC 3CRRA 3SYOA 2JIZG 1FFXB 2F4VB 1VMGA 4O2AB 2ITDC 5J2UB 1GRJA 1AILA 1V55B 3IAYA 5BZBA 5JH7B 4X1IB 4OX9B 4MTGA 1H2SB 3ML0A 1SF9A 1PPJH 1G1XB 1SQFA 2EINB 1MG1A 3H1JH 3U10A 3RVZA 1Q8IA 4ZI7A 2FKXA 4FZ1A 1B3QA 4RAIA 3K5LA 2GTSA 1IX9A 1Q3EA 1SA0B 3K59A 1XMOB 4LF5B 2MW2B 1NJIW 1THZA 4L87A 2YS8A 3RN4A 4TV8B 3FKSG 5EYPB 4WFBV 4ZIBA 2KKWA 4K0KO 2P5OA 2R70A 4FMTA 3SPCA 4HNAA 4TQFA 5KHKA 4DR5O 2YDEA 2ZDIA 1XL6A 1V54C 4CS2A 4GYCB 1FS0G 2D3OW 4I50B 2BE3A 3ZMUA 2OCHA 4PA6A 4YIPA 2C2AA 5IJ0A 1YIJV 2H3OA 4DK0A 1FXKB 1RPOA 4NB5A 4JI1B 1WPBA 1CXZB 4O4IA 1L0NH 2QWQB 3CCVV 5LL6Y 1K8AW 4JAUA 2OCCB 3WB1A 3T1CA 3ASOC 5HFLA 1Z2GA 1KP3A 4QE7A 1F4MA 3NR7A 3AK2A 1MMMA 4J9ZB 4X8AA 4YY3B 3J80N 2XASA 1XHZA 3CCJV 4FLZA 1PNLA 3ZRVA 2WA3A 2F4VO 5BMVB 1O9HA 1I0HA 4GCZA 1SZTA 3K9SA 4UCTA 3F7VC 5ITZA 2QSAA 1D5NA 1E1RG 3RWRD 5EBLC 5EC2C 2N74A 3QG5A 2B1GA 5A9GA 1I94B 1Q6IA 3I56V 5LOVA 1TAEA 1IBKB 5CB4A 3CWBH 2HHHB 3UKMA 4X62B 1S76D 2XNDG 3LDCA 1Y4MA 1YZBA 2JDIG 2QTSA 3HKBB 4GX1A 2YIAA 2BTQA 1LUVA 1OZ0A 2W6IG 4MS2A 4JI7B 1Y74A 1ZX3A 3C3SA 1Q6UA 1W59A 1TVKB 3APOA 3G4SV 3H01A 4NTWA 3STZC 4PA9A 1AB3A 4DV2B 2JS3A 1HNXB 2K1EA 3DGEA 4LFBB 1VEWA 3B8MA 3L72H 4YJ2B 4FLXA 4WFFA 2E5LB 1OJHA 4JI1O 2DW4A 3RYHA 2HR3A 2YC0A 3FYIB 2XT9A 2X7RB 4DXWA 2L35A 1LR1A 1BCCH 3OR6C 4X88A 3H1KH 1FPOA 3SYPA 4YY3O 3K57A 1YITV 3WG7B 3WB0A 3H1HH 4QPKA 2QDOA 3L70H 2KG7A 4GX0A 4EB6B 2UXDO 5H2FZ 1P7BA 2HJDA 1SERA 3BA9A 3BHPA 3JARA 2WLJA 5L3GA 2Q4PA 4H0LB 3JD1A 4DRXB 1H8HG 1I94O 1BS3A 2PGGA 3ZX6A 4UVAA 2HHHO 1SKVA 5JJNB 4X62O 2EIKC 1FKAO 1VP7A 5KA5A 1OCZC 1BE3H 1YF2A 5BXZA 5B1BC 2JGUA 1JVMA 3DXRA 4LFCB 1OCCB 4YIOA 3OR7C 4WFAV 2HKOA 4DUYO 3LSQA 4D7TA 5JCOC 3AG2B 2XTAA 2E76B 1J5EB 1KP2A 1ZL8A 1KMIZ 4EFBA 5KAIZ 3E89A 4QE9A 4DV2O 1HNXO 4LFBO 2EJRA 3CRCA 3IGAC 4DUZB 1R6NA 2JJ1G 4BIZA 3RYCA 2WLMA 2ZCEA 3R65A 2CUGA 2IM9A 2E5LO 5JWPA 4BWAA 1VQ5V 5A2QN 5H6RA 3Q4HA 2ADPA 3K04A 3ETEA 3CSXA 3RBZA 3F7YC 5KHHA 4O4LA 1R6KA 4O2BB 5KUMA 1OHHG 4IHJA 3JAWA 3KKYA 1VQMV 2AZ2A 1KUQA 2ZR2A 5CBHA 2O57A 3HKEB 3UM7A 4QGPA 3L73H 3ABLC 3DC5A 2QR4A 3BA8A 1NKDA 3ABKC 1AP6A 3AEIA 1NH2D 2RJZA 3WU2Z 4J42A 3TXSA 4DV1B 4JAAA 3QO7A 3L71H 3J81N 1NVPD 1GO3F 1A32A 3OUSA 1VIBA 2P6JA 1VQ8V 3THOA 2Q8VA 2HEPA 1XNRB 2GDSA 5DM6V 1M93A 2QM4A 2P06A 3OAAG 4RO2A 1VF5B 1RM1C 1WB8A 1EZVH 3E86A 1N36B 1HW7A 3RYFA 2EBOA 4KUMA 3JAMN 5LBQA 4LFCO 2RDCA 1U97A 1BQ0A 1KD1W 3JCUZ 4ZI7B 3AK3A 2VQEB 4I5SA 2FL4A 4C7UA 2B1IA 1HR0O 1XQ8A 1J5EO 3N2KA 3FB7C 5CA0A 2LFRA 4X64B 4KHPB 1M56B 1WN7A 4UCRA 4PHZA 5EC1C 2VQFO 1H2LA 4OXSA 2EINC 1YJ9V 4TWKA 2F66C 2IH1C 4UV9A 2UU9B 1IDSA 4PV1B 3P3NA 4HNAB 3BEHA 4CH5A 4NTXA 2A3QA 3CPWU 2JRIA 2YSUB 3ZHSA 5CBFA 1N34B 5IJ0B 3OE7G 4CC5A 3M7MX 2A06H 2QA4V 4UB6Z 4O4IB 1PNKA 2WA4A 3KZIZ 4X66B 3UO3A 1AR4A 2LFSA 4LBEC 1JFFB 1XI1A 3FFQA 1SS3A 3D36C 1FYJA 4FJCC 5EIBD 2B5UA 1XREA 1ROPA 1K92A 1AJQA 3SPGA 2UUAB 1XNRO 4J10A 2VWKA 3B09A 5ITZB 2OCCC 2DQ3A 5LGUA 3HKDA 3P3PA 4WFHA 3W7SA 1AR1B 3BAAA 3ETGA 1BZKA 1GH6A 5LOVB 2B9ZA 4FLWA 1H2GA 1BHBA 2GSMB 3GWKC 5CB4B 4ZBMA 2VQEO 1Q81W 2WPDG 3ZRSA 4B3MB 3N27A 2AXTZ 3OEEG 2ATKC 4JI5B 4ZHQB 3B8NA 4KHPO 4MTXA 1R1BA 1MABG 1Y74B 3A0HZ 1WA8A 2WLKA 4KL1A 2M7WA 2P4VA 1QVFU 4MVQA 3JASB 2LGQA 1YCIA 4X65O 2UUBO 3GB7C 4N21A 1ZUQA 4J11A 1G8MA 3OW2U 2AZ0A 2G38A 2ZIMA 3B40A 4UVCA 3RYIB 1S0VA 2LQTA 4TSFG 1N34O 4B7EA 5GTHZ 5K1PA 3EFFK 1NS1A 4EFEA 2ZNJA 4HAMA 3RYHB 1HNZB 4X1KA 3TK1A 4CH4A 1P7GA 1WNSA 4X9QA 1WJZA 3TETA 3SYQA 3ZMZA 4DR6B 1VF6C 4JAVA 1GM7A 4EKWA 2ZE7A 4CS3A 3K3WA 5B3SB 1Q86W 1Y6XA 1N0JA 1YI2V 1F51A 2UUAO 2KG7B 1GM9A 1JCHA 3AG4B 4LF9B 2YICA 4MTOA 4UVBA 3JARB 4MTFA 4LWSA 5CBGA 5DECA 2KB1A 1WB7A 2ZD9A 4WFEA 1PL0A 3TCUA 3AG1B 4B3RB 1FXVA 3WG7C 3OT7A 3VQYA 4B3MO 4F6RA 3JCZA 1AI5A 1QLEB 4R50A 4CH6A 4JI5O 2ZINA 1F23A 2ITCC 4LF8B 1I7FA 2F43G 3T4ZA 4PA3A 2MK3A 4P9PA 3AG7A 2R9IA 3W7UA 1PD3A 4H37A 1ZL8B 1RP3B 3JD4A 5KUKA 2OYQA 3ASNB 1NTKH 5L3BA 5CMUA 2EZPA 4JZGA 3VQWA 4JYCA 4PI0A 1OCCC 3E83A 3APQA 3IJ4A 2ZXWB 1BHAA 3C3TA 3Q4HB 1HNZO 3AG2C 2RCVA 4TUYA 1F7YA 1JA8A 2ARHA 4DR6O 2H94A 4O4LB 4UCUA 4IHJB 2YXHA 3JAWB 3QO8A 5L3EA 4J7JA 1EFRG 4HYOA 3T1YB 4D6TH 3A0RA 3RW0A 4AI8A 3B4SA 4JTAB 1BL8A 1Z5WA 3QTCA 4U7NA 1H38A 4LF9O 1WP7A 4P2ZA 1OCOB 4JYBA 3JYCA 1VQPV 3ABMB 2PUSA 4NXMO 1HNWO 4JI6O 2JVDA 1Y66A 2NR5A 1KB9F 2GUZA 3CEIA 2AW9A 4GKJB 1BT8A 3RYFB 2Z0AA 1HP8A 2IBZH 3F5TA 4MT8A 3F5WC 3UCSC 3ZRWB 4LF8O 3T4DA 4B3SB 3O65A 3ZHTA 1SQXH 1R3LC 5TISZ 3ZN1A 5LP6A 1JJ2U 1NTZH 2WAMA 3N2KB 1KQSU 2Q69A 5CA0B 3BRCA 1IURA 3JD0A 2GV9A 1JMKC 1OV9A 1XEQA 2DOSA 1VQ9V 4MVUA 2UXCO 1SQGA 1R6TA 1JPXA 4IIJB 4MW3A 4LF6B 2Y69C 4R6ZA 3IC7A 4FM2A 3LSSA 1NR7A 2ODMA 3QVNA 3FX7A 4PI2A 1M56C 1RFYA 2ZT9B 3VOUA 3FYEB 1O9GA 4N23A 1IXBA 2FTKA 3JSNA 2D2CB 3D3IA 3ABUA 4OPAA 3CP1A 5IWAB 3T1YO 1GTOA 2QWNB 3OMIB 3BFRA 4Q20A 3NXSA 4OX9O 3E22A 4O4HA 1XMQB 3BPZA 4XDJA 4Z2WA 2A79B 5IJ9A 4FLYA 3OGIB 5KAFZ 2Y4TA 1Q6HA 2EIJC 1XMOO 5EZYA 5L3CA 4LF5O 1DTOA 1EBOA 2Y48A 2E3CA 3W7TA 2WLLA 5IYBO 3HKDB 2QWOB 4BR6A 1GN3A 1AP5A 4LF7B 4ZOLA 3P32A 2WLIA 4LCUC 1Y67A 2LGWA 2XAGA 2JJ2G 4G27B 2DJVA 3FB6C 1YTFD 4PDLA 4I0XA 1WA8B 1JOYA 3K0GA 3STLC 3L74H 4LC1A 1NH2B 3SR2C 3ZN0A 3OTOB 2LW1A 4I9WA 3OGCC 1NVPB 1UPGA 3OUFA 4J80A 1I08A 4MSWC 1EM1A 3SGIA 3CMEV 2P90A 4X1YA 1P4RA 4DV0B 5KLVH 4X1KB 4GZRB 3CB2A 2A9HA 4LP8A 4AHCA 3K0DA 2GBOA 1XHXA 2DQ0A 3SDLA 4MVSA 1KECA 3BCCH 1MSDA 4U3FH 2ILMA 1QNMA 1JR9A 1XMQO 3CCRV 4FZ0A 3BABA 2JGDA 1MSWD 2F23A 1IBKO 1VQ4V 1ENVA 4YXWG 3LNMB 4DYLA 1BMFG 1VF7A 1D2DA 4ABMA 4JI7O 4LWSB 1EZJA 1RSOA 5LYJA 1KU9A 5GONA 1SZXA 1KYOF 2P7TC 4LH6A 5IYCO 4GKKB 2Q68A 2ZQMA 3CE2A 3MD0A 3CD6V 1MOFA 2JEXA 4X89A 2DMXA 4F6RB 3AG4C 1N8RW 4PJ0Z 3CC2V 3O9OA 1K5SA 3VBBA 2Q0AA 5JVDA 1DK1A 4NKGB 1IVSA 2IU0A 1YJWV 1XILA 2W6JG 3A0BZ 2BSKA 3AG1C 2F95B 2YI8A 1DGSA 4WBNA 1K4CC 4UCOA 5KHGA 1QLEC 4JTDB 3E8GA 1UJWB 3CXCU 5B1NA 4J7KA 2DYRB 4DR7B 5FL7G 4H44B 4RQFA 5GW7A 2X6AA 4TUYB 3KCYA 3ASNC 1IBLB 2EJ7A 4FFKA 1VQ6V 2KSDA 4JI2B 4L8JA 3KCXA 2V7QG 3WB2A 1S72V 4P9OA 2ZXWC 5JH7A 1S5JA 4D7SA 2N05A 4OGQB 1XOUA 1K4DC 1YXBA 4DK1A 1N32B 5KX5A 3M99B 2E74B 4RUFA 2VRZA 2PYLA 3ZJZA 1VARA 1AI6A 3UQ8A 1WP8A 4BW5A 4DR3B 1V55C 5D5PA 1Y76A 1NQTA 4YJ3A 1XDCA 2GUZB 3CJHA 3SJCC 1AI4A 2QTOA 3CRAA 2CE4A 3CC7V 2A7WA 4DUZO 4JPRA 4CC6A 2ZM6B 5IYZA 4GT1A 3ABMC 5LP6B 1B06A 4ASUG 1PKXA 3D36A 5FNVA 4H13B 3I5DA 4JYYA 3K5MA 1SRYA 4DV4B 1S5LZ 4R7CA 1SC5B 3HPLC 2UXBB 4W4KA 2YEVA 2AHYA 4DR7O 3K03A 2PYJA 5D5QA 4FLVA 1G4YB 4U3JA 4JF3A 4JZ2A 1P49A 2Q7EA 2VWJA 3RFRA 3ETDA 2FB5A 4DV1O 1XBLA 5BY1A 4LF4B 1FXKC 3SYCA 1AJPA 1FXHA 4JI2O 4JYAB 2IJJA 2UUCB 2XUMA 1XNQB 1LNQA 3OM3B 1N32O 1VQOV 1QR9A 3E22B 1N36O 4O4HB 3VQVA 2XAHA 1XUQA 5IJ9B 1I5XA 3CRMA 3OFNG 3B77A 3K5NA 4FM1A 2RQ6A 4XDLA 5EZYB 4TV9A 3T1HB 2E75B 2YXYA 2BTQB 2FYUH 3HKCA 4X64O 5DEDA 2NNUA 3QNEA 2DYSB 2WLHA 5B1OA 2UU9O 4ZOLB 2WLIB 2EULA 2QM8A 2AHZA 2KQXA 4U7OA 1CP9A 4AQYB 4KFMA 4I0XB 2VS0A 3H9VA 2CTWA 2F1MA 2XAQA 4X66O 2HP8A 3N2GA 1LUWA 1ZWIC 3WFVA 1YJNV 1K5QA 5LHGA 2RMKB 3BY6A 4E4EA 3HR0A 4NVPA 1KBHA 3IFXA 4LF4O 1YSCA 5JJJB 4X1YB 4CS4A 1UFIA 3OMNB 1M4UA 3LDDA 2EIMB 1OCZB 2CH7A 4JYAO 1P84F 5B1BB 2UUCO 1GAXA 1U96A 3AK1A 3ZHRA 3DTUB 4UFZA 5LMUB 3L75H 2OTJV 5HFMA 4PELA 3A2FA 2UXXA 4DV3B 3X2QB 3CHXA 3D8CA 2UXNA 1SETA 3K5OA 2IJKA 2YIBA 5LMNB 1K9MW 3E35A 3T1HO 3DXRB 2GHYA 5LA6A 2Q6AA 2HVJC 4GLXA 1T5EA 4E2LA 5C8YA 3JSLA 1RSOB 1OCRB 5LYJB 4PA7A 2OIGA 5FPOA 2OWOA 3CCUV 2Q5ZA 2CTPA 1Q5OA 1TGOA 2Q73A 2K9PA 4B3TB 5B66Z 3SYAA 1H2MA 4WCEV 5B1AB 1BQZA 2QE7G 5CA1A 1Q90D 4J9YB 2H8PC 5JJEB 1FAFA 3RYCB 3ABLB 4AQYO 5JVDB 1H8EG 1K3EA 4YHHB 4DV6B 4FVMA 1BSMA 2BSKB 4JI3B 2IJIA 1NTMH 4WBNB 2WLNA 3CMAV 2GTAA 2QWPB 1M9NA
chains in the Genus database with same CATH topology
1TVKA 4EEQA 4LF7B 3HKEB 4ZOLA 3BA8A 4DR4B 2RJZA 2Q7HA 5FPRA 3QF7A 3VQXA 2QJ1A 4DV1B 4YJ2A 4LNUB 1QQCA 3THOA 4LH7A 5EIBC 4LR3A 2HEPA 4JI8B 2JS5A 1XNRB 1M93A 2R72A 2QM4A 1TUBB 3SR2C 3OTOB 5KX5B 4AILC 1N36B 1HW7A 3RYFA 3SGIA 4B08A 3K58A 4ZI7B 4X1YA 1VQ0A 4DV0B 4LFAB 2VQEB 4K8ZA 5KHIA 4TQDA 4EB6A 3UT5A 4X1KB 2R9AA 1XQ8A 3CB2A 3N2KA 5CA0A 4YJ3B 4X64B 4AHCA 1XHXA 4KHPB 3JAKA 1M5IA 1WN7A 4UCRA 3PN1A 2Q7GA 4PHZA 5KMGA 2ZNIA 4DRXA 4NXNB 4Q6GA 1G6UA 2F66C 2UU9B 3BABA 4FFBB 4HNAB 1L8DA 4CH5A 5IYZB 4O4JA 2P22C 1TA8A 1YEWA 1N34B 1VF7A 5IJ0B 5FNVB 4CC5A 3M7MX 1RSOA 5LYJA 1KU9A 5GONA 4O4IB 4FLTA 5GONB 4X20B 4LH6A 4X66B 4NXMB 1HNWB 4GKKB 4JI6B 1JFFA 1JFFB 2YXLA 3JATA 4U3JB 5JQGB 3RGBA 4F6RB 5LP6C 4JI0B 1XI1A 1V9PA 3FFQA 4K0KB 4DV7B 1NT2B 4I4TB 5EIBD 5J2TA 4DR5B 2Q0AA 5JVDA 2UXDB 3JALB 2UUAB 4HBNA 2VWKA 4I55B 5ITZB 2F95B 4O2BA 2YI8A 1DGSA 3U0ZA 4WBNA 4FM0A 3HKDA 4UCOA 1N33B 5KHGA 3BAAA 1Q43A 2UXCB 5LOVB 3HKEA 4FLWA 5LXTB 4DR7B 5CB4B 5KHJA 4B3MB 4K8XA 4TUYB 4TV9B 4ZHQA 4JI5B 4ZHQB 1IBLB 3HKCB 4DUYB 4JI2B 1FFXB 4LNUA 4KL1A 2F4VB 4L8JA 4O2AB 3JASA 4JV5B 5J2UB 3JASB 3WB2A 3IAYA 3SJAC 5JH7A 1S5JA 4D7SA 5JH7B 1TUBA 1X4TA 4X1IB 3DSQA 4OX9B 4DK1A 1N32B 5KX5A 1H2SB 3RYIA 2ZIMA 3RYIB 1ZAUA 1SQFA 3U10A 2PYLA 5K1PA 3U11A 4DR1B 1Q8IA 4ZI7A 3UQ8A 4EFEA 3K5LA 3SJBC 3RYHB 1SA0B 1Q3EA 2ZNJA 3K59A 1XMOB 1HNZB 4DR3B 2ZIOA 4X1KA 4CH4A 4LF5B 1WNSA 5D5PA 2PY5A 4DR6B 3N2GB 4YJ3A 4TV8B 1FJGB 5EYPB 3SJCC 4I9QA 4ZIBA 4CS3A 5JCOA 2KKWA 2P5OA 2R70A 4FFBA 4CC6A 4HNAA 2CAZC 4TQFA 5KHKA 2ZM6B 4DR2B 5IYZA 4CS2A 4GYCB 5LP6B 4LF9B 4I50B 4TOIA 5IJ0A 3JARB 5FNVA 4DK0A 3K5MA 4JI1B 4DV4B 1WPBA 3ZEDA 4O4IA 4X20A 2UXBB 3B2EE 4B3RB 3VQYA 3WB1A 2PYJA 5D5QA 2XHBA 4FLVA 4U3JA 5JQGA 1P49A 2Q7EA 4F6RA 2VWJA 2BTOA 3RFRA 3OTFA 4CH6A 4YY3B 2ZINA 5LA6B 1XHZA 4I4TA 4LF4B 4LF8B 4FLZA 1B04A 5C8YB 1I7FA 3JALA 3MAQA 4UCVA 1HR0B 5BMVB 1O9HA 4JYAB 1QHTA 2UUCB 1XNQB 4I55A 2OYQA 4UCTA 5ITZA 3RWRD 2VQFB 2PTMA 3E22B 3QG5A 4O4HB 3VQWA 4DV5B 1I94B 4PI0A 3VQVA 3ETQA 5CA1B 5LOVA 5LXTA 5IJ9B 1TAEA 1IBKB 5CB4A 3K5NA 2HHHB 4FLUA 4X62B 4FM1A 2RQ6A 4TUYA 3HKBB 2EX3A 5EZYB 4TV9A 2YIAA 3T1HB 2BTQA 2BTQB 4JI7B 4O4LB 3HKCA 4UCUA 4IHJB 3JAWB 1FFXA 4O2AA 5J2UA 1TVKB 3T1YB 2F93B 4ZOLB 4X1IA 4BW9A 4UCSA 4DV2B 1HNXB 1Z5WA 3QTCA 4LFBB 3ZS8C 1JJOA 4YJ2B 4FLXA 2E5LB 4AQYB 1SA0A 3RYHA 1IBMB 2PUSA 2F1MA 3N2GA 4TV8A 2JVDA 2PZSA 5EYPA 4GKJB 3RYFB 4NVPA 3K57A 5JJJB 4X1YB 4CS4A 3WB0A 1M4UA 4B3SB 4EB6B 3UT5B 5K1XA 5LP6A 4I50A 2V4DA 4UFZA 3N2KB 4CH3A 5LMUB 3BA9A 2YIBD 3BHPA 5CA0B 3JARA 3JAKB 3BRCA 1VZYA 3A2FA 5KMGB 2YI9A 2GV9A 4DRXB 1JMKC 4X65B 2PGGA 4DV3B 2UUBB 3CHXA 1SQGA 3K5OA 4IIJA 1SKVA 5JJNB 4IIJB 4LF6B 2YIBA 5LMNB 4O4JB 4FM2A 2JGUA 4LFCB 4PI2A 5LA6A 4GLXA 1O9GA 1T5EA 5C8YA 3JSLA 3JSNA 5LYJB 4D7TA 5BMVA 5JCOC 5FPOA 2OWOA 5IWAB 1J5EB 1Q5OA 1TGOA 1KMIZ 4B3TB 4EFBA 3JATB 3E22A 3LNNA 4O4HA 1XMQB 3BPZA 5CA1A 4DUZB 5JJEB 5IJ9A 3RYCA 5BR8B 4JI4B 2ZCEA 3RYCB 2IM9A 4FLYA 5J2TB 4BWAA 5JVDB 4YHHB 3ICXA 3HKBA 1Z5VA 4DV6B 5EZYA 4FVMA 1D5AA 3CSXA 4JI3B 5KHHA 2E3CA 4O4LA 4O2BB 4WBNB 4IHJA 3JAWA 3HKDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VZY A;  1VQ0 A;  1I7F A;  3M7M X;  1HW7 A; 
#chains in the Genus database with same CATH topology
 4EEQ A;  3PJS K;  3T2M A;  2CTQ A;  2XOK G;  4WF9 V;  4XDK A;  2CTR A;  4MVZ A;  3BVO A;  1W0J G;  5GTI Z;  5FPR A;  3VQX A;  2QJ1 A;  5IE9 A;  2DE0 X;  5LMU O;  2HVK C;  4RUE A;  4PD4 F;  1EN5 A;  1QQC A;  4LH7 A;  1PP9 H;  1XL4 A;  5EIB C;  4LR3 A;  4DW0 A;  4DV3 O;  4JI8 B;  2JS5 A;  1SQQ H;  2DYR C;  3RVY A;  4B3R O;  1FFT B;  4JTC B;  5LMN O;  1WAZ A;  5KX5 B;  4AIL C;  4WFG A;  2CDY A;  5EK0 A;  1YTF B;  4RWU A;  2LJ2 A;  1JQ0 A;  1QCE A;  4B08 A;  2EIL B;  4LFA B;  4H33 A;  3ZIA G;  1IZ3 A;  1M57 B;  3UT5 A;  2Y0I A;  2R9A A;  3E8H A;  2PF4 E;  3K9A A;  1Y76 B;  1FD9 A;  4UB8 Z;  4B3T O;  4YJ3 B;  3JAK A;  1W2B U;  2Q7G A;  4FK5 C;  5KMG A;  2ZNI A;  3CJH B;  4NXN B;  1WLE A;  1SQP H;  2QM7 A;  1L1F A;  5IY5 B;  4PDM A;  1VQ7 V;  5B5E Z;  3R66 A;  3C90 A;  5DN6 G;  4KXR A;  5IYZ B;  4YHH O;  3EVK A;  4O4J A;  1NZ6 A;  1TUE B;  4DV6 O;  1TA8 A;  1MA1 A;  4JI3 O;  4F6E A;  1NR1 A;  5FNV B;  3EHB B;  4MW8 A;  4NTY A;  4FLT A;  5EBW C;  1H2N A;  3FD9 A;  4PA4 A;  2Q67 A;  2YEV B;  3D3Q A;  1JFF A;  4K3A A;  4CZZ A;  3FAV A;  3JAT A;  2ZDI C;  4U3J B;  2Q9L A;  4QNH B;  2W0X A;  5LP6 C;  4JI0 B;  2X6B A;  4DV7 B;  1MNG A;  3L9D A;  2XAF A;  5J2T A;  1R73 A;  1M90 W;  2UXD B;  3OMA B;  3H1L H;  3MHH C;  4JI8 O;  1KKC A;  4KP4 A;  4G28 B;  3QO5 A;  1PL4 A;  3U0Z A;  2LP7 A;  1BGY H;  2XAJ A;  5C93 A;  3GWO A;  3EXA A;  3GVM A;  1Q43 A;  4GKJ O;  4IYH A;  1DF5 A;  2LW7 A;  1K73 W;  4BAY A;  4LFA O;  3A8T A;  4B3S O;  4K8X A;  5E1A C;  1MZE A;  5KA6 A;  4TV9 B;  4ZHQ A;  1S77 D;  3FB8 C;  3H1I H;  3CCS V;  3HKC B;  4DUY B;  4IL6 Z;  3G80 A;  4NXN O;  4LNU A;  3JAS A;  4JV5 B;  2YUA A;  3SJA C;  1TUB A;  3ABT A;  1X4T A;  5IT9 N;  3DSQ A;  1CPY A;  4LF6 O;  1RPR A;  3RYI A;  4CBC A;  1ZAU A;  4BIO A;  1QR8 A;  2RNB A;  2FML A;  2Y0P A;  3U11 A;  4DR1 B;  3CS5 A;  1K33 A;  1URF A;  3SJB C;  1N33 B;  4MVO A;  2DYS C;  2ZIO A;  2PI4 A;  3W7X A;  1IXM A;  5IWA O;  1F4N A;  2Y4U A;  2PY5 A;  3N2G B;  1FJG B;  3CCL V;  3AG3 B;  1M1K W;  4I9Q A;  4JI0 O;  1VQL V;  5LGN A;  5JCO A;  5AG2 A;  4DV7 O;  1S5H C;  4FPP A;  4GUN A;  4FFB A;  1E1Q G;  2CAZ C;  4DR2 B;  5H6Q A;  2L6L A;  2CH7 B;  4GX5 A;  2NLJ C;  4TOI A;  3RT3 C;  3LDE A;  3G67 A;  2Z3Y A;  5E79 Z;  3CC4 V;  1QVG U;  1AI7 A;  2AGA A;  3ZED A;  4X20 A;  5B3S C;  1GN4 A;  2ZE6 A;  3CCE V;  4LF7 O;  4UV8 A;  3B2E E;  3ZMT A;  4F4L A;  4JAS A;  2EIM C;  2XHB A;  1GM8 A;  5JQG A;  1ZSP A;  2BTO A;  1E79 G;  1VQN V;  3OTF A;  5J9P C;  4J41 A;  3ZRX A;  3CCQ V;  5LA6 B;  4I4T A;  3SPI A;  1B04 A;  4DW1 A;  5C8Y B;  3JAL A;  3MAQ A;  4UCV A;  1HR0 B;  4JV5 O;  3LUT B;  1QHT A;  3X2Q C;  1QU7 A;  4I55 A;  3FB5 C;  2VQF B;  1AVM A;  2PTM A;  4QJF B;  3OTO O;  3HB3 B;  1HDJ A;  4DV5 B;  4PDV A;  3ETQ A;  5CA1 B;  2ZKO A;  2BOC C;  5LXT A;  3CCM V;  4DR1 O;  4FLU A;  4Z1V A;  2DWD C;  1OCR C;  4DV0 O;  2M6Y A;  1N33 O;  1QLN A;  5F2V O;  2EX3 A;  2NN4 A;  4QPJ A;  3ZHQ A;  1X59 A;  2Q0O C;  2R9R B;  1PM9 A;  3J7A U;  1FJG O;  1FFX A;  5B1A C;  4O2A A;  4ZKI A;  3K06 A;  5J2U A;  5IDJ A;  5L3F A;  5CN0 A;  2F93 B;  5CA3 A;  4X1I A;  4BW9 A;  1PV0 A;  4RQE A;  2DN9 A;  4UCS A;  4DR2 O;  3ZMV A;  3ZS8 C;  4BIU A;  1DF4 A;  1ZLZ A;  2IU3 A;  2V1D A;  3MDS A;  1JJO A;  2OT5 A;  1N4C A;  2N04 A;  2CGO A;  1AJN A;  1SA0 A;  1V54 B;  2P4K A;  1IBM B;  4MVM A;  2CK3 G;  1QBZ A;  3TJT A;  4GKK O;  2HFE C;  4MVR A;  4TV8 A;  2PZS A;  5EYP A;  3E8B A;  2YID A;  2WSS G;  4QIW F;  3ZRW A;  3OD4 A;  1OCO C;  2ETN A;  3UO2 A;  2Y69 B;  3ASO B;  3SJQ C;  3UT5 B;  5K1X A;  4I50 A;  1R3K C;  2IW5 A;  2V4D A;  4CH3 A;  4G2K A;  2YIB D;  3JAK B;  1FXK A;  1VZY A;  2X0L A;  4GX2 A;  5KMG B;  2YI9 A;  5L3D A;  1K7D A;  4DV5 O;  4X65 B;  2UUB B;  2QGN A;  2EIL C;  3LSU A;  2PI5 A;  1NI8 A;  4IYI A;  4IIJ A;  1M57 C;  4R8C A;  3S3W A;  4O4J B;  4PDR A;  4UXN A;  1GN6 A;  1IBL O;  5LGT A;  5IY5 C;  5BMV A;  2EIJ B;  1S3J A;  4W4L A;  3CXH F;  2Z5U A;  2X6C A;  2ADQ B;  3S3X A;  1H2K A;  3FAV B;  3JAT B;  3G6E V;  2QWR B;  3LNN A;  1L0L H;  1DLB A;  5BR8 B;  4JI4 B;  1SES A;  5J2T B;  1YHQ V;  5H9C A;  1W0K G;  3ICX A;  1IBM O;  2HLD G;  3MHS C;  3HKB A;  1Z5V A;  4DR3 O;  1ARO P;  2QKS A;  4TT3 G;  1GN2 A;  1D5A A;  3OEH G;  3SPH A;  1SQB H;  1J95 A;  2WWW A;  1VQK V;  1YDX A;  1GMG A;  2WLL B;  3E2E A;  4NYK A;  1US6 A;  3I55 V;  1WPX A;  4ICG A;  1TVK A;  2A0L A;  3CX5 F;  1B6Q A;  1R3I C;  1VF6 A;  5H5N A;  2ZM6 O;  4DR4 B;  1Q7Y W;  4NR1 A;  2Q7H A;  3DC6 A;  3ZCC A;  3QF7 A;  4YJ2 A;  3CRQ A;  2HG5 C;  4OPH A;  4LNU B;  4DV4 O;  1K97 A;  2ZE5 A;  2UXB O;  2BOB C;  2R72 A;  1CEZ A;  3JD2 A;  1N0N A;  1TUB B;  3ZMS A;  5IYD O;  5LHI A;  4J7Z A;  2QEX V;  3K58 A;  2OIE A;  1VQ0 A;  1GK9 A;  4K8Z A;  3G6B A;  2EIK B;  5KHI A;  4TQD A;  3K08 A;  4EB6 A;  1KKD A;  3IC9 A;  4Z1M G;  1XNQ O;  5EBM C;  1KC8 W;  1Q82 W;  1M5I A;  3ZHV A;  3KG2 A;  3PN1 A;  1PNM A;  4DRX A;  4XBF A;  4Q6G A;  1EN4 A;  1AR5 A;  1G6U A;  1JX9 A;  2HJF C;  5LHH A;  5FLX N;  2EZO A;  5BR8 O;  4JI4 O;  1ZTE A;  3TXQ A;  4FFB B;  4A5U B;  4B7K A;  4P30 A;  2JGD B;  1L8D A;  2LO1 A;  2DWE C;  1NBM G;  2P22 C;  1YEW A;  1EN6 A;  3CYO A;  2IH3 C;  3P30 A;  3ZHU A;  4FIP C;  1COW G;  3JD3 A;  3AG3 C;  1SQV H;  4HZ3 A;  1K34 A;  2CGN A;  3E8F A;  3G71 V;  5GON B;  4X20 B;  3W7W A;  1R3J C;  4NXM B;  1HNW B;  1MZF A;  4JI6 B;  4DO2 A;  3K79 A;  2IJH A;  2YXL A;  2W0F C;  5JQG B;  4DR4 O;  3RGB A;  4IGG A;  2BCC H;  2JEU A;  4K35 A;  1V9P A;  4IT5 A;  2QKC A;  4K0K B;  4UUJ C;  1NT2 B;  4I4T B;  1NU1 H;  4DR5 B;  3SPJ A;  3JAL B;  3ZBH A;  4JGS A;  1I5Y A;  3ABK B;  2RN9 A;  4HBN A;  2P67 A;  4I55 B;  4O2B A;  4FM0 A;  1GKF A;  2ZE8 A;  2JK5 C;  3TGU H;  3M8A A;  4I7Z B;  1HWY A;  2QKA A;  2OTL V;  2UXC B;  3HKE A;  5LXT B;  5KHJ A;  1RM1 B;  2ZR3 A;  1YVW A;  1ORQ C;  3CRR A;  3SYO A;  2JIZ G;  1FFX B;  2F4V B;  1VMG A;  4O2A B;  2ITD C;  5J2U B;  1GRJ A;  1AIL A;  1V55 B;  3IAY A;  5BZB A;  5JH7 B;  4X1I B;  4OX9 B;  4MTG A;  1H2S B;  3ML0 A;  1SF9 A;  1PPJ H;  1G1X B;  1SQF A;  2EIN B;  1MG1 A;  3H1J H;  3U10 A;  3RVZ A;  1Q8I A;  4ZI7 A;  2FKX A;  4FZ1 A;  1B3Q A;  4RAI A;  3K5L A;  2GTS A;  1IX9 A;  1Q3E A;  1SA0 B;  3K59 A;  1XMO B;  4LF5 B;  2MW2 B;  1NJI W;  1THZ A;  4L87 A;  2YS8 A;  3RN4 A;  4TV8 B;  3FKS G;  5EYP B;  4WFB V;  4ZIB A;  2KKW A;  4K0K O;  2P5O A;  2R70 A;  4FMT A;  3SPC A;  4HNA A;  4TQF A;  5KHK A;  4DR5 O;  2YDE A;  2ZDI A;  1XL6 A;  1V54 C;  4CS2 A;  4GYC B;  1FS0 G;  2D3O W;  4I50 B;  2BE3 A;  3ZMU A;  2OCH A;  4PA6 A;  4YIP A;  2C2A A;  5IJ0 A;  1YIJ V;  2H3O A;  4DK0 A;  1FXK B;  1RPO A;  4NB5 A;  4JI1 B;  1WPB A;  1CXZ B;  4O4I A;  1L0N H;  2QWQ B;  3CCV V;  5LL6 Y;  1K8A W;  4JAU A;  2OCC B;  3WB1 A;  3T1C A;  3ASO C;  5HFL A;  1Z2G A;  1KP3 A;  4QE7 A;  1F4M A;  3NR7 A;  3AK2 A;  1MMM A;  4J9Z B;  4X8A A;  4YY3 B;  3J80 N;  2XAS A;  1XHZ A;  3CCJ V;  4FLZ A;  1PNL A;  3ZRV A;  2WA3 A;  2F4V O;  5BMV B;  1O9H A;  1I0H A;  4GCZ A;  1SZT A;  3K9S A;  4UCT A;  3F7V C;  5ITZ A;  2QSA A;  1D5N A;  1E1R G;  3RWR D;  5EBL C;  5EC2 C;  2N74 A;  3QG5 A;  2B1G A;  5A9G A;  1I94 B;  1Q6I A;  3I56 V;  5LOV A;  1TAE A;  1IBK B;  5CB4 A;  3CWB H;  2HHH B;  3UKM A;  4X62 B;  1S76 D;  2XND G;  3LDC A;  1Y4M A;  1YZB A;  2JDI G;  2QTS A;  3HKB B;  4GX1 A;  2YIA A;  2BTQ A;  1LUV A;  1OZ0 A;  2W6I G;  4MS2 A;  4JI7 B;  1Y74 A;  1ZX3 A;  3C3S A;  1Q6U A;  1W59 A;  1TVK B;  3APO A;  3G4S V;  3H01 A;  4NTW A;  3STZ C;  4PA9 A;  1AB3 A;  4DV2 B;  2JS3 A;  1HNX B;  2K1E A;  3DGE A;  4LFB B;  1VEW A;  3B8M A;  3L72 H;  4YJ2 B;  4FLX A;  4WFF A;  2E5L B;  1OJH A;  4JI1 O;  2DW4 A;  3RYH A;  2HR3 A;  2YC0 A;  3FYI B;  2XT9 A;  2X7R B;  4DXW A;  2L35 A;  1LR1 A;  1BCC H;  3OR6 C;  4X88 A;  3H1K H;  1FPO A;  3SYP A;  4YY3 O;  3K57 A;  1YIT V;  3WG7 B;  3WB0 A;  3H1H H;  4QPK A;  2QDO A;  3L70 H;  2KG7 A;  4GX0 A;  4EB6 B;  2UXD O;  5H2F Z;  1P7B A;  2HJD A;  1SER A;  3BA9 A;  3BHP A;  3JAR A;  2WLJ A;  5L3G A;  2Q4P A;  4H0L B;  3JD1 A;  4DRX B;  1H8H G;  1I94 O;  1BS3 A;  2PGG A;  3ZX6 A;  4UVA A;  2HHH O;  1SKV A;  5JJN B;  4X62 O;  2EIK C;  1FKA O;  1VP7 A;  5KA5 A;  1OCZ C;  1BE3 H;  1YF2 A;  5BXZ A;  5B1B C;  2JGU A;  1JVM A;  3DXR A;  4LFC B;  1OCC B;  4YIO A;  3OR7 C;  4WFA V;  2HKO A;  4DUY O;  3LSQ A;  4D7T A;  5JCO C;  3AG2 B;  2XTA A;  2E76 B;  1J5E B;  1KP2 A;  1ZL8 A;  1KMI Z;  4EFB A;  5KAI Z;  3E89 A;  4QE9 A;  4DV2 O;  1HNX O;  4LFB O;  2EJR A;  3CRC A;  3IGA C;  4DUZ B;  1R6N A;  2JJ1 G;  4BIZ A;  3RYC A;  2WLM A;  2ZCE A;  3R65 A;  2CUG A;  2IM9 A;  2E5L O;  5JWP A;  4BWA A;  1VQ5 V;  5A2Q N;  5H6R A;  3Q4H A;  2ADP A;  3K04 A;  3ETE A;  3CSX A;  3RBZ A;  3F7Y C;  5KHH A;  4O4L A;  1R6K A;  4O2B B;  5KUM A;  1OHH G;  4IHJ A;  3JAW A;  3KKY A;  1VQM V;  2AZ2 A;  1KUQ A;  2ZR2 A;  5CBH A;  2O57 A;  3HKE B;  3UM7 A;  4QGP A;  3L73 H;  3ABL C;  3DC5 A;  2QR4 A;  3BA8 A;  1NKD A;  3ABK C;  1AP6 A;  3AEI A;  1NH2 D;  2RJZ A;  3WU2 Z;  4J42 A;  3TXS A;  4DV1 B;  4JAA A;  3QO7 A;  3L71 H;  3J81 N;  1NVP D;  1GO3 F;  1A32 A;  3OUS A;  1VIB A;  2P6J A;  1VQ8 V;  3THO A;  2Q8V A;  2HEP A;  1XNR B;  2GDS A;  5DM6 V;  1M93 A;  2QM4 A;  2P06 A;  3OAA G;  4RO2 A;  1VF5 B;  1RM1 C;  1WB8 A;  1EZV H;  3E86 A;  1N36 B;  1HW7 A;  3RYF A;  2EBO A;  4KUM A;  3JAM N;  5LBQ A;  4LFC O;  2RDC A;  1U97 A;  1BQ0 A;  1KD1 W;  3JCU Z;  4ZI7 B;  3AK3 A;  2VQE B;  4I5S A;  2FL4 A;  4C7U A;  2B1I A;  1HR0 O;  1XQ8 A;  1J5E O;  3N2K A;  3FB7 C;  5CA0 A;  2LFR A;  4X64 B;  4KHP B;  1M56 B;  1WN7 A;  4UCR A;  4PHZ A;  5EC1 C;  2VQF O;  1H2L A;  4OXS A;  2EIN C;  1YJ9 V;  4TWK A;  2F66 C;  2IH1 C;  4UV9 A;  2UU9 B;  1IDS A;  4PV1 B;  3P3N A;  4HNA B;  3BEH A;  4CH5 A;  4NTX A;  2A3Q A;  3CPW U;  2JRI A;  2YSU B;  3ZHS A;  5CBF A;  1N34 B;  5IJ0 B;  3OE7 G;  4CC5 A;  3M7M X;  2A06 H;  2QA4 V;  4UB6 Z;  4O4I B;  1PNK A;  2WA4 A;  3KZI Z;  4X66 B;  3UO3 A;  1AR4 A;  2LFS A;  4LBE C;  1JFF B;  1XI1 A;  3FFQ A;  1SS3 A;  3D36 C;  1FYJ A;  4FJC C;  5EIB D;  2B5U A;  1XRE A;  1ROP A;  1K92 A;  1AJQ A;  3SPG A;  2UUA B;  1XNR O;  4J10 A;  2VWK A;  3B09 A;  5ITZ B;  2OCC C;  2DQ3 A;  5LGU A;  3HKD A;  3P3P A;  4WFH A;  3W7S A;  1AR1 B;  3BAA A;  3ETG A;  1BZK A;  1GH6 A;  5LOV B;  2B9Z A;  4FLW A;  1H2G A;  1BHB A;  2GSM B;  3GWK C;  5CB4 B;  4ZBM A;  2VQE O;  1Q81 W;  2WPD G;  3ZRS A;  4B3M B;  3N27 A;  2AXT Z;  3OEE G;  2ATK C;  4JI5 B;  4ZHQ B;  3B8N A;  4KHP O;  4MTX A;  1R1B A;  1MAB G;  1Y74 B;  3A0H Z;  1WA8 A;  2WLK A;  4KL1 A;  2M7W A;  2P4V A;  1QVF U;  4MVQ A;  3JAS B;  2LGQ A;  1YCI A;  4X65 O;  2UUB O;  3GB7 C;  4N21 A;  1ZUQ A;  4J11 A;  1G8M A;  3OW2 U;  2AZ0 A;  2G38 A;  2ZIM A;  3B40 A;  4UVC A;  3RYI B;  1S0V A;  2LQT A;  4TSF G;  1N34 O;  4B7E A;  5GTH Z;  5K1P A;  3EFF K;  1NS1 A;  4EFE A;  2ZNJ A;  4HAM A;  3RYH B;  1HNZ B;  4X1K A;  3TK1 A;  4CH4 A;  1P7G A;  1WNS A;  4X9Q A;  1WJZ A;  3TET A;  3SYQ A;  3ZMZ A;  4DR6 B;  1VF6 C;  4JAV A;  1GM7 A;  4EKW A;  2ZE7 A;  4CS3 A;  3K3W A;  5B3S B;  1Q86 W;  1Y6X A;  1N0J A;  1YI2 V;  1F51 A;  2UUA O;  2KG7 B;  1GM9 A;  1JCH A;  3AG4 B;  4LF9 B;  2YIC A;  4MTO A;  4UVB A;  3JAR B;  4MTF A;  4LWS A;  5CBG A;  5DEC A;  2KB1 A;  1WB7 A;  2ZD9 A;  4WFE A;  1PL0 A;  3TCU A;  3AG1 B;  4B3R B;  1FXV A;  3WG7 C;  3OT7 A;  3VQY A;  4B3M O;  4F6R A;  3JCZ A;  1AI5 A;  1QLE B;  4R50 A;  4CH6 A;  4JI5 O;  2ZIN A;  1F23 A;  2ITC C;  4LF8 B;  1I7F A;  2F43 G;  3T4Z A;  4PA3 A;  2MK3 A;  4P9P A;  3AG7 A;  2R9I A;  3W7U A;  1PD3 A;  4H37 A;  1ZL8 B;  1RP3 B;  3JD4 A;  5KUK A;  2OYQ A;  3ASN B;  1NTK H;  5L3B A;  5CMU A;  2EZP A;  4JZG A;  3VQW A;  4JYC A;  4PI0 A;  1OCC C;  3E83 A;  3APQ A;  3IJ4 A;  2ZXW B;  1BHA A;  3C3T A;  3Q4H B;  1HNZ O;  3AG2 C;  2RCV A;  4TUY A;  1F7Y A;  1JA8 A;  2ARH A;  4DR6 O;  2H94 A;  4O4L B;  4UCU A;  4IHJ B;  2YXH A;  3JAW B;  3QO8 A;  5L3E A;  4J7J A;  1EFR G;  4HYO A;  3T1Y B;  4D6T H;  3A0R A;  3RW0 A;  4AI8 A;  3B4S A;  4JTA B;  1BL8 A;  1Z5W A;  3QTC A;  4U7N A;  1H38 A;  4LF9 O;  1WP7 A;  4P2Z A;  1OCO B;  4JYB A;  3JYC A;  1VQP V;  3ABM B;  2PUS A;  4NXM O;  1HNW O;  4JI6 O;  2JVD A;  1Y66 A;  2NR5 A;  1KB9 F;  2GUZ A;  3CEI A;  2AW9 A;  4GKJ B;  1BT8 A;  3RYF B;  2Z0A A;  1HP8 A;  2IBZ H;  3F5T A;  4MT8 A;  3F5W C;  3UCS C;  3ZRW B;  4LF8 O;  3T4D A;  4B3S B;  3O65 A;  3ZHT A;  1SQX H;  1R3L C;  5TIS Z;  3ZN1 A;  5LP6 A;  1JJ2 U;  1NTZ H;  2WAM A;  3N2K B;  1KQS U;  2Q69 A;  5CA0 B;  3BRC A;  1IUR A;  3JD0 A;  2GV9 A;  1JMK C;  1OV9 A;  1XEQ A;  2DOS A;  1VQ9 V;  4MVU A;  2UXC O;  1SQG A;  1R6T A;  1JPX A;  4IIJ B;  4MW3 A;  4LF6 B;  2Y69 C;  4R6Z A;  3IC7 A;  4FM2 A;  3LSS A;  1NR7 A;  2ODM A;  3QVN A;  3FX7 A;  4PI2 A;  1M56 C;  1RFY A;  2ZT9 B;  3VOU A;  3FYE B;  1O9G A;  4N23 A;  1IXB A;  2FTK A;  3JSN A;  2D2C B;  3D3I A;  3ABU A;  4OPA A;  3CP1 A;  5IWA B;  3T1Y O;  1GTO A;  2QWN B;  3OMI B;  3BFR A;  4Q20 A;  3NXS A;  4OX9 O;  3E22 A;  4O4H A;  1XMQ B;  3BPZ A;  4XDJ A;  4Z2W A;  2A79 B;  5IJ9 A;  4FLY A;  3OGI B;  5KAF Z;  2Y4T A;  1Q6H A;  2EIJ C;  1XMO O;  5EZY A;  5L3C A;  4LF5 O;  1DTO A;  1EBO A;  2Y48 A;  2E3C A;  3W7T A;  2WLL A;  5IYB O;  3HKD B;  2QWO B;  4BR6 A;  1GN3 A;  1AP5 A;  4LF7 B;  4ZOL A;  3P32 A;  2WLI A;  4LCU C;  1Y67 A;  2LGW A;  2XAG A;  2JJ2 G;  4G27 B;  2DJV A;  3FB6 C;  1YTF D;  4PDL A;  4I0X A;  1WA8 B;  1JOY A;  3K0G A;  3STL C;  3L74 H;  4LC1 A;  1NH2 B;  3SR2 C;  3ZN0 A;  3OTO B;  2LW1 A;  4I9W A;  3OGC C;  1NVP B;  1UPG A;  3OUF A;  4J80 A;  1I08 A;  4MSW C;  1EM1 A;  3SGI A;  3CME V;  2P90 A;  4X1Y A;  1P4R A;  4DV0 B;  5KLV H;  4X1K B;  4GZR B;  3CB2 A;  2A9H A;  4LP8 A;  4AHC A;  3K0D A;  2GBO A;  1XHX A;  2DQ0 A;  3SDL A;  4MVS A;  1KEC A;  3BCC H;  1MSD A;  4U3F H;  2ILM A;  1QNM A;  1JR9 A;  1XMQ O;  3CCR V;  4FZ0 A;  3BAB A;  2JGD A;  1MSW D;  2F23 A;  1IBK O;  1VQ4 V;  1ENV A;  4YXW G;  3LNM B;  4DYL A;  1BMF G;  1VF7 A;  1D2D A;  4ABM A;  4JI7 O;  4LWS B;  1EZJ A;  1RSO A;  5LYJ A;  1KU9 A;  5GON A;  1SZX A;  1KYO F;  2P7T C;  4LH6 A;  5IYC O;  4GKK B;  2Q68 A;  2ZQM A;  3CE2 A;  3MD0 A;  3CD6 V;  1MOF A;  2JEX A;  4X89 A;  2DMX A;  4F6R B;  3AG4 C;  1N8R W;  4PJ0 Z;  3CC2 V;  3O9O A;  1K5S A;  3VBB A;  2Q0A A;  5JVD A;  1DK1 A;  4NKG B;  1IVS A;  2IU0 A;  1YJW V;  1XIL A;  2W6J G;  3A0B Z;  2BSK A;  3AG1 C;  2F95 B;  2YI8 A;  1DGS A;  4WBN A;  1K4C C;  4UCO A;  5KHG A;  1QLE C;  4JTD B;  3E8G A;  1UJW B;  3CXC U;  5B1N A;  4J7K A;  2DYR B;  4DR7 B;  5FL7 G;  4H44 B;  4RQF A;  5GW7 A;  2X6A A;  4TUY B;  3KCY A;  3ASN C;  1IBL B;  2EJ7 A;  4FFK A;  1VQ6 V;  2KSD A;  4JI2 B;  4L8J A;  3KCX A;  2V7Q G;  3WB2 A;  1S72 V;  4P9O A;  2ZXW C;  5JH7 A;  1S5J A;  4D7S A;  2N05 A;  4OGQ B;  1XOU A;  1K4D C;  1YXB A;  4DK1 A;  1N32 B;  5KX5 A;  3M99 B;  2E74 B;  4RUF A;  2VRZ A;  2PYL A;  3ZJZ A;  1VAR A;  1AI6 A;  3UQ8 A;  1WP8 A;  4BW5 A;  4DR3 B;  1V55 C;  5D5P A;  1Y76 A;  1NQT A;  4YJ3 A;  1XDC A;  2GUZ B;  3CJH A;  3SJC C;  1AI4 A;  2QTO A;  3CRA A;  2CE4 A;  3CC7 V;  2A7W A;  4DUZ O;  4JPR A;  4CC6 A;  2ZM6 B;  5IYZ A;  4GT1 A;  3ABM C;  5LP6 B;  1B06 A;  4ASU G;  1PKX A;  3D36 A;  5FNV A;  4H13 B;  3I5D A;  4JYY A;  3K5M A;  1SRY A;  4DV4 B;  1S5L Z;  4R7C A;  1SC5 B;  3HPL C;  2UXB B;  4W4K A;  2YEV A;  2AHY A;  4DR7 O;  3K03 A;  2PYJ A;  5D5Q A;  4FLV A;  1G4Y B;  4U3J A;  4JF3 A;  4JZ2 A;  1P49 A;  2Q7E A;  2VWJ A;  3RFR A;  3ETD A;  2FB5 A;  4DV1 O;  1XBL A;  5BY1 A;  4LF4 B;  1FXK C;  3SYC A;  1AJP A;  1FXH A;  4JI2 O;  4JYA B;  2IJJ A;  2UUC B;  2XUM A;  1XNQ B;  1LNQ A;  3OM3 B;  1N32 O;  1VQO V;  1QR9 A;  3E22 B;  1N36 O;  4O4H B;  3VQV A;  2XAH A;  1XUQ A;  5IJ9 B;  1I5X A;  3CRM A;  3OFN G;  3B77 A;  3K5N A;  4FM1 A;  2RQ6 A;  4XDL A;  5EZY B;  4TV9 A;  3T1H B;  2E75 B;  2YXY A;  2BTQ B;  2FYU H;  3HKC A;  4X64 O;  5DED A;  2NNU A;  3QNE A;  2DYS B;  2WLH A;  5B1O A;  2UU9 O;  4ZOL B;  2WLI B;  2EUL A;  2QM8 A;  2AHZ A;  2KQX A;  4U7O A;  1CP9 A;  4AQY B;  4KFM A;  4I0X B;  2VS0 A;  3H9V A;  2CTW A;  2F1M A;  2XAQ A;  4X66 O;  2HP8 A;  3N2G A;  1LUW A;  1ZWI C;  3WFV A;  1YJN V;  1K5Q A;  5LHG A;  2RMK B;  3BY6 A;  4E4E A;  3HR0 A;  4NVP A;  1KBH A;  3IFX A;  4LF4 O;  1YSC A;  5JJJ B;  4X1Y B;  4CS4 A;  1UFI A;  3OMN B;  1M4U A;  3LDD A;  2EIM B;  1OCZ B;  2CH7 A;  4JYA O;  1P84 F;  5B1B B;  2UUC O;  1GAX A;  1U96 A;  3AK1 A;  3ZHR A;  3DTU B;  4UFZ A;  5LMU B;  3L75 H;  2OTJ V;  5HFM A;  4PEL A;  3A2F A;  2UXX A;  4DV3 B;  3X2Q B;  3CHX A;  3D8C A;  2UXN A;  1SET A;  3K5O A;  2IJK A;  2YIB A;  5LMN B;  1K9M W;  3E35 A;  3T1H O;  3DXR B;  2GHY A;  5LA6 A;  2Q6A A;  2HVJ C;  4GLX A;  1T5E A;  4E2L A;  5C8Y A;  3JSL A;  1RSO B;  1OCR B;  5LYJ B;  4PA7 A;  2OIG A;  5FPO A;  2OWO A;  3CCU V;  2Q5Z A;  2CTP A;  1Q5O A;  1TGO A;  2Q73 A;  2K9P A;  4B3T B;  5B66 Z;  3SYA A;  1H2M A;  4WCE V;  5B1A B;  1BQZ A;  2QE7 G;  5CA1 A;  1Q90 D;  4J9Y B;  2H8P C;  5JJE B;  1FAF A;  3RYC B;  3ABL B;  4AQY O;  5JVD B;  1H8E G;  1K3E A;  4YHH B;  4DV6 B;  4FVM A;  1BSM A;  2BSK B;  4JI3 B;  2IJI A;  1NTM H;  4WBN B;  2WLN A;  3CMA V;  2GTA A;  2QWP B;  1M9N A; 
#chains in the Genus database with same CATH homology
 1TVK A;  4EEQ A;  4LF7 B;  3HKE B;  4ZOL A;  3BA8 A;  4DR4 B;  2RJZ A;  2Q7H A;  5FPR A;  3QF7 A;  3VQX A;  2QJ1 A;  4DV1 B;  4YJ2 A;  4LNU B;  1QQC A;  3THO A;  4LH7 A;  5EIB C;  4LR3 A;  2HEP A;  4JI8 B;  2JS5 A;  1XNR B;  1M93 A;  2R72 A;  2QM4 A;  1TUB B;  3SR2 C;  3OTO B;  5KX5 B;  4AIL C;  1N36 B;  1HW7 A;  3RYF A;  3SGI A;  4B08 A;  3K58 A;  4ZI7 B;  4X1Y A;  1VQ0 A;  4DV0 B;  4LFA B;  2VQE B;  4K8Z A;  5KHI A;  4TQD A;  4EB6 A;  3UT5 A;  4X1K B;  2R9A A;  1XQ8 A;  3CB2 A;  3N2K A;  5CA0 A;  4YJ3 B;  4X64 B;  4AHC A;  1XHX A;  4KHP B;  3JAK A;  1M5I A;  1WN7 A;  4UCR A;  3PN1 A;  2Q7G A;  4PHZ A;  5KMG A;  2ZNI A;  4DRX A;  4NXN B;  4Q6G A;  1G6U A;  2F66 C;  2UU9 B;  3BAB A;  4FFB B;  4HNA B;  1L8D A;  4CH5 A;  5IYZ B;  4O4J A;  2P22 C;  1TA8 A;  1YEW A;  1N34 B;  1VF7 A;  5IJ0 B;  5FNV B;  4CC5 A;  3M7M X;  1RSO A;  5LYJ A;  1KU9 A;  5GON A;  4O4I B;  4FLT A;  5GON B;  4X20 B;  4LH6 A;  4X66 B;  4NXM B;  1HNW B;  4GKK B;  4JI6 B;  1JFF A;  1JFF B;  2YXL A;  3JAT A;  4U3J B;  5JQG B;  3RGB A;  4F6R B;  5LP6 C;  4JI0 B;  1XI1 A;  1V9P A;  3FFQ A;  4K0K B;  4DV7 B;  1NT2 B;  4I4T B;  5EIB D;  5J2T A;  4DR5 B;  2Q0A A;  5JVD A;  2UXD B;  3JAL B;  2UUA B;  4HBN A;  2VWK A;  4I55 B;  5ITZ B;  2F95 B;  4O2B A;  2YI8 A;  1DGS A;  3U0Z A;  4WBN A;  4FM0 A;  3HKD A;  4UCO A;  1N33 B;  5KHG A;  3BAA A;  1Q43 A;  2UXC B;  5LOV B;  3HKE A;  4FLW A;  5LXT B;  4DR7 B;  5CB4 B;  5KHJ A;  4B3M B;  4K8X A;  4TUY B;  4TV9 B;  4ZHQ A;  4JI5 B;  4ZHQ B;  1IBL B;  3HKC B;  4DUY B;  4JI2 B;  1FFX B;  4LNU A;  4KL1 A;  2F4V B;  4L8J A;  4O2A B;  3JAS A;  4JV5 B;  5J2U B;  3JAS B;  3WB2 A;  3IAY A;  3SJA C;  5JH7 A;  1S5J A;  4D7S A;  5JH7 B;  1TUB A;  1X4T A;  4X1I B;  3DSQ A;  4OX9 B;  4DK1 A;  1N32 B;  5KX5 A;  1H2S B;  3RYI A;  2ZIM A;  3RYI B;  1ZAU A;  1SQF A;  3U10 A;  2PYL A;  5K1P A;  3U11 A;  4DR1 B;  1Q8I A;  4ZI7 A;  3UQ8 A;  4EFE A;  3K5L A;  3SJB C;  3RYH B;  1SA0 B;  1Q3E A;  2ZNJ A;  3K59 A;  1XMO B;  1HNZ B;  4DR3 B;  2ZIO A;  4X1K A;  4CH4 A;  4LF5 B;  1WNS A;  5D5P A;  2PY5 A;  4DR6 B;  3N2G B;  4YJ3 A;  4TV8 B;  1FJG B;  5EYP B;  3SJC C;  4I9Q A;  4ZIB A;  4CS3 A;  5JCO A;  2KKW A;  2P5O A;  2R70 A;  4FFB A;  4CC6 A;  4HNA A;  2CAZ C;  4TQF A;  5KHK A;  2ZM6 B;  4DR2 B;  5IYZ A;  4CS2 A;  4GYC B;  5LP6 B;  4LF9 B;  4I50 B;  4TOI A;  5IJ0 A;  3JAR B;  5FNV A;  4DK0 A;  3K5M A;  4JI1 B;  4DV4 B;  1WPB A;  3ZED A;  4O4I A;  4X20 A;  2UXB B;  3B2E E;  4B3R B;  3VQY A;  3WB1 A;  2PYJ A;  5D5Q A;  2XHB A;  4FLV A;  4U3J A;  5JQG A;  1P49 A;  2Q7E A;  4F6R A;  2VWJ A;  2BTO A;  3RFR A;  3OTF A;  4CH6 A;  4YY3 B;  2ZIN A;  5LA6 B;  1XHZ A;  4I4T A;  4LF4 B;  4LF8 B;  4FLZ A;  1B04 A;  5C8Y B;  1I7F A;  3JAL A;  3MAQ A;  4UCV A;  1HR0 B;  5BMV B;  1O9H A;  4JYA B;  1QHT A;  2UUC B;  1XNQ B;  4I55 A;  2OYQ A;  4UCT A;  5ITZ A;  3RWR D;  2VQF B;  2PTM A;  3E22 B;  3QG5 A;  4O4H B;  3VQW A;  4DV5 B;  1I94 B;  4PI0 A;  3VQV A;  3ETQ A;  5CA1 B;  5LOV A;  5LXT A;  5IJ9 B;  1TAE A;  1IBK B;  5CB4 A;  3K5N A;  2HHH B;  4FLU A;  4X62 B;  4FM1 A;  2RQ6 A;  4TUY A;  3HKB B;  2EX3 A;  5EZY B;  4TV9 A;  2YIA A;  3T1H B;  2BTQ A;  2BTQ B;  4JI7 B;  4O4L B;  3HKC A;  4UCU A;  4IHJ B;  3JAW B;  1FFX A;  4O2A A;  5J2U A;  1TVK B;  3T1Y B;  2F93 B;  4ZOL B;  4X1I A;  4BW9 A;  4UCS A;  4DV2 B;  1HNX B;  1Z5W A;  3QTC A;  4LFB B;  3ZS8 C;  1JJO A;  4YJ2 B;  4FLX A;  2E5L B;  4AQY B;  1SA0 A;  3RYH A;  1IBM B;  2PUS A;  2F1M A;  3N2G A;  4TV8 A;  2JVD A;  2PZS A;  5EYP A;  4GKJ B;  3RYF B;  4NVP A;  3K57 A;  5JJJ B;  4X1Y B;  4CS4 A;  3WB0 A;  1M4U A;  4B3S B;  4EB6 B;  3UT5 B;  5K1X A;  5LP6 A;  4I50 A;  2V4D A;  4UFZ A;  3N2K B;  4CH3 A;  5LMU B;  3BA9 A;  2YIB D;  3BHP A;  5CA0 B;  3JAR A;  3JAK B;  3BRC A;  1VZY A;  3A2F A;  5KMG B;  2YI9 A;  2GV9 A;  4DRX B;  1JMK C;  4X65 B;  2PGG A;  4DV3 B;  2UUB B;  3CHX A;  1SQG A;  3K5O A;  4IIJ A;  1SKV A;  5JJN B;  4IIJ B;  4LF6 B;  2YIB A;  5LMN B;  4O4J B;  4FM2 A;  2JGU A;  4LFC B;  4PI2 A;  5LA6 A;  4GLX A;  1O9G A;  1T5E A;  5C8Y A;  3JSL A;  3JSN A;  5LYJ B;  4D7T A;  5BMV A;  5JCO C;  5FPO A;  2OWO A;  5IWA B;  1J5E B;  1Q5O A;  1TGO A;  1KMI Z;  4B3T B;  4EFB A;  3JAT B;  3E22 A;  3LNN A;  4O4H A;  1XMQ B;  3BPZ A;  5CA1 A;  4DUZ B;  5JJE B;  5IJ9 A;  3RYC A;  5BR8 B;  4JI4 B;  2ZCE A;  3RYC B;  2IM9 A;  4FLY A;  5J2T B;  4BWA A;  5JVD B;  4YHH B;  3ICX A;  3HKB A;  1Z5V A;  4DV6 B;  5EZY A;  4FVM A;  1D5A A;  3CSX A;  4JI3 B;  5KHH A;  2E3C A;  4O4L A;  4O2B B;  4WBN B;  4IHJ A;  3JAW A;  3HKD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...