1I7FA

Crystal structure of the hsp33 domain with constitutive chaperone activity
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
228
structure length
228
Chain Sequence
b'HDQLHRYLFENFAVRGELVTVSETLQQILENHDYPQPVKNVLAELLVATSLLTATLKFDGDITVQLQGDGPMNLAVINGNNNQQMRGVARVQGEIPENADLKTLVGNGYVVITITPSEGERYQGVVGLEGDTLAADLEDYFMRSEQLPTRLFIRTGDVDGKPAAGGMLLQVMPAQNAQQDDFDHLATLTETIKTEELLTLPANEVLWRLYHEEEVTVYDPQDVEFKCT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEAT SHOCK PROTEIN 33
molecule tags Chaperone
source organism Escherichia coli
publication title Crystal structure of proteolytic fragments of the redox-sensitive Hsp33 with constitutive chaperone activity
pubmed doi rcsb
total genus 45
structure length 228
sequence length 228
ec nomenclature
pdb deposition date 2001-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01430 HSP33 Hsp33 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.480 Mainly Alpha Orthogonal Bundle Helix Hairpins helix hairpin bin 1i7fA02
3.55.30.10 Alpha Beta 3-Layer(bab) Sandwich Hsp33 domain Hsp33 domain 1i7fA01
1HW7A 1I7FA 1VQ0A 3M7MX 1VZYA
chains in the Genus database with same CATH superfamily
2N05A 2JK5C 4I4TA 4X1IB 5B66Z 3JASA 4R7CA 4DW1A 3ZN0A 2YIDA 1XNRB 3RYCB 1I94O 1IURA 1Q5OA 2LGWA 2AW9A 3MD0A 4NR1A 4DK0A 5BMVA 4UVCA 1OCCC 4EFBA 3K03A 4UCVA 3A2FA 5DM6V 1YJWV 2ILMA 4O2BB 1XMOB 4LH6A 1M1KW 2JGUA 3SR2C 2WLKA 1VQNV 4FVMA 4G27B 3LDEA 2JS5A 4TV8B 2PUSA 1KB9F 4CS3A 2D3OW 4FM0A 1NTMH 4QGPA 5EBWC 1VQPV 1NJIW 3ABKC 2YXYA 4DV5O 2E5LO 3P30A 4B7EA 5EC1C 4IL6Z 1ZX3A 2LQTA 3H01A 1PNMA 1EBOA 3N2GA 1SQFA 4KL1A 4RUEA 3AG2B 4QJFB 3STZC 2LGQA 2RJZA 1US6A 4DR4B 1GAXA 2X6CA 3OM3B 4DUYB 3FB8C 1DLBA 3E83A 4LC1A 3ZHUA 4GKJB 2Z0AA 4NXNO 5JWPA 1BSMA 1G4YB 1PKXA 2AHYA 3OMIB 3D36A 1ENVA 3TETA 1MOFA 3DXRA 5EYPA 3JYCA 4GKJO 3QG5A 2ZE7A 4AQYB 4JI6B 1ZUQA 3SPHA 1OCRC 2EIKB 2WLLB 4DRXB 5L3GA 4LF8B 5EBMC 2WPDG 5KHHA 3K5NA 1BQ0A 2IU3A 5B3SC 1B04A 4YY3B 2EIMB 1VARA 4JYBA 2DQ3A 4X1KB 2GBOA 1SZTA 2DQ0A 2YIBD 1XMOO 3OMAB 4F6RA 1O9GA 3CCEV 2P7TC 2HLDG 4MTXA 4EKWA 2A7WA 5LGUA 2Q4PA 1ZTEA 3CRMA 4BWAA 3UQ8A 2OIGA 1BHBA 4DR6B 4O2BA 2WLJA 3STLC 3WU2Z 4O4LA 1KD1W 2JS3A 2F93B 5CA0B 2IJKA 3ICXA 1M9NA 4CS2A 4WCEV 4DV4O 2EINC 3OEEG 4NTYA 3ETDA 4P9OA 4YJ2B 4FFKA 1N36B 2P06A 1E79G 1M5IA 1AI7A 3QO7A 3KCXA 4FIPC 1JX9A 4IHJA 5GTHZ 3VQYA 1HNWB 3L70H 2DYRB 4JTCB 3ABLC 2BTQA 4QE7A 4DV0B 2HVJC 3GWOA 3C3TA 4H37A 2G38A 2EBOA 3RW0A 4QNHB 1QLNA 2OCHA 2H94A 3QNEA 4PJ0Z 4KFMA 3ABLB 1KU9A 2W6JG 3CRQA 2JIZG 4MVQA 2YICA 1VF5B 4FLWA 4WBNB 3JCUZ 3MHHC 4C7UA 3OUFA 5KUMA 1S72V 1XMQB 4I9QA 4QE9A 2OWOA 3IGAC 3FFQA 3CXHF 5LYJA 4X66B 4ZHQA 4JV5O 4F6EA 1V55B 4CC5A 2UUCB 5J2UA 1KQSU 1VF6C 1IBLO 5BY1A 1AROP 4O4IA 3ZRXA 3MAQA 3TXQA 2KQXA 3OD4A 3CC4V 4CZZA 4LF6O 4DV5B 2F1MA 3M99B 3CCUV 1FD9A 1BCCH 1VMGA 2EULA 2OTLV 1ZAUA 4K0KO 1YZBA 1YTFB 3WG7C 1SETA 3ABUA 2JJ2G 3BA9A 4ABMA 2Y0PA 3JCZA 3LSUA 2PY5A 4DUZB 3FB7C 3HR0A 3AG1C 4OXSA 5L3DA 1Y6XA 3JAKA 1JVMA 2ZIOA 4O4HB 5LP6B 4B3RO 1AJNA 4I7ZB 1PD3A 1V55C 2XAQA 1CP9A 3ZCCA 2M6YA 1S5LZ 4LF5O 2UXBB 3SJQC 3T1HB 1KKDA 3W7SA 2YSUB 3IAYA 3ETQA 5KHKA 1G8MA 1BGYH 1KMIZ 4ICGA 4R6ZA 4LFCO 4OX9O 3KKYA 1DGSA 2EIJB 4DV3O 5KHIA 4LFAO 1WAZA 1GH6A 1G1XB 4H44B 3E8HA 3LSQA 3THOA 5IYBO 3WG7B 2YI9A 3RWRD 2EIJC 4YJ3A 1XHXA 3FYIB 4X1KA 3NXSA 4NKGB 2ITCC 1BS3A 4D6TH 4DR7O 5CBGA 3BY6A 4PA7A 2XTAA 1ROPA 2ZXWC 2PYLA 2IM9A 4LR3A 2IJIA 4B08A 4BW5A 2QSAA 3H1JH 2OYQA 5L3BA 1FXKB 1CXZB 1YVWA 4Z1MG 2B1IA 2VS0A 1HW7A 3K57A 2JJ1G 1OCRB 1KECA 4DR3B 5LMUO 4TSFG 2FL4A 4LCUC 1M57C 2OCCB 2Q7HA 2ZE5A 3FX7A 4JZ2A 5EIBD 3I5DA 4J9ZB 2QDOA 1AR4A 4JI5O 4KHPO 3TGUH 4UXNA 2Q68A 5F2VO 4X62B 1O9HA 1K4CC 1U97A 2BTOA 3BVOA 4WFEA 2D2CB 3O65A 5LP6A 4J41A 1QVGU 3ZMTA 1F51A 1LR1A 2NN4A 5LXTA 5IJ0A 1M56B 2QGNA 4CS4A 3FB5C 4EB6B 4PDRA 1Q6UA 3CCRV 1V9PA 4NXMB 4MTFA 5KX5B 1GMGA 4JTDB 2LFSA 3R66A 2C2AA 3F7VC 1SA0B 4DV4B 5K1PA 2ZCEA 3A8TA 1NR1A 1P84F 3SJCC 4XDKA 2CTPA 1F7YA 1W59A 4G28B 4I55B 1XL4A 2YUAA 1WP7A 1KC8W 2LJ2A 1FYJA 1K33A 3VQXA 4DR5B 1AP5A 1H2NA 2Q69A 1MA1A 3P32A 1K3EA 3CE2A 5B3SB 1JQ0A 3X2QB 4JI8O 2F66C 3QVNA 3CJHA 3QF7A 4J9YB 2HJFC 5IY5B 5KLVH 2HJDA 2EJ7A 1XI1A 3RYCA 4DV1B 4UUJC 3BABA 3EFFK 2F43G 1XILA 1RFYA 1XL6A 2UU9O 2XAJA 1Y4MA 5B1BC 2HHHB 3G4SV 1WB8A 1AJQA 2Q0AA 4F6RB 5CB4A 2V1DA 2A9HA 4DR4O 3VBBA 2BCCH 3CB2A 4TUYB 5C8YA 4MVRA 2P67A 1PL4A 4UV8A 5J2UB 2Z3YA 1V54C 1S5JA 4JYAO 4J42A 3RFRA 3HKEA 4GX5A 2AZ2A 1R3LC 3ZEDA 5LOVA 1FJGO 1H2KA 3ASNB 5GW7A 4FLXA 2KKWA 2GHYA 1XNQO 2P4VA 2Q9LA 2OTJV 3J81N 4OX9B 3QO5A 3P3PA 3BRCA 4MVUA 1HNZB 1GN3A 5CMUA 5B1OA 2R9RB 4IT5A 3KG2A 3RYFA 5ITZA 4ZI7B 4YXWG 4W4KA 5IWAO 1KP3A 4FPPA 3H1LH 5CA0A 1SQPH 5EC2C 3CCMV 4PDMA 3FB6C 4JI3O 5KX5A 3JD3A 1B3QA 2R9IA 4ZOLA 1UJWB 1Y66A 3C3SA 4I55A 5LL6Y 2HVKC 4FFBB 4KP4A 2Y4TA 3FAVA 4E4EA 1Q86W 1JJ2U 1BL8A 2JGDA 1YITV 2OIEA 1NKDA 3Q4HB 2Y69B 4NVPA 5J2TA 2EJRA 4ZHQB 3NR7A 3CWBH 3CJHB 5L3FA 3JSLA 5AG2A 4O4IB 1HNZO 4EB6A 2WAMA 2ZM6B 3E2EA 1QR8A 1VQKV 2ATKC 2NR5A 2DYSC 4CH3A 4JV5B 3ABKB 1KBHA 2BTQB 5LOVB 4IIJA 3K5LA 3CCLV 4G2KA 1J5EO 3TCUA 1S76D 1N4CA 1HWYA 5IYCO 4B3SB 4CH4A 1K34A 1FXKC 3K9SA 2XT9A 5KAFZ 1R3KC 3FYEB 3LUTB 1AILA 1PPJH 1WN7A 5KMGB 2XASA 3B40A 1FXHA 5LA6B 2DN9A 1VQOV 1HNXO 5J2TB 4DV0O 4FLUA 1JR9A 3R65A 4JI6O 4JF3A 2OCCC 4RUFA 1GO3F 1HR0B 3D3IA 3OE7G 1T5EA 4I50B 1TUBB 2IU0A 4NYKA 2FB5A 2RQ6A 2XOKG 4O4JA 2PZSA 2QM4A 3K5MA 4FJCC 2KB1A 2F95B 3K3WA 2YIAA 1GTOA 2YS8A 4I9WA 3ETEA 4JZGA 2UXCB 1QNMA 4B3RB 1QU7A 5EZYB 2X7RB 2DYSB 4TUYA 3LDDA 2DMXA 3OFNG 4UFZA 2R70A 2QR4A 3FAVB 4KHPB 5A9GA 4GX1A 5JQGB 1WP8A 3K04A 4LFCB 1NZ6A 2PF4E 2X6BA 3CEIA 3L73H 3UT5B 4JI3B 1I7FA 3SJBC 4O2AA 3N2KA 1VQ5V 2BSKB 4XDLA 4BIZA 1I0HA 3CCJV 4LFBO 4JI1B 2UUBB 3D36C 1Q90D 1M93A 2A06H 1S0VA 4UCRA 1SESA 4I50A 2GUZA 1S5HC 1XNQB 4ZI7A 4K3AA 4LF8O 3H9VA 1THZA 2P4KA 4BIOA 5LYJB 2QKSA 4N23A 5FNVA 3JASB 1XREA 4P30A 4DR1O 4DR3O 2QE7G 1TUBA 1I5YA 3ZRWA 4YIPA 2XAGA 3UKMA 3U11A 1IBMO 1AR1B 4HAMA 1IX9A 4JAVA 4QIWF 1TAEA 4UB6Z 1RM1C 4TQFA 1QR9A 2CTQA 1HR0O 4ASUG 2MK3A 1VQLV 4UB8Z 4X88A 2ZE8A 1I08A 1Q82W 2P22C 4GT1A 1P4RA 3IC7A 1NBMG 4BR6A 1AB3A 3ZMSA 3G71V 2Y0IA 3JARB 2CE4A 5FPOA 2GTAA 1SQVH 2MW2B 3JD1A 3AEIA 3VOUA 1GN2A 4YHHB 5CBHA 1IXMA 2DOSA 2NLJC 2UXDO 3CRAA 2CTWA 4FM2A 3SPIA 5FLXN 5LMNB 4TV9A 2A3QA 3S3XA 2EILC 5IE9A 3KCYA 4DR2B 2CH7B 4U7NA 3OR7C 1QBZA 3QTCA 4I5SA 4U3JA 1S3JA 5KAIZ 4I0XA 3JALA 2DWEC 3I55V 4X66O 3HKCB 4H0LB 1XEQA 4JI1O 4J11A 1Y74B 2UUBO 1NS1A 3FKSG 1SQQH 1M90W 1SZXA 4PDVA 5IWAB 3JAWB 2EZOA 5IY5C 1FJGB 1RPRA 2YXLA 3VQVA 4TWKA 3E8BA 3AG4C 5CA3A 2LW1A 5JJJB 3JSNA 3E89A 4RWUA 2YDEA 3HKBB 1SC5B 1LNQA 3ZRVA 1YXBA 3ABMB 2K1EA 2UXCO 3BA8A 4JASA 4DV6O 4X65B 1I5XA 1RSOA 2UXNA 3OTOB 3Q4HA 5IJ0B 4NXNB 4PELA 5IT9N 1NTZH 2RCVA 2H3OA 2QWPB 3SYQA 4LWSA 2QKAA 1YI2V 3MHSC 2JEUA 3ZJZA 4MVZA 4LF4B 1P49A 4TV9B 2N74A 1SQXH 1IBMB 1COWG 2JDIG 1YJ9V 4FZ0A 1N32O 4GUNA 1FXVA 2IJJA 3IFXA 2GUZB 1VQ7V 1SKVA 1NH2D 1KYOF 1JCHA 4PI2A 4W4LA 3SYAA 2O57A 1FFXB 1SQBH 4JI2O 2Q8VA 1D2DA 3EHBB 1Z2GA 5KA5A 1IBLB 1YCIA 2GSMB 4H13B 5LXTB 4UVBA 1H2GA 1JFFB 3ML0A 3KZIZ 4OGQB 5BR8B 3CMEV 5LP6C 2PI5A 3CXCU 3JD2A 2L35A 3JALB 1BE3H 1GM7A 1CPYA 1IXBA 5B1AC 1RP3B 3APQA 1K9MW 5HFLA 3ZMZA 4PDLA 5BMVB 1EN5A 4LFAB 1EFRG 3K59A 2E76B 1B6QA 4CH5A 4DR7B 2WA4A 1HDJA 5FNVB 4LNUA 5JCOA 1YJNV 4OPAA 5KUKA 3E8GA 1HNWO 2W6IG 4WFFA 1OZ0A 3T1YB 1RSOB 4JI0B 2CUGA 3X2QC 2GDSA 3OT7A 5BZBA 1JFFA 2QJ1A 2HEPA 4MS2A 4Z2WA 3N27A 4ZIBA 4B7KA 3GWKC 3UO3A 1OCZC 1OV9A 5KHGA 3HKEB 1Q43A 4GCZA 5CBFA 1UPGA 4LF4O 1IDSA 3RGBA 4DXWA 3F7YC 4UCOA 3WFVA 2Y69C 3AG7A 2ETNA 1U96A 2FMLA 1K4DC 1MABG 1R1BA 2DJVA 2JGDB 3BAAA 5L3CA 4DV6B 1YHQV 2EZPA 2CGNA 1H2LA 2CTRA 3D3QA 2A0LA 4JI0O 2EILB 1IZ3A 1DTOA 4FM1A 2P5OA 2QM7A 1BT8A 5EYPB 4NB5A 2UXXA 1X59A 2ZR3A 4K0KB 1L0NH 1KUQA 3RYFB 4L8JA 4HYOA 1Z5VA 3HKCA 4JPRA 4TT3G 2KSDA 2GV9A 2X6AA 2WLLA 4DRXA 3C90A 3E8FA 1R6TA 4K8ZA 2V7QG 1DK1A 5H2FZ 3JD4A 3BEHA 1N0JA 2ZQMA 3W7XA 5JCOC 4IYHA 1DF5A 3H1HH 3T2MA 4JYAB 1H2MA 3DTUB 2IBZH 1NH2B 4K8XA 4RAIA 3CD6V 3HKBA 1XDCA 2Q7GA 3CCQV 2FKXA 5IYDO 2YC0A 3ZHQA 1WNSA 1SS3A 1R6KA 4JAAA 2CGOA 1UFIA 4IHJB 4XBFA 3GB7C 3CC7V 4DV7B 4LF9B 2B1GA 1SQGA 4FLTA 1BMFG 1DF4A 5EZYA 2DW4A 1ZWIC 4YHHO 3HB3B 1LUVA 2ZD9A 1QLEC 2K9PA 4LF7B 3B8MA 3L9DA 5L3EA 2QKCA 4DR1B 5EBLC 3MDSA 2QWRB 1XHZA 1N8RW 2EIMC 4A5UB 1W2BU 4UCUA 2DYRC 5GTIZ 3F5WC 5HFMA 3OR6C 1F4NA 4E2LA 1ZSPA 3G67A 4LF6B 4OPHA 1BQZA 1VZYA 5LA6A 3RYIA 1VP7A 2JEXA 3IC9A 3JAWA 3CRRA 4LP8A 3T4DA 5JVDA 2F23A 4WFGA 3ZRSA 5DN6G 5LGTA 1XNRO 1I94B 1EZVH 1XBLA 1GKFA 2Y48A 4R50A 3GVMA 3AG3C 2YEVA 2Q6AA 1R6NA 2DWDC 1F4MA 2AHZA 1YDXA 1W0KG 1JMKC 3APOA 1XMQO 5IYZA 2JRIA 1V54B 2YEVB 2IH3C 3E22A 4P2ZA 4JI5B 2IW5A 2LO1A 2UUAO 2HP8A 2OT5A 3E86A 5DECA 4X64O 4O4JB 4PD4F 3HPLC 1TVKA 3A0RA 1YTFD 1ORQC 4JYCA 3TK1A 1WPBA 4R8CA 5LBQA 3H1KH 3RN4A 3K58A 2YI8A 4FK5C 2E3CA 3ZHTA 2VQEB 1N32B 3BCCH 4LWSB 4Q6GA 3U10A 4IIJB 1WB7A 2XAFA 3N2KB 3G6EV 4MVSA 1NVPB 4CBCA 3ZHRA 1P7GA 2LW7A 1URFA 3DXRB 2ZM6O 3SPJA 1SA0A 1TUEB 4BW9A 4QPKA 3SJAC 1Q6HA 4HNAA 3E22B 1MZFA 1X4TA 4N21A 2Q67A 1EN4A 2Z5UA 1L0LH 3P3NA 2M7WA 4F4LA 2E5LB 3UT5A 1QVFU 4J7JA 1OCZB 5H6QA 3L71H 2ZE6A 3EXAA 5KMGA 3SYPA 3CX5F 1XUQA 1FXKA 2ZT9B 2WWWA 2ZIMA 3EVKA 3K0GA 1VIBA 2B9ZA 1VQ4V 3G80A 1MZEA 4DR2O 3T4ZA 2ADPA 2AGAA 1H8HG 2VRZA 4I0XB 5JH7B 4J10A 1FPOA 3N2GB 2QTSA 3UM7A 4TV8A 2QA4V 2FTKA 4HZ3A 5CA1A 1IBKO 4YJ2A 4BAYA 5K1XA 4B3MB 2EIKC 1K92A 1PV0A 4O2AB 2HR3A 3LNMB 1FAFA 3ASOC 1TVKB 4EEQA 5GONA 1ZL8A 2UU9B 4X1YB 1IBKB 1NTKH 4YIOA 2Q0OC 3W7UA 2VWJA 1AR5A 1AI5A 4AHCA 4KUMA 3F5TA 3I56V 3OGCC 4AI8A 1FFXA 3CCVV 5BR8O 1OCOB 1MSWD 2F4VB 5H6RA 2X0LA 4QPJA 3AG2C 4PA9A 2PYJA 5TISZ 1QQCA 4YJ3B 1FFTB 2WLIB 2VWKA 2P90A 1AI4A 3K08A 4UCTA 1OCCB 1R3IC 1VQ8V 3L75H 4DO2A 2RNBA 5ITZB 5CA1B 3B77A 4JI8B 4FLYA 3W7WA 4B3TO 1NI8A 2BOBC 4DV7O 4LF9O 1J95A 3FD9A 2F4VO 4H33A 1YIJV 4WFHA 4LNUB 3CSXA 2Y4UA 3L72H 1JJOA 3ZIAG 2CK3G 1BZKA 2WLNA 1L1FA 4WF9V 4MW3A 3LDCA 2E74B 4BIUA 1NR7A 3ZMUA 2JVDA 1VEWA 1YF2A 1QHTA 2ARHA 4CH6A 2XNDG 1K5SA 1GN6A 4X65O 4D7TA 1N36O 1EN6A 4NXMO 5JQGA 4MTGA 4X8AA 3M8AA 4WFBV 2IJHA 5JJNB 4AILC 1Y76B 4MTOA 3K5OA 1H38A 4U7OA 5BXZA 4WFAV 4JI7B 4MSWC 4UCSA 1N34B 1Q81W 1BHAA 4RQEA 1MSDA 1Z5WA 5IJ9A 3PN1A 3RT3C 3TXSA 2L6LA 2H8PC 5LHHA 3JATA 3ABTA 1QLEB 5JVDB 1JPXA 1LUWA 4JI7O 5LMNO 3ASNC 4PV1B 3ZMVA 4ZOLB 3G6BA 2EINB 1JOYA 2XUMA 3ZHVA 1QCEA 4LFBB 1Y74A 5J9PC 2ADQB 3VQWA 3OMNB 3T1YO 4JI4O 4PA3A 4TQDA 3RYHB 1GM9A 4DR6O 2ITDC 4X89A 3AG3B 3ETGA 4JTAB 5FL7G 3OTFA 1HNXB 4FZ1A 3B8NA 1WA8A 4B3TB 3AG4B 2HFEC 4MVMA 1VQ9V 5B1NA 1XOUA 3IJ4A 4J7ZA 4LH7A 2ZR2A 3OW2U 3ZBHA 2YXHA 2ODMA 5GONB 2RDCA 5EIBC 4PI0A 1WA8B 1MMMA 4ZBMA 3RBZA 4HBNA 4PHZA 4YY3O 2R72A 2WA3A 1EM1A 3K9AA 1P7BA 2HG5C 2QWQB 1AI6A 3OEHG 3JARA 4DYLA 1Q6IA 4L87A 2W0XA 5C8YB 3CRCA 4MT8A 2QWNB 2KG7A 4AQYO 1A32A 1G6UA 3K0DA 4MVOA 2AXTZ 1J5EB 3ZN1A 1VF7A 3ABMC 4GX0A 2DE0X 1K5QA 3CCSV 5JJEB 3B2EE 2VQEO 2QM8A 2PGGA 5LHGA 3ZS8C 3SGIA 3AK1A 1NT2B 3J7AU 1PP9H 3OAAG 4LF5B 4U3JB 5CN0A 4DW0A 2LFRA 1OHHG 1N33B 4JI2B 3B09A 1Y76A 1VF6A 2ZDIA 3BHPA 4IGGA 4FLVA 2XAHA 3PJSK 2RN9A 1F23A 5IDJA 3DC6A 3AK3A 2AZ0A 5B1AB 1SF9A 4ZKIA 1N34O 2P6JA 2VQFB 2Q73A 2BSKA 5C93A 2A79B 1N33O 1E1RG 4RQFA 3OUSA 2ZKOA 1WJZA 5KA6A 1Y67A 3ZX6A 4XDJA 2ZNIA 1ZLZA 3RYHA 5D5QA 3H1IH 2UXBO 3DSQA 3UCSC 1AJPA 2ZNJA 1H2SB 4J7KA 3SYCA 4UVAA 1MNGA 1OCOC 2CAZC 3K79A 4O4HA 4DUYO 5EK0A 4NTXA 1YEWA 2QWOB 2HKOA 3ZHSA 3LSSA 1M56C 1PNKA 2BE3A 1AVMA 2NNUA 1GK9A 4K35A 4U3FH 1E1QG 3UO2A 3BPZA 3AK2A 4X64B 2KG7B 3CPWU 5IYZB 1S77D 4DV1O 2WSSG 1FKAO 3O9OA 4WBNA 2B5UA 4UV9A 4P9PA 1SRYA 4KXRA 2WLMA 5B5EZ 1D5NA 3WB2A 1K7DA 2BOCC 1IVSA 3HKDB 5D5PA 2ZDIC 3JATB 3SDLA 2UUAB 2YIBA 3DC5A 1VQ0A 2EX3A 1AP6A 1R73A 2E75B 2GTSA 5E1AC 3SPCA 1PL0A 5JH7A 4PA4A 3U0ZA 3CC2V 3RYIB 3RVYA 1KKCA 1L8DA 2UXDB 3ASOB 3T1CA 4B3SO 1NU1H 3BFRA 1PNLA 4Z1VA 1SERA 3D8CA 4FFBA 4GYCB 3CP1A 2V4DA 3S3WA 4HNAB 1WLEA 5H5NA 4GLXA 4DR5O 3A0HZ 1MG1A 1Q7YW 3T1HO 3TJTA 2CH7A 1TA8A 4FMTA 2QEXV 1YSCA 3B4SA 3E35A 5B1BB 3CHXA 5A2QN 5LHIA 2PI4A 4DV2B 4X20A 3M7MX 4B3MO 1KP2A 1TGOA 3JD0A 5DEDA 4O4LB 1W0JG 4NTWA 1RM1B 3AG1B 2VQFO 2R9AA 1WPXA 2WLHA 4JAUA 1Q3EA 1HP8A 1ZL8B 4X62O 3HKDA 5KHJA 1M4UA 3ZRWB 4X1IA 1VQ6V 3SYOA 1OJHA 2CDYA 4IYIA 4Q20A 3A0BZ 2FYUH 1VQMV 4GZRB 1M57B 4LF7O 1GRJA 1CEZA 1K8AW 3CS5A 4GX2A 2ZINA 1B06A 3W7TA 4EFEA 2PTMA 4DUZO 4DK1A 2N04A 4PA6A 3CYOA 2Q7EA 2RMKB 3K06A 1XQ8A 5LMUB 1PM9A 2LP7A 3CMAV 2WLIA 4X20B 3L74H 1K73W 4JI4B 2UUCO 1GN4A 3QO8A 1H8EG 4GKKB 4TOIA 2XHBA 2ZXWB 4D7SA 1NVPD 1NQTA 2W0FC 3WB1A 1N0NA 3RVZA 4MW8A 3JAMN 4X9QA 5LGNA 4GKKO 1JA8A 3SPGA 5FPRA 4I4TB 2QTOA 4JYYA 1FS0G 2Q5ZA 1K97A 4X1YA 5CB4B 3JAKB 4DV3B 3J80N 3WB0A 2HHHO 5E79Z 3DGEA 4JGSA 1EZJA 5IJ9B 1RPOA 3LNNA 4CC6A 4J80A 4FLZA 1Q8IA 1R3JC 3OTOO 3OGIB 2IH1C 4LBEC 1GM8A 4RO2A 4DV2O 1D5AA 5H9CA
chains in the Genus database with same CATH topology
4PI2A 4I55B 4I4TA 1FFXB 4X1IB 1JJOA 3JASA 1XNRB 3RYCB 1IBLB 3VQXA 1Q5OA 4DR5B 5LXTB 4DK0A 5BMVA 1JFFB 4EFBA 5BR8B 5LP6C 2JVDA 2F66C 4UCVA 1QHTA 3A2FA 4CH6A 3QF7A 3JALB 4O2BB 4D7TA 1XMOB 4LH6A 5JQGA 5BMVB 1XI1A 3RYCA 4DV1B 4LFAB 3K59A 2JGUA 3BABA 4CH5A 4DR7B 5JJNB 4AILC 3SR2C 3K5OA 4FVMA 5FNVB 4LNUA 2HHHB 2JS5A 5JCOA 4TV8B 2PUSA 4CS3A 4JI7B 2Q0AA 4FM0A 4UCSA 4F6RB 1N34B 5CB4A 1Z5WA 3T1YB 5IJ9A 3PN1A 3CB2A 4JI0B 4TUYB 5C8YA 3JATA 1JFFA 2QJ1A 2HEPA 5J2UB 5JVDB 1S5JA 3N2GA 1SQFA 4KL1A 4ZOLB 4ZIBA 3RFRA 3HKEA 2RJZA 5KHGA 3HKEB 3ZEDA 4LFBB 5LOVA 3VQWA 1Q43A 4DR4B 4TQDA 3RYHB 4DUYB 4FLXA 2KKWA 4GKJB 3RGBA 4UCOA 4OX9B 3OTFA 3BRCA 1HNXB 1HNZB 4B3TB 3RYFA 3BAAA 5ITZA 4DV6B 4ZI7B 5EYPA 4LH7A 3QG5A 5CA0A 4AQYB 4JI6B 5GONB 5EIBC 4PI0A 4DRXB 4FM1A 2P5OA 5KX5A 4HBNA 4PHZA 4ZOLA 4LF8B 2R72A 4I55A 5KHHA 4FFBB 5EYPB 3K5NA 1B04A 4K0KB 3RYFB 4YY3B 4L8JA 3JARA 1Z5VA 3HKCA 5C8YB 2GV9A 4X1KB 4NVPA 4DRXA 5J2TA 1G6UA 2YIBD 4ZHQB 4K8ZA 4F6RA 1O9GA 1J5EB 1VF7A 3JSLA 4O4IB 5JCOC 4EB6A 5JJEB 3B2EE 4JYAB 2PGGA 4K8XA 2ZM6B 3ZS8C 4BWAA 3SGIA 3UQ8A 3HKBA 1NT2B 2Q7GA 4LF5B 4U3JB 4O2BA 4DR6B 4CH3A 4JV5B 4O4LA 1WNSA 2F93B 1N33B 4JI2B 2BTQB 5LOVB 5CA0B 3ICXA 4IHJB 4IIJA 3BHPA 4CS2A 3K5LA 4DV7B 4LF9B 4FLVA 1SQGA 4YJ2B 1N36B 4FLTA 4B3SB 4CH4A 1M5IA 5EZYA 4IHJA 3VQYA 1HNWB 1WN7A 4LF7B 2VQFB 5KMGB 2BTQA 4DV0B 5LA6B 4DR1B 1XHZA 5J2TB 4UCUA 4FLUA 1KU9A 1HR0B 1T5EA 4I50B 1TUBB 2RQ6A 2ZNIA 3RYHA 4O4JA 2PZSA 5D5QA 2QM4A 3K5MA 4FLWA 4WBNB 3DSQA 1XMQB 4I9QA 4LF6B 2F95B 2OWOA 1VZYA 2ZNJA 1H2SB 5LA6A 2YIAA 3FFQA 5LYJA 3RYIA 4X66B 4ZHQA 4CC5A 3JAWA 2UUCB 5JVDA 5J2UA 2UXCB 4B3RB 2CAZC 4O4HA 5EZYB 1I94B 4TUYA 4O4IA 3MAQA 1YEWA 4UFZA 2R70A 4KHPB 5JQGB 3BPZA 4X64B 4LFCB 1JMKC 3UT5B 4DV5B 2F1MA 4JI3B 1I7FA 5IYZB 3SJBC 5IYZA 4O2AA 3N2KA 3E22A 4WBNA 1ZAUA 4JI5B 3WB2A 3BA9A 4JI1B 2UUBB 1M93A 3HKDB 5D5PA 4O4JB 3JATB 4UCRA 2UUAB 1VQ0A 2YIBA 1TVKA 2PY5A 2EX3A 4I50A 4DUZB 1XNQB 4ZI7A 5JH7A 3U0ZA 3RYIB 5LYJB 1L8DA 1WPBA 5FNVA 2UXDB 3JASB 3JAKA 2ZIOA 4O4HB 5LP6B 3K58A 2YI8A 2E3CA 4FFBA 4GYCB 1TUBA 2V4DA 2VQEB 1N32B 4HNAB 4Q6GA 3U10A 4IIJB 4GLXA 3N2KB 3U11A 2UXBB 1TAEA 4TQFA 1TA8A 3CHXA 4DV2B 3T1HB 4X20A 3M7MX 3IAYA 1SA0A 1TGOA 3ETQA 5KHKA 2P22C 4O4LB 4BW9A 1KMIZ 3SJAC 4HNAA 3JARB 1DGSA 3E22B 1X4TA 5FPOA 5KHIA 2R9AA 1Q3EA 1D5AA 4YHHB 3THOA 2E5LB 2YI9A 3UT5A 3HKDA 3RWRD 4YJ3A 5KHJA 1XHXA 4FM2A 4X1KA 1M4UA 4X1IA 5LMNB 4TV9A 5KMGA 4DR2B 2ZIMA 2PYLA 2IM9A 4LR3A 4B08A 3QTCA 4U3JA 5JH7B 2OYQA 3N2GB 2ZINA 3JALA 4EFEA 2PTMA 4DK1A 4TV8A 3HKCB 5CA1A 2Q7EA 4YJ2A 1HW7A 3K57A 1XQ8A 5LMUB 5K1XA 4B3MB 5IWAB 3JAWB 4X20B 4DR3B 4JI4B 1FJGB 4O2AB 4GKKB 1TVKB 4TOIA 4EEQA 2XHBA 4D7SA 5GONA 2UU9B 2Q7HA 4X1YB 2YXLA 1IBKB 3VQVA 5EIBD 2VWJA 3WB1A 4AHCA 5JJJB 3JSNA 3HKBB 4X62B 1O9HA 1FFXA 5FPRA 4I4TB 2BTOA 3BA8A 2F4VB 4X1YA 4X65B 5LP6A 5CB4B 3JAKB 4DV3B 5LXTA 3WB0A 5IJ0A 1RSOA 3OTOB 5IJ9B 2PYJA 5IJ0B 4NXNB 1QQCA 4CS4A 4YJ3B 4EB6B 3LNNA 2VWKA 4UCTA 1V9PA 4LF4B 1P49A 4TV9B 4NXMB 4CC6A 5ITZB 5KX5B 5CA1B 1IBMB 4FLZA 4JI8B 1Q8IA 4FLYA 1SA0B 4DV4B 5K1PA 2ZCEA 3SJCC 1SKVA 4LNUB 3CSXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HW7 A;  1I7F A;  1VQ0 A;  3M7M X;  1VZY A; 
#chains in the Genus database with same CATH topology
 2N05 A;  2JK5 C;  4I4T A;  4X1I B;  5B66 Z;  3JAS A;  4R7C A;  4DW1 A;  3ZN0 A;  2YID A;  1XNR B;  3RYC B;  1I94 O;  1IUR A;  1Q5O A;  2LGW A;  2AW9 A;  3MD0 A;  4NR1 A;  4DK0 A;  5BMV A;  4UVC A;  1OCC C;  4EFB A;  3K03 A;  4UCV A;  3A2F A;  5DM6 V;  1YJW V;  2ILM A;  4O2B B;  1XMO B;  4LH6 A;  1M1K W;  2JGU A;  3SR2 C;  2WLK A;  1VQN V;  4FVM A;  4G27 B;  3LDE A;  2JS5 A;  4TV8 B;  2PUS A;  1KB9 F;  4CS3 A;  2D3O W;  4FM0 A;  1NTM H;  4QGP A;  5EBW C;  1VQP V;  1NJI W;  3ABK C;  2YXY A;  4DV5 O;  2E5L O;  3P30 A;  4B7E A;  5EC1 C;  4IL6 Z;  1ZX3 A;  2LQT A;  3H01 A;  1PNM A;  1EBO A;  3N2G A;  1SQF A;  4KL1 A;  4RUE A;  3AG2 B;  4QJF B;  3STZ C;  2LGQ A;  2RJZ A;  1US6 A;  4DR4 B;  1GAX A;  2X6C A;  3OM3 B;  4DUY B;  3FB8 C;  1DLB A;  3E83 A;  4LC1 A;  3ZHU A;  4GKJ B;  2Z0A A;  4NXN O;  5JWP A;  1BSM A;  1G4Y B;  1PKX A;  2AHY A;  3OMI B;  3D36 A;  1ENV A;  3TET A;  1MOF A;  3DXR A;  5EYP A;  3JYC A;  4GKJ O;  3QG5 A;  2ZE7 A;  4AQY B;  4JI6 B;  1ZUQ A;  3SPH A;  1OCR C;  2EIK B;  2WLL B;  4DRX B;  5L3G A;  4LF8 B;  5EBM C;  2WPD G;  5KHH A;  3K5N A;  1BQ0 A;  2IU3 A;  5B3S C;  1B04 A;  4YY3 B;  2EIM B;  1VAR A;  4JYB A;  2DQ3 A;  4X1K B;  2GBO A;  1SZT A;  2DQ0 A;  2YIB D;  1XMO O;  3OMA B;  4F6R A;  1O9G A;  3CCE V;  2P7T C;  2HLD G;  4MTX A;  4EKW A;  2A7W A;  5LGU A;  2Q4P A;  1ZTE A;  3CRM A;  4BWA A;  3UQ8 A;  2OIG A;  1BHB A;  4DR6 B;  4O2B A;  2WLJ A;  3STL C;  3WU2 Z;  4O4L A;  1KD1 W;  2JS3 A;  2F93 B;  5CA0 B;  2IJK A;  3ICX A;  1M9N A;  4CS2 A;  4WCE V;  4DV4 O;  2EIN C;  3OEE G;  4NTY A;  3ETD A;  4P9O A;  4YJ2 B;  4FFK A;  1N36 B;  2P06 A;  1E79 G;  1M5I A;  1AI7 A;  3QO7 A;  3KCX A;  4FIP C;  1JX9 A;  4IHJ A;  5GTH Z;  3VQY A;  1HNW B;  3L70 H;  2DYR B;  4JTC B;  3ABL C;  2BTQ A;  4QE7 A;  4DV0 B;  2HVJ C;  3GWO A;  3C3T A;  4H37 A;  2G38 A;  2EBO A;  3RW0 A;  4QNH B;  1QLN A;  2OCH A;  2H94 A;  3QNE A;  4PJ0 Z;  4KFM A;  3ABL B;  1KU9 A;  2W6J G;  3CRQ A;  2JIZ G;  4MVQ A;  2YIC A;  1VF5 B;  4FLW A;  4WBN B;  3JCU Z;  3MHH C;  4C7U A;  3OUF A;  5KUM A;  1S72 V;  1XMQ B;  4I9Q A;  4QE9 A;  2OWO A;  3IGA C;  3FFQ A;  3CXH F;  5LYJ A;  4X66 B;  4ZHQ A;  4JV5 O;  4F6E A;  1V55 B;  4CC5 A;  2UUC B;  5J2U A;  1KQS U;  1VF6 C;  1IBL O;  5BY1 A;  1ARO P;  4O4I A;  3ZRX A;  3MAQ A;  3TXQ A;  2KQX A;  3OD4 A;  3CC4 V;  4CZZ A;  4LF6 O;  4DV5 B;  2F1M A;  3M99 B;  3CCU V;  1FD9 A;  1BCC H;  1VMG A;  2EUL A;  2OTL V;  1ZAU A;  4K0K O;  1YZB A;  1YTF B;  3WG7 C;  1SET A;  3ABU A;  2JJ2 G;  3BA9 A;  4ABM A;  2Y0P A;  3JCZ A;  3LSU A;  2PY5 A;  4DUZ B;  3FB7 C;  3HR0 A;  3AG1 C;  4OXS A;  5L3D A;  1Y6X A;  3JAK A;  1JVM A;  2ZIO A;  4O4H B;  5LP6 B;  4B3R O;  1AJN A;  4I7Z B;  1PD3 A;  1V55 C;  2XAQ A;  1CP9 A;  3ZCC A;  2M6Y A;  1S5L Z;  4LF5 O;  2UXB B;  3SJQ C;  3T1H B;  1KKD A;  3W7S A;  2YSU B;  3IAY A;  3ETQ A;  5KHK A;  1G8M A;  1BGY H;  1KMI Z;  4ICG A;  4R6Z A;  4LFC O;  4OX9 O;  3KKY A;  1DGS A;  2EIJ B;  4DV3 O;  5KHI A;  4LFA O;  1WAZ A;  1GH6 A;  1G1X B;  4H44 B;  3E8H A;  3LSQ A;  3THO A;  5IYB O;  3WG7 B;  2YI9 A;  3RWR D;  2EIJ C;  4YJ3 A;  1XHX A;  3FYI B;  4X1K A;  3NXS A;  4NKG B;  2ITC C;  1BS3 A;  4D6T H;  4DR7 O;  5CBG A;  3BY6 A;  4PA7 A;  2XTA A;  1ROP A;  2ZXW C;  2PYL A;  2IM9 A;  4LR3 A;  2IJI A;  4B08 A;  4BW5 A;  2QSA A;  3H1J H;  2OYQ A;  5L3B A;  1FXK B;  1CXZ B;  1YVW A;  4Z1M G;  2B1I A;  2VS0 A;  1HW7 A;  3K57 A;  2JJ1 G;  1OCR B;  1KEC A;  4DR3 B;  5LMU O;  4TSF G;  2FL4 A;  4LCU C;  1M57 C;  2OCC B;  2Q7H A;  2ZE5 A;  3FX7 A;  4JZ2 A;  5EIB D;  3I5D A;  4J9Z B;  2QDO A;  1AR4 A;  4JI5 O;  4KHP O;  3TGU H;  4UXN A;  2Q68 A;  5F2V O;  4X62 B;  1O9H A;  1K4C C;  1U97 A;  2BTO A;  3BVO A;  4WFE A;  2D2C B;  3O65 A;  5LP6 A;  4J41 A;  1QVG U;  3ZMT A;  1F51 A;  1LR1 A;  2NN4 A;  5LXT A;  5IJ0 A;  1M56 B;  2QGN A;  4CS4 A;  3FB5 C;  4EB6 B;  4PDR A;  1Q6U A;  3CCR V;  1V9P A;  4NXM B;  4MTF A;  5KX5 B;  1GMG A;  4JTD B;  2LFS A;  3R66 A;  2C2A A;  3F7V C;  1SA0 B;  4DV4 B;  5K1P A;  2ZCE A;  3A8T A;  1NR1 A;  1P84 F;  3SJC C;  4XDK A;  2CTP A;  1F7Y A;  1W59 A;  4G28 B;  4I55 B;  1XL4 A;  2YUA A;  1WP7 A;  1KC8 W;  2LJ2 A;  1FYJ A;  1K33 A;  3VQX A;  4DR5 B;  1AP5 A;  1H2N A;  2Q69 A;  1MA1 A;  3P32 A;  1K3E A;  3CE2 A;  5B3S B;  1JQ0 A;  3X2Q B;  4JI8 O;  2F66 C;  3QVN A;  3CJH A;  3QF7 A;  4J9Y B;  2HJF C;  5IY5 B;  5KLV H;  2HJD A;  2EJ7 A;  1XI1 A;  3RYC A;  4DV1 B;  4UUJ C;  3BAB A;  3EFF K;  2F43 G;  1XIL A;  1RFY A;  1XL6 A;  2UU9 O;  2XAJ A;  1Y4M A;  5B1B C;  2HHH B;  3G4S V;  1WB8 A;  1AJQ A;  2Q0A A;  4F6R B;  5CB4 A;  2V1D A;  2A9H A;  4DR4 O;  3VBB A;  2BCC H;  3CB2 A;  4TUY B;  5C8Y A;  4MVR A;  2P67 A;  1PL4 A;  4UV8 A;  5J2U B;  2Z3Y A;  1V54 C;  1S5J A;  4JYA O;  4J42 A;  3RFR A;  3HKE A;  4GX5 A;  2AZ2 A;  1R3L C;  3ZED A;  5LOV A;  1FJG O;  1H2K A;  3ASN B;  5GW7 A;  4FLX A;  2KKW A;  2GHY A;  1XNQ O;  2P4V A;  2Q9L A;  2OTJ V;  3J81 N;  4OX9 B;  3QO5 A;  3P3P A;  3BRC A;  4MVU A;  1HNZ B;  1GN3 A;  5CMU A;  5B1O A;  2R9R B;  4IT5 A;  3KG2 A;  3RYF A;  5ITZ A;  4ZI7 B;  4YXW G;  4W4K A;  5IWA O;  1KP3 A;  4FPP A;  3H1L H;  5CA0 A;  1SQP H;  5EC2 C;  3CCM V;  4PDM A;  3FB6 C;  4JI3 O;  5KX5 A;  3JD3 A;  1B3Q A;  2R9I A;  4ZOL A;  1UJW B;  1Y66 A;  3C3S A;  4I55 A;  5LL6 Y;  2HVK C;  4FFB B;  4KP4 A;  2Y4T A;  3FAV A;  4E4E A;  1Q86 W;  1JJ2 U;  1BL8 A;  2JGD A;  1YIT V;  2OIE A;  1NKD A;  3Q4H B;  2Y69 B;  4NVP A;  5J2T A;  2EJR A;  4ZHQ B;  3NR7 A;  3CWB H;  3CJH B;  5L3F A;  3JSL A;  5AG2 A;  4O4I B;  1HNZ O;  4EB6 A;  2WAM A;  2ZM6 B;  3E2E A;  1QR8 A;  1VQK V;  2ATK C;  2NR5 A;  2DYS C;  4CH3 A;  4JV5 B;  3ABK B;  1KBH A;  2BTQ B;  5LOV B;  4IIJ A;  3K5L A;  3CCL V;  4G2K A;  1J5E O;  3TCU A;  1S76 D;  1N4C A;  1HWY A;  5IYC O;  4B3S B;  4CH4 A;  1K34 A;  1FXK C;  3K9S A;  2XT9 A;  5KAF Z;  1R3K C;  3FYE B;  3LUT B;  1AIL A;  1PPJ H;  1WN7 A;  5KMG B;  2XAS A;  3B40 A;  1FXH A;  5LA6 B;  2DN9 A;  1VQO V;  1HNX O;  5J2T B;  4DV0 O;  4FLU A;  1JR9 A;  3R65 A;  4JI6 O;  4JF3 A;  2OCC C;  4RUF A;  1GO3 F;  1HR0 B;  3D3I A;  3OE7 G;  1T5E A;  4I50 B;  1TUB B;  2IU0 A;  4NYK A;  2FB5 A;  2RQ6 A;  2XOK G;  4O4J A;  2PZS A;  2QM4 A;  3K5M A;  4FJC C;  2KB1 A;  2F95 B;  3K3W A;  2YIA A;  1GTO A;  2YS8 A;  4I9W A;  3ETE A;  4JZG A;  2UXC B;  1QNM A;  4B3R B;  1QU7 A;  5EZY B;  2X7R B;  2DYS B;  4TUY A;  3LDD A;  2DMX A;  3OFN G;  4UFZ A;  2R70 A;  2QR4 A;  3FAV B;  4KHP B;  5A9G A;  4GX1 A;  5JQG B;  1WP8 A;  3K04 A;  4LFC B;  1NZ6 A;  2PF4 E;  2X6B A;  3CEI A;  3L73 H;  3UT5 B;  4JI3 B;  1I7F A;  3SJB C;  4O2A A;  3N2K A;  1VQ5 V;  2BSK B;  4XDL A;  4BIZ A;  1I0H A;  3CCJ V;  4LFB O;  4JI1 B;  2UUB B;  3D36 C;  1Q90 D;  1M93 A;  2A06 H;  1S0V A;  4UCR A;  1SES A;  4I50 A;  2GUZ A;  1S5H C;  1XNQ B;  4ZI7 A;  4K3A A;  4LF8 O;  3H9V A;  1THZ A;  2P4K A;  4BIO A;  5LYJ B;  2QKS A;  4N23 A;  5FNV A;  3JAS B;  1XRE A;  4P30 A;  4DR1 O;  4DR3 O;  2QE7 G;  1TUB A;  1I5Y A;  3ZRW A;  4YIP A;  2XAG A;  3UKM A;  3U11 A;  1IBM O;  1AR1 B;  4HAM A;  1IX9 A;  4JAV A;  4QIW F;  1TAE A;  4UB6 Z;  1RM1 C;  4TQF A;  1QR9 A;  2CTQ A;  1HR0 O;  4ASU G;  2MK3 A;  1VQL V;  4UB8 Z;  4X88 A;  2ZE8 A;  1I08 A;  1Q82 W;  2P22 C;  4GT1 A;  1P4R A;  3IC7 A;  1NBM G;  4BR6 A;  1AB3 A;  3ZMS A;  3G71 V;  2Y0I A;  3JAR B;  2CE4 A;  5FPO A;  2GTA A;  1SQV H;  2MW2 B;  3JD1 A;  3AEI A;  3VOU A;  1GN2 A;  4YHH B;  5CBH A;  1IXM A;  2DOS A;  2NLJ C;  2UXD O;  3CRA A;  2CTW A;  4FM2 A;  3SPI A;  5FLX N;  5LMN B;  4TV9 A;  2A3Q A;  3S3X A;  2EIL C;  5IE9 A;  3KCY A;  4DR2 B;  2CH7 B;  4U7N A;  3OR7 C;  1QBZ A;  3QTC A;  4I5S A;  4U3J A;  1S3J A;  5KAI Z;  4I0X A;  3JAL A;  2DWE C;  3I55 V;  4X66 O;  3HKC B;  4H0L B;  1XEQ A;  4JI1 O;  4J11 A;  1Y74 B;  2UUB O;  1NS1 A;  3FKS G;  1SQQ H;  1M90 W;  1SZX A;  4PDV A;  5IWA B;  3JAW B;  2EZO A;  5IY5 C;  1FJG B;  1RPR A;  2YXL A;  3VQV A;  4TWK A;  3E8B A;  3AG4 C;  5CA3 A;  2LW1 A;  5JJJ B;  3JSN A;  3E89 A;  4RWU A;  2YDE A;  3HKB B;  1SC5 B;  1LNQ A;  3ZRV A;  1YXB A;  3ABM B;  2K1E A;  2UXC O;  3BA8 A;  4JAS A;  4DV6 O;  4X65 B;  1I5X A;  1RSO A;  2UXN A;  3OTO B;  3Q4H A;  5IJ0 B;  4NXN B;  4PEL A;  5IT9 N;  1NTZ H;  2RCV A;  2H3O A;  2QWP B;  3SYQ A;  4LWS A;  2QKA A;  1YI2 V;  3MHS C;  2JEU A;  3ZJZ A;  4MVZ A;  4LF4 B;  1P49 A;  4TV9 B;  2N74 A;  1SQX H;  1IBM B;  1COW G;  2JDI G;  1YJ9 V;  4FZ0 A;  1N32 O;  4GUN A;  1FXV A;  2IJJ A;  3IFX A;  2GUZ B;  1VQ7 V;  1SKV A;  1NH2 D;  1KYO F;  1JCH A;  4PI2 A;  4W4L A;  3SYA A;  2O57 A;  1FFX B;  1SQB H;  4JI2 O;  2Q8V A;  1D2D A;  3EHB B;  1Z2G A;  5KA5 A;  1IBL B;  1YCI A;  2GSM B;  4H13 B;  5LXT B;  4UVB A;  1H2G A;  1JFF B;  3ML0 A;  3KZI Z;  4OGQ B;  5BR8 B;  3CME V;  5LP6 C;  2PI5 A;  3CXC U;  3JD2 A;  2L35 A;  3JAL B;  1BE3 H;  1GM7 A;  1CPY A;  1IXB A;  5B1A C;  1RP3 B;  3APQ A;  1K9M W;  5HFL A;  3ZMZ A;  4PDL A;  5BMV B;  1EN5 A;  4LFA B;  1EFR G;  3K59 A;  2E76 B;  1B6Q A;  4CH5 A;  4DR7 B;  2WA4 A;  1HDJ A;  5FNV B;  4LNU A;  5JCO A;  1YJN V;  4OPA A;  5KUK A;  3E8G A;  1HNW O;  2W6I G;  4WFF A;  1OZ0 A;  3T1Y B;  1RSO B;  4JI0 B;  2CUG A;  3X2Q C;  2GDS A;  3OT7 A;  5BZB A;  1JFF A;  2QJ1 A;  2HEP A;  4MS2 A;  4Z2W A;  3N27 A;  4ZIB A;  4B7K A;  3GWK C;  3UO3 A;  1OCZ C;  1OV9 A;  5KHG A;  3HKE B;  1Q43 A;  4GCZ A;  5CBF A;  1UPG A;  4LF4 O;  1IDS A;  3RGB A;  4DXW A;  3F7Y C;  4UCO A;  3WFV A;  2Y69 C;  3AG7 A;  2ETN A;  1U96 A;  2FML A;  1K4D C;  1MAB G;  1R1B A;  2DJV A;  2JGD B;  3BAA A;  5L3C A;  4DV6 B;  1YHQ V;  2EZP A;  2CGN A;  1H2L A;  2CTR A;  3D3Q A;  2A0L A;  4JI0 O;  2EIL B;  1IZ3 A;  1DTO A;  4FM1 A;  2P5O A;  2QM7 A;  1BT8 A;  5EYP B;  4NB5 A;  2UXX A;  1X59 A;  2ZR3 A;  4K0K B;  1L0N H;  1KUQ A;  3RYF B;  4L8J A;  4HYO A;  1Z5V A;  3HKC A;  4JPR A;  4TT3 G;  2KSD A;  2GV9 A;  2X6A A;  2WLL A;  4DRX A;  3C90 A;  3E8F A;  1R6T A;  4K8Z A;  2V7Q G;  1DK1 A;  5H2F Z;  3JD4 A;  3BEH A;  1N0J A;  2ZQM A;  3W7X A;  5JCO C;  4IYH A;  1DF5 A;  3H1H H;  3T2M A;  4JYA B;  1H2M A;  3DTU B;  2IBZ H;  1NH2 B;  4K8X A;  4RAI A;  3CD6 V;  3HKB A;  1XDC A;  2Q7G A;  3CCQ V;  2FKX A;  5IYD O;  2YC0 A;  3ZHQ A;  1WNS A;  1SS3 A;  1R6K A;  4JAA A;  2CGO A;  1UFI A;  4IHJ B;  4XBF A;  3GB7 C;  3CC7 V;  4DV7 B;  4LF9 B;  2B1G A;  1SQG A;  4FLT A;  1BMF G;  1DF4 A;  5EZY A;  2DW4 A;  1ZWI C;  4YHH O;  3HB3 B;  1LUV A;  2ZD9 A;  1QLE C;  2K9P A;  4LF7 B;  3B8M A;  3L9D A;  5L3E A;  2QKC A;  4DR1 B;  5EBL C;  3MDS A;  2QWR B;  1XHZ A;  1N8R W;  2EIM C;  4A5U B;  1W2B U;  4UCU A;  2DYR C;  5GTI Z;  3F5W C;  5HFM A;  3OR6 C;  1F4N A;  4E2L A;  1ZSP A;  3G67 A;  4LF6 B;  4OPH A;  1BQZ A;  1VZY A;  5LA6 A;  3RYI A;  1VP7 A;  2JEX A;  3IC9 A;  3JAW A;  3CRR A;  4LP8 A;  3T4D A;  5JVD A;  2F23 A;  4WFG A;  3ZRS A;  5DN6 G;  5LGT A;  1XNR O;  1I94 B;  1EZV H;  1XBL A;  1GKF A;  2Y48 A;  4R50 A;  3GVM A;  3AG3 C;  2YEV A;  2Q6A A;  1R6N A;  2DWD C;  1F4M A;  2AHZ A;  1YDX A;  1W0K G;  1JMK C;  3APO A;  1XMQ O;  5IYZ A;  2JRI A;  1V54 B;  2YEV B;  2IH3 C;  3E22 A;  4P2Z A;  4JI5 B;  2IW5 A;  2LO1 A;  2UUA O;  2HP8 A;  2OT5 A;  3E86 A;  5DEC A;  4X64 O;  4O4J B;  4PD4 F;  3HPL C;  1TVK A;  3A0R A;  1YTF D;  1ORQ C;  4JYC A;  3TK1 A;  1WPB A;  4R8C A;  5LBQ A;  3H1K H;  3RN4 A;  3K58 A;  2YI8 A;  4FK5 C;  2E3C A;  3ZHT A;  2VQE B;  1N32 B;  3BCC H;  4LWS B;  4Q6G A;  3U10 A;  4IIJ B;  1WB7 A;  2XAF A;  3N2K B;  3G6E V;  4MVS A;  1NVP B;  4CBC A;  3ZHR A;  1P7G A;  2LW7 A;  1URF A;  3DXR B;  2ZM6 O;  3SPJ A;  1SA0 A;  1TUE B;  4BW9 A;  4QPK A;  3SJA C;  1Q6H A;  4HNA A;  3E22 B;  1MZF A;  1X4T A;  4N21 A;  2Q67 A;  1EN4 A;  2Z5U A;  1L0L H;  3P3N A;  2M7W A;  4F4L A;  2E5L B;  3UT5 A;  1QVF U;  4J7J A;  1OCZ B;  5H6Q A;  3L71 H;  2ZE6 A;  3EXA A;  5KMG A;  3SYP A;  3CX5 F;  1XUQ A;  1FXK A;  2ZT9 B;  2WWW A;  2ZIM A;  3EVK A;  3K0G A;  1VIB A;  2B9Z A;  1VQ4 V;  3G80 A;  1MZE A;  4DR2 O;  3T4Z A;  2ADP A;  2AGA A;  1H8H G;  2VRZ A;  4I0X B;  5JH7 B;  4J10 A;  1FPO A;  3N2G B;  2QTS A;  3UM7 A;  4TV8 A;  2QA4 V;  2FTK A;  4HZ3 A;  5CA1 A;  1IBK O;  4YJ2 A;  4BAY A;  5K1X A;  4B3M B;  2EIK C;  1K92 A;  1PV0 A;  4O2A B;  2HR3 A;  3LNM B;  1FAF A;  3ASO C;  1TVK B;  4EEQ A;  5GON A;  1ZL8 A;  2UU9 B;  4X1Y B;  1IBK B;  1NTK H;  4YIO A;  2Q0O C;  3W7U A;  2VWJ A;  1AR5 A;  1AI5 A;  4AHC A;  4KUM A;  3F5T A;  3I56 V;  3OGC C;  4AI8 A;  1FFX A;  3CCV V;  5BR8 O;  1OCO B;  1MSW D;  2F4V B;  5H6R A;  2X0L A;  4QPJ A;  3AG2 C;  4PA9 A;  2PYJ A;  5TIS Z;  1QQC A;  4YJ3 B;  1FFT B;  2WLI B;  2VWK A;  2P90 A;  1AI4 A;  3K08 A;  4UCT A;  1OCC B;  1R3I C;  1VQ8 V;  3L75 H;  4DO2 A;  2RNB A;  5ITZ B;  5CA1 B;  3B77 A;  4JI8 B;  4FLY A;  3W7W A;  4B3T O;  1NI8 A;  2BOB C;  4DV7 O;  4LF9 O;  1J95 A;  3FD9 A;  2F4V O;  4H33 A;  1YIJ V;  4WFH A;  4LNU B;  3CSX A;  2Y4U A;  3L72 H;  1JJO A;  3ZIA G;  2CK3 G;  1BZK A;  2WLN A;  1L1F A;  4WF9 V;  4MW3 A;  3LDC A;  2E74 B;  4BIU A;  1NR7 A;  3ZMU A;  2JVD A;  1VEW A;  1YF2 A;  1QHT A;  2ARH A;  4CH6 A;  2XND G;  1K5S A;  1GN6 A;  4X65 O;  4D7T A;  1N36 O;  1EN6 A;  4NXM O;  5JQG A;  4MTG A;  4X8A A;  3M8A A;  4WFB V;  2IJH A;  5JJN B;  4AIL C;  1Y76 B;  4MTO A;  3K5O A;  1H38 A;  4U7O A;  5BXZ A;  4WFA V;  4JI7 B;  4MSW C;  4UCS A;  1N34 B;  1Q81 W;  1BHA A;  4RQE A;  1MSD A;  1Z5W A;  5IJ9 A;  3PN1 A;  3RT3 C;  3TXS A;  2L6L A;  2H8P C;  5LHH A;  3JAT A;  3ABT A;  1QLE B;  5JVD B;  1JPX A;  1LUW A;  4JI7 O;  5LMN O;  3ASN C;  4PV1 B;  3ZMV A;  4ZOL B;  3G6B A;  2EIN B;  1JOY A;  2XUM A;  3ZHV A;  1QCE A;  4LFB B;  1Y74 A;  5J9P C;  2ADQ B;  3VQW A;  3OMN B;  3T1Y O;  4JI4 O;  4PA3 A;  4TQD A;  3RYH B;  1GM9 A;  4DR6 O;  2ITD C;  4X89 A;  3AG3 B;  3ETG A;  4JTA B;  5FL7 G;  3OTF A;  1HNX B;  4FZ1 A;  3B8N A;  1WA8 A;  4B3T B;  3AG4 B;  2HFE C;  4MVM A;  1VQ9 V;  5B1N A;  1XOU A;  3IJ4 A;  4J7Z A;  4LH7 A;  2ZR2 A;  3OW2 U;  3ZBH A;  2YXH A;  2ODM A;  5GON B;  2RDC A;  5EIB C;  4PI0 A;  1WA8 B;  1MMM A;  4ZBM A;  3RBZ A;  4HBN A;  4PHZ A;  4YY3 O;  2R72 A;  2WA3 A;  1EM1 A;  3K9A A;  1P7B A;  2HG5 C;  2QWQ B;  1AI6 A;  3OEH G;  3JAR A;  4DYL A;  1Q6I A;  4L87 A;  2W0X A;  5C8Y B;  3CRC A;  4MT8 A;  2QWN B;  2KG7 A;  4AQY O;  1A32 A;  1G6U A;  3K0D A;  4MVO A;  2AXT Z;  1J5E B;  3ZN1 A;  1VF7 A;  3ABM C;  4GX0 A;  2DE0 X;  1K5Q A;  3CCS V;  5JJE B;  3B2E E;  2VQE O;  2QM8 A;  2PGG A;  5LHG A;  3ZS8 C;  3SGI A;  3AK1 A;  1NT2 B;  3J7A U;  1PP9 H;  3OAA G;  4LF5 B;  4U3J B;  5CN0 A;  4DW0 A;  2LFR A;  1OHH G;  1N33 B;  4JI2 B;  3B09 A;  1Y76 A;  1VF6 A;  2ZDI A;  3BHP A;  4IGG A;  4FLV A;  2XAH A;  3PJS K;  2RN9 A;  1F23 A;  5IDJ A;  3DC6 A;  3AK3 A;  2AZ0 A;  5B1A B;  1SF9 A;  4ZKI A;  1N34 O;  2P6J A;  2VQF B;  2Q73 A;  2BSK A;  5C93 A;  2A79 B;  1N33 O;  1E1R G;  4RQF A;  3OUS A;  2ZKO A;  1WJZ A;  5KA6 A;  1Y67 A;  3ZX6 A;  4XDJ A;  2ZNI A;  1ZLZ A;  3RYH A;  5D5Q A;  3H1I H;  2UXB O;  3DSQ A;  3UCS C;  1AJP A;  2ZNJ A;  1H2S B;  4J7K A;  3SYC A;  4UVA A;  1MNG A;  1OCO C;  2CAZ C;  3K79 A;  4O4H A;  4DUY O;  5EK0 A;  4NTX A;  1YEW A;  2QWO B;  2HKO A;  3ZHS A;  3LSS A;  1M56 C;  1PNK A;  2BE3 A;  1AVM A;  2NNU A;  1GK9 A;  4K35 A;  4U3F H;  1E1Q G;  3UO2 A;  3BPZ A;  3AK2 A;  4X64 B;  2KG7 B;  3CPW U;  5IYZ B;  1S77 D;  4DV1 O;  2WSS G;  1FKA O;  3O9O A;  4WBN A;  2B5U A;  4UV9 A;  4P9P A;  1SRY A;  4KXR A;  2WLM A;  5B5E Z;  1D5N A;  3WB2 A;  1K7D A;  2BOC C;  1IVS A;  3HKD B;  5D5P A;  2ZDI C;  3JAT B;  3SDL A;  2UUA B;  2YIB A;  3DC5 A;  1VQ0 A;  2EX3 A;  1AP6 A;  1R73 A;  2E75 B;  2GTS A;  5E1A C;  3SPC A;  1PL0 A;  5JH7 A;  4PA4 A;  3U0Z A;  3CC2 V;  3RYI B;  3RVY A;  1KKC A;  1L8D A;  2UXD B;  3ASO B;  3T1C A;  4B3S O;  1NU1 H;  3BFR A;  1PNL A;  4Z1V A;  1SER A;  3D8C A;  4FFB A;  4GYC B;  3CP1 A;  2V4D A;  3S3W A;  4HNA B;  1WLE A;  5H5N A;  4GLX A;  4DR5 O;  3A0H Z;  1MG1 A;  1Q7Y W;  3T1H O;  3TJT A;  2CH7 A;  1TA8 A;  4FMT A;  2QEX V;  1YSC A;  3B4S A;  3E35 A;  5B1B B;  3CHX A;  5A2Q N;  5LHI A;  2PI4 A;  4DV2 B;  4X20 A;  3M7M X;  4B3M O;  1KP2 A;  1TGO A;  3JD0 A;  5DED A;  4O4L B;  1W0J G;  4NTW A;  1RM1 B;  3AG1 B;  2VQF O;  2R9A A;  1WPX A;  2WLH A;  4JAU A;  1Q3E A;  1HP8 A;  1ZL8 B;  4X62 O;  3HKD A;  5KHJ A;  1M4U A;  3ZRW B;  4X1I A;  1VQ6 V;  3SYO A;  1OJH A;  2CDY A;  4IYI A;  4Q20 A;  3A0B Z;  2FYU H;  1VQM V;  4GZR B;  1M57 B;  4LF7 O;  1GRJ A;  1CEZ A;  1K8A W;  3CS5 A;  4GX2 A;  2ZIN A;  1B06 A;  3W7T A;  4EFE A;  2PTM A;  4DUZ O;  4DK1 A;  2N04 A;  4PA6 A;  3CYO A;  2Q7E A;  2RMK B;  3K06 A;  1XQ8 A;  5LMU B;  1PM9 A;  2LP7 A;  3CMA V;  2WLI A;  4X20 B;  3L74 H;  1K73 W;  4JI4 B;  2UUC O;  1GN4 A;  3QO8 A;  1H8E G;  4GKK B;  4TOI A;  2XHB A;  2ZXW B;  4D7S A;  1NVP D;  1NQT A;  2W0F C;  3WB1 A;  1N0N A;  3RVZ A;  4MW8 A;  3JAM N;  4X9Q A;  5LGN A;  4GKK O;  1JA8 A;  3SPG A;  5FPR A;  4I4T B;  2QTO A;  4JYY A;  1FS0 G;  2Q5Z A;  1K97 A;  4X1Y A;  5CB4 B;  3JAK B;  4DV3 B;  3J80 N;  3WB0 A;  2HHH O;  5E79 Z;  3DGE A;  4JGS A;  1EZJ A;  5IJ9 B;  1RPO A;  3LNN A;  4CC6 A;  4J80 A;  4FLZ A;  1Q8I A;  1R3J C;  3OTO O;  3OGI B;  2IH1 C;  4LBE C;  1GM8 A;  4RO2 A;  4DV2 O;  1D5A A;  5H9C A; 
#chains in the Genus database with same CATH homology
 4PI2 A;  4I55 B;  4I4T A;  1FFX B;  4X1I B;  1JJO A;  3JAS A;  1XNR B;  3RYC B;  1IBL B;  3VQX A;  1Q5O A;  4DR5 B;  5LXT B;  4DK0 A;  5BMV A;  1JFF B;  4EFB A;  5BR8 B;  5LP6 C;  2JVD A;  2F66 C;  4UCV A;  1QHT A;  3A2F A;  4CH6 A;  3QF7 A;  3JAL B;  4O2B B;  4D7T A;  1XMO B;  4LH6 A;  5JQG A;  5BMV B;  1XI1 A;  3RYC A;  4DV1 B;  4LFA B;  3K59 A;  2JGU A;  3BAB A;  4CH5 A;  4DR7 B;  5JJN B;  4AIL C;  3SR2 C;  3K5O A;  4FVM A;  5FNV B;  4LNU A;  2HHH B;  2JS5 A;  5JCO A;  4TV8 B;  2PUS A;  4CS3 A;  4JI7 B;  2Q0A A;  4FM0 A;  4UCS A;  4F6R B;  1N34 B;  5CB4 A;  1Z5W A;  3T1Y B;  5IJ9 A;  3PN1 A;  3CB2 A;  4JI0 B;  4TUY B;  5C8Y A;  3JAT A;  1JFF A;  2QJ1 A;  2HEP A;  5J2U B;  5JVD B;  1S5J A;  3N2G A;  1SQF A;  4KL1 A;  4ZOL B;  4ZIB A;  3RFR A;  3HKE A;  2RJZ A;  5KHG A;  3HKE B;  3ZED A;  4LFB B;  5LOV A;  3VQW A;  1Q43 A;  4DR4 B;  4TQD A;  3RYH B;  4DUY B;  4FLX A;  2KKW A;  4GKJ B;  3RGB A;  4UCO A;  4OX9 B;  3OTF A;  3BRC A;  1HNX B;  1HNZ B;  4B3T B;  3RYF A;  3BAA A;  5ITZ A;  4DV6 B;  4ZI7 B;  5EYP A;  4LH7 A;  3QG5 A;  5CA0 A;  4AQY B;  4JI6 B;  5GON B;  5EIB C;  4PI0 A;  4DRX B;  4FM1 A;  2P5O A;  5KX5 A;  4HBN A;  4PHZ A;  4ZOL A;  4LF8 B;  2R72 A;  4I55 A;  5KHH A;  4FFB B;  5EYP B;  3K5N A;  1B04 A;  4K0K B;  3RYF B;  4YY3 B;  4L8J A;  3JAR A;  1Z5V A;  3HKC A;  5C8Y B;  2GV9 A;  4X1K B;  4NVP A;  4DRX A;  5J2T A;  1G6U A;  2YIB D;  4ZHQ B;  4K8Z A;  4F6R A;  1O9G A;  1J5E B;  1VF7 A;  3JSL A;  4O4I B;  5JCO C;  4EB6 A;  5JJE B;  3B2E E;  4JYA B;  2PGG A;  4K8X A;  2ZM6 B;  3ZS8 C;  4BWA A;  3SGI A;  3UQ8 A;  3HKB A;  1NT2 B;  2Q7G A;  4LF5 B;  4U3J B;  4O2B A;  4DR6 B;  4CH3 A;  4JV5 B;  4O4L A;  1WNS A;  2F93 B;  1N33 B;  4JI2 B;  2BTQ B;  5LOV B;  5CA0 B;  3ICX A;  4IHJ B;  4IIJ A;  3BHP A;  4CS2 A;  3K5L A;  4DV7 B;  4LF9 B;  4FLV A;  1SQG A;  4YJ2 B;  1N36 B;  4FLT A;  4B3S B;  4CH4 A;  1M5I A;  5EZY A;  4IHJ A;  3VQY A;  1HNW B;  1WN7 A;  4LF7 B;  2VQF B;  5KMG B;  2BTQ A;  4DV0 B;  5LA6 B;  4DR1 B;  1XHZ A;  5J2T B;  4UCU A;  4FLU A;  1KU9 A;  1HR0 B;  1T5E A;  4I50 B;  1TUB B;  2RQ6 A;  2ZNI A;  3RYH A;  4O4J A;  2PZS A;  5D5Q A;  2QM4 A;  3K5M A;  4FLW A;  4WBN B;  3DSQ A;  1XMQ B;  4I9Q A;  4LF6 B;  2F95 B;  2OWO A;  1VZY A;  2ZNJ A;  1H2S B;  5LA6 A;  2YIA A;  3FFQ A;  5LYJ A;  3RYI A;  4X66 B;  4ZHQ A;  4CC5 A;  3JAW A;  2UUC B;  5JVD A;  5J2U A;  2UXC B;  4B3R B;  2CAZ C;  4O4H A;  5EZY B;  1I94 B;  4TUY A;  4O4I A;  3MAQ A;  1YEW A;  4UFZ A;  2R70 A;  4KHP B;  5JQG B;  3BPZ A;  4X64 B;  4LFC B;  1JMK C;  3UT5 B;  4DV5 B;  2F1M A;  4JI3 B;  1I7F A;  5IYZ B;  3SJB C;  5IYZ A;  4O2A A;  3N2K A;  3E22 A;  4WBN A;  1ZAU A;  4JI5 B;  3WB2 A;  3BA9 A;  4JI1 B;  2UUB B;  1M93 A;  3HKD B;  5D5P A;  4O4J B;  3JAT B;  4UCR A;  2UUA B;  1VQ0 A;  2YIB A;  1TVK A;  2PY5 A;  2EX3 A;  4I50 A;  4DUZ B;  1XNQ B;  4ZI7 A;  5JH7 A;  3U0Z A;  3RYI B;  5LYJ B;  1L8D A;  1WPB A;  5FNV A;  2UXD B;  3JAS B;  3JAK A;  2ZIO A;  4O4H B;  5LP6 B;  3K58 A;  2YI8 A;  2E3C A;  4FFB A;  4GYC B;  1TUB A;  2V4D A;  2VQE B;  1N32 B;  4HNA B;  4Q6G A;  3U10 A;  4IIJ B;  4GLX A;  3N2K B;  3U11 A;  2UXB B;  1TAE A;  4TQF A;  1TA8 A;  3CHX A;  4DV2 B;  3T1H B;  4X20 A;  3M7M X;  3IAY A;  1SA0 A;  1TGO A;  3ETQ A;  5KHK A;  2P22 C;  4O4L B;  4BW9 A;  1KMI Z;  3SJA C;  4HNA A;  3JAR B;  1DGS A;  3E22 B;  1X4T A;  5FPO A;  5KHI A;  2R9A A;  1Q3E A;  1D5A A;  4YHH B;  3THO A;  2E5L B;  2YI9 A;  3UT5 A;  3HKD A;  3RWR D;  4YJ3 A;  5KHJ A;  1XHX A;  4FM2 A;  4X1K A;  1M4U A;  4X1I A;  5LMN B;  4TV9 A;  5KMG A;  4DR2 B;  2ZIM A;  2PYL A;  2IM9 A;  4LR3 A;  4B08 A;  3QTC A;  4U3J A;  5JH7 B;  2OYQ A;  3N2G B;  2ZIN A;  3JAL A;  4EFE A;  2PTM A;  4DK1 A;  4TV8 A;  3HKC B;  5CA1 A;  2Q7E A;  4YJ2 A;  1HW7 A;  3K57 A;  1XQ8 A;  5LMU B;  5K1X A;  4B3M B;  5IWA B;  3JAW B;  4X20 B;  4DR3 B;  4JI4 B;  1FJG B;  4O2A B;  4GKK B;  1TVK B;  4TOI A;  4EEQ A;  2XHB A;  4D7S A;  5GON A;  2UU9 B;  2Q7H A;  4X1Y B;  2YXL A;  1IBK B;  3VQV A;  5EIB D;  2VWJ A;  3WB1 A;  4AHC A;  5JJJ B;  3JSN A;  3HKB B;  4X62 B;  1O9H A;  1FFX A;  5FPR A;  4I4T B;  2BTO A;  3BA8 A;  2F4V B;  4X1Y A;  4X65 B;  5LP6 A;  5CB4 B;  3JAK B;  4DV3 B;  5LXT A;  3WB0 A;  5IJ0 A;  1RSO A;  3OTO B;  5IJ9 B;  2PYJ A;  5IJ0 B;  4NXN B;  1QQC A;  4CS4 A;  4YJ3 B;  4EB6 B;  3LNN A;  2VWK A;  4UCT A;  1V9P A;  4LF4 B;  1P49 A;  4TV9 B;  4NXM B;  4CC6 A;  5ITZ B;  5KX5 B;  5CA1 B;  1IBM B;  4FLZ A;  4JI8 B;  1Q8I A;  4FLY A;  1SA0 B;  4DV4 B;  5K1P A;  2ZCE A;  3SJC C;  1SKV A;  4LNU B;  3CSX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...