1I7FA

Crystal structure of the hsp33 domain with constitutive chaperone activity
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
228
structure length
228
Chain Sequence
HDQLHRYLFENFAVRGELVTVSETLQQILENHDYPQPVKNVLAELLVATSLLTATLKFDGDITVQLQGDGPMNLAVINGNNNQQMRGVARVQGEIPENADLKTLVGNGYVVITITPSEGERYQGVVGLEGDTLAADLEDYFMRSEQLPTRLFIRTGDVDGKPAAGGMLLQVMPAQNAQQDDFDHLATLTETIKTEELLTLPANEVLWRLYHEEEVTVYDPQDVEFKCT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEAT SHOCK PROTEIN 33
publication title Crystal structure of proteolytic fragments of the redox-sensitive Hsp33 with constitutive chaperone activity
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone
total genus 45
structure length 228
sequence length 228
ec nomenclature
pdb deposition date 2001-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01430 HSP33 Hsp33 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.480 Mainly Alpha Orthogonal Bundle Helix Hairpins helix hairpin bin 1i7fA02
3.55.30.10 Alpha Beta 3-Layer(bab) Sandwich Hsp33 domain Hsp33 domain 1i7fA01
1HW7A 3M7MX 1VQ0A 1I7FA 1VZYA
chains in the Genus database with same CATH superfamily
4GZRB 2E3CA 3LSUA 5JWPA 4ZHQA 1XNQB 4CH6A 2UUCO 3W7XA 2LFRA 2BE3A 1ZAUA 1XUQA 4UV8A 3RW0A 1QQCA 4WFHA 2OCHA 1VMGA 1OCOB 2LQTA 3A0RA 3G6BA 5A9GA 4YJ2B 4ZBMA 3ZHQA 4MW8A 2EX3A 3JAMN 2OCCB 4UFZA 3ZBHA 2KKWA 2JVDA 1R6KA 5GW7A 3CHXA 4B08A 4FM0A 2E5LB 5LBQA 3LSSA 3X2QC 1JJ2U 4LFBO 4PJ0Z 5FNVA 1M56B 1WP8A 3OTFA 3E83A 3KG2A 4I55A 4TWKA 4YIOA 2L35A 1WA8B 1XHZA 1HNZO 2X6BA 3ZHTA 4JI0B 3OMAB 1XMOB 2MK3A 2F4VB 4EEQA 4X66B 1OCOC 3C3SA 5L3FA 3AG2B 4F4LA 2B1IA 1IBMO 3HKDB 3CX5F 4BWAA 5J2UA 4O4JA 3SYAA 2UXCO 2QSAA 5KUMA 2XAFA 1K5QA 2Q73A 1DLBA 5GONB 2XNDG 5JH7A 3N27A 2FL4A 2RCVA 3WB1A 1M56C 4Z1VA 4IYHA 5B66Z 2ITCC 4O4HA 4FPPA 1AR4A 4MVRA 4ASUG 4EFBA 2JS3A 4MTOA 1L1FA 3ABMC 1R3JC 2QDOA 5H6RA 3W7TA 2BOBC 3R66A 3P30A 2P90A 4WBNA 4TUYB 3QTCA 3GB7C 4KP4A 3AG2C 3J80N 2UXNA 3EXAA 3RYIA 3FB8C 3H1LH 1WJZA 5CA1B 4PDVA 1TUBA 1KP3A 4EKWA 4DV0O 2PY5A 3AG4B 3KZIZ 2LP7A 1HNXB 1VQPV 1AJNA 3D8CA 1GN6A 1Z5WA 3ZMSA 1R3KC 1K4DC 4FLXA 3FAVB 2M7WA 4OPAA 4YY3O 2DYSB 5IJ0B 3HKCB 4D7SA 1XL4A 5B1AB 2YI8A 2Q7EA 1XOUA 3E89A 4CS2A 1IBLB 4CS3A 1J5EO 3K3WA 4HBNA 4AI8A 4IHJB 5ITZA 2ZXWB 4RQFA 1SQGA 5F2VO 3S3WA 5JQGB 1RSOA 4K8XA 3AG4C 1NBMG 4BW9A 2HHHB 3L70H 1Q43A 2IJIA 1SKVA 4UVCA 1QR9A 2JDIG 1YHQV 2OIGA 1AI5A 1I7FA 3OW2U 4BAYA 3OGIB 1YVWA 5JVDA 2ZE8A 4J80A 1Z2GA 5B1AC 2Q7GA 4J9YB 3JCUZ 2EILB 1PNMA 4NR1A 4FK5C 1F4MA 3UKMA 2UU9B 1D2DA 1F23A 2ZXWC 2N04A 1SERA 1NTMH 2Q9LA 1EN6A 4MVMA 3MAQA 2XOKG 2QKAA 3K79A 4PI0A 3VBBA 3PN1A 2ZDIC 2OTLV 3F5TA 5CB4B 3N2KB 4PDMA 3LNMB 4LF8B 3J7AU 1WPXA 4HAMA 4UCUA 1N34O 3TK1A 1Q90D 5EBLC 4UVBA 3UT5A 2JEUA 2VQFO 2EILC 1H2LA 2LGWA 5FPOA 5KMGB 1CXZB 1SRYA 3TETA 3U0ZA 2HJDA 1JCHA 4JI3B 2IU0A 1N33O 2WLIB 1EN4A 2EINB 1S76D 1EZJA 1Y66A 4LF4B 2ZR3A 5BR8B 3DXRA 2XT9A 4O4LA 3TXQA 4X1IB 3D36C 5DM6V 4DV1O 3CJHA 1NKDA 1DF4A 3CRCA 1IBKB 1Q6UA 2XAQA 3W7UA 2KSDA 4X1YA 3T1CA 3C3TA 3JAWB 4B3TO 1Q81W 3CS5A 4OX9O 3H9VA 2DE0X 4RUEA 1TGOA 4DRXB 2HEPA 4ZI7B 3OTOB 4JI4O 2QTSA 2BSKB 2JRIA 1LUVA 2QWRB 1EN5A 3QNEA 3H1HH 1M57B 2F1MA 1BS3A 2ZINA 3L71H 1L0NH 3L75H 4MTFA 3Q4HB 3STZC 5LP6B 1FXKB 1H2SB 4HNAA 3IAYA 1LUWA 1W0JG 1AILA 4OGQB 4QPJA 3JASB 1YITV 4E2LA 4DR3B 1ROPA 3G80A 4YHHO 1N32O 2IH1C 1HR0O 4YJ3B 3QO7A 2DYRB 5KX5A 1QU7A 3HB3B 1VQ5V 1D5NA 4JI7B 1NS1A 4UV9A 1M57C 1QLEC 3K5MA 1VF7A 4FLZA 3EFFK 2AZ2A 2E5LO 4L8JA 1JFFA 2HLDG 1VEWA 5LP6C 2Q0AA 1FXKC 4ICGA 2PI4A 2RNBA 2F95B 3CSXA 4CBCA 2P06A 3E8HA 5BMVA 4X89A 1JX9A 4JAAA 1HNWO 2HFEC 3RYHB 1H38A 4JI0O 3SYPA 1XMOO 2DYRC 4AQYB 2D3OW 4U3JA 2YIAA 2A79B 4PA6A 1N0NA 3VQWA 2DN9A 3BY6A 2W6IG 4DR5B 1BMFG 4DW0A 3BCCH 2RN9A 1Y67A 2XAGA 2LW7A 1NR7A 2PF4E 4MS2A 1BZKA 4XDJA 1LR1A 4GX5A 3ML0A 3FYIB 5IWAO 2CTWA 3CRQA 1YTFD 3RYCA 4F6RB 2RQ6A 2JK5C 4FFBA 4MW3A 1MA1A 5B1BB 3SPCA 2KB1A 4DV5O 1VF5B 4DUYB 2F43G 3SPGA 3ZHVA 2A0LA 5LMUB 2PUSA 3R65A 3T1YO 2Q8VA 3HKEA 3B8NA 1AI6A 1VQ7V 4B3SB 3ZIAG 4EB6B 3SYCA 1BGYH 5IDJA 2LJ2A 1BL8A 4DV4B 1XQ8A 3OMIB 2WLLB 2ZKOA 1ZLZA 2BCCH 3E22A 3M99B 1JOYA 2VWJA 3RT3C 4TQFA 3GWOA 3T1HB 3ZRWA 3QF7A 2KG7A 3M8AA 4QPKA 2QM4A 1U96A 4UCRA 2JEXA 5B1BC 2P67A 1WLEA 2NNUA 2UXDO 3P32A 1I0HA 4UCVA 3M7MX 3W7SA 1NVPB 2DQ0A 4CH3A 4IYIA 5KHJA 4C7UA 2HHHO 1KD1W 1THZA 4LH6A 1SF9A 4A5UB 5H9CA 2F23A 4ZIBA 5C8YB 4NB5A 5FNVB 5BY1A 2G38A 1NZ6A 3JSNA 4WF9V 2BOCC 2YEVA 3UO3A 3ZRVA 1YCIA 3IFXA 5LMNB 4X65B 5IJ9B 4JZGA 2ILMA 3FX7A 1KKCA 1SS3A 5E79Z 1G1XB 4BIOA 1R3LC 2CGOA 1R6NA 5IYZB 3FKSG 1VP7A 4LNUA 4FVMA 2LGQA 2UU9O 4O2AB 1SQXH 5D5PA 2QGNA 4X9QA 1AJQA 1VZYA 4D7TA 5KHHA 4FLUA 3CCLV 3E8GA 2P4VA 1FS0G 4PA4A 1IXMA 1YI2V 2GTSA 1XI1A 4LF7O 1URFA 4QE7A 2ZQMA 4I4TB 3JD4A 1PNLA 2DOSA 3SDLA 1AJPA 1KECA 2YXLA 4UCTA 3TGUH 2XAJA 1MMMA 1OCRB 4B7KA 5K1PA 1PM9A 3IC7A 2ITDC 5HFLA 3JARA 4TSFG 1GH6A 4FLWA 1CPYA 1FAFA 4R8CA 3SJAC 1LNQA 1K8AW 3CMAV 4LWSB 5DECA 3E2EA 4LF4O 3HKBB 3N2GB 5EC1C 2EJRA 5CA0A 2KQXA 4BIUA 2ATKC 3O65A 3JATB 5EYPA 1K4CC 4R50A 1YDXA 4DO2A 1Q7YW 3G71V 3ABKB 1RM1B 1DF5A 2ZNJA 4J11A 1P4RA 4GX1A 2EULA 5J9PC 1NTKH 3CRMA 4X1KA 1FFTB 2IJKA 1OCRC 4L87A 5LYJB 3OTOO 4JI8B 1BSMA 1YZBA 1FJGB 4O4IA 2DWDC 1ZSPA 2Z3YA 3JALB 1BT8A 1Q86W 4MVZA 4MVOA 2PTMA 5LOVA 4NXMO 4I50A 3U10A 2JIZG 5L3DA 2UUBO 2CUGA 2DW4A 5KLVH 1RM1C 3WU2Z 4X8AA 2DWEC 5KAIZ 1VQ9V 5EC2C 1I5YA 3DC6A 1AP6A 4B7EA 2IW5A 3H1IH 4PA9A 1WB7A 3K9SA 1O9GA 3B8MA 1SZTA 4JI2B 1WB8A 4W4LA 4JI1O 3SYQA 1TVKA 4IGGA 2OCCC 4DK0A 1PV0A 4TT3G 4I0XA 5KA5A 3B2EE 1KYOF 1DGSA 1DK1A 1KC8W 2A9HA 3K5LA 4N21A 4O2BB 1K97A 4JPRA 4DW1A 3SPIA 2P7TC 3I5DA 1DTOA 3UT5B 3G67A 3JCZA 2RMKB 1KKDA 1M5IA 1D5AA 1NTZH 2W6JG 2Y0PA 5B5EZ 1J95A 2GSMB 4QJFB 5B1OA 1MSDA 1S5LZ 1VF6C 4GKJB 1FD9A 5TISZ 1IURA 5D5QA 3OAAG 2ADPA 4R7CA 5EIBD 3I55V 1N36B 2NLJC 2QWNB 5LHHA 2YS8A 1Y74A 2EIMB 2CTQA 3T4ZA 2CTRA 1P49A 1I94O 1OZ0A 4TOIA 2A06H 2PI5A 2P4KA 3OT7A 4FLTA 1SETA 2IH3C 4GX2A 3ZX6A 1PD3A 3AG3B 2NR5A 1YF2A 3C90A 4X20A 4DUYO 3UCSC 4WFGA 4KHPB 4BW5A 4DR2O 5LMUO 2RDCA 2JGDA 3SGIA 5J2TB 2CE4A 3LDEA 4PD4F 1S5HC 3OM3B 3K5OA 4FFKA 2H8PC 1M93A 4UVAA 5EZYA 4MVSA 4DR7B 2EIMC 2QKSA 4LF6O 2UUAB 1FFXB 2CH7A 5KHKA 5B3SB 2WPDG 4LR3A 4HNAB 3FB5C 4PA3A 1KB9F 2FTKA 2ZT9B 4DV2O 3NXSA 1WP7A 4GUNA 1S3JA 4CC6A 4NTWA 2DYSC 2ZCEA 1XDCA 1VQMV 1SQBH 1VQKV 3WG7B 1L0LH 4YJ2A 4AHCA 5EBWC 2MW2B 5LXTB 3APOA 5JCOC 2JJ1G 2OYQA 1E79G 3SJCC 1GM9A 1NJIW 3AG7A 3L72H 1VARA 5B3SC 1XHXA 5KUKA 4DR6B 4YIPA 5GTIZ 2PGGA 1WA8A 4LF9O 3F7YC 3DTUB 1QLNA 1K3EA 1XBLA 4LF5B 4X64O 1M1KW 1MSWD 3SYOA 3B77A 5LA6B 3WG7C 3HKDA 4X62B 4JV5B 1GKFA 4DV3O 1WAZA 1GN2A 1BCCH 1XL6A 4JF3A 4TV8B 1O9HA 2OIEA 5LGUA 1SA0B 5H2FZ 4G2KA 3ABTA 1ZWIC 2UXBO 2XASA 5GONA 1OHHG 4JYAO 1Q8IA 4DR4B 1X4TA 2ODMA 1VQ4V 2OTJV 1T5EA 2ZM6O 3JAKB 5LGTA 3THOA 3ABLB 4PV1B 2YXHA 2EIKB 4P9PA 2BTQB 3CMEV 1I08A 4U7OA 4TUYA 3OUFA 2HVKC 1KQSU 2YC0A 3W7WA 4YXWG 4MTXA 3UM7A 4OXSA 5CA1A 2FYUH 5H6QA 4B3RB 2GTAA 3BA8A 4JTDB 4W4KA 4QIWF 1QBZA 4P2ZA 3AK1A 2EINC 4KFMA 2PZSA 3ABLC 3ZRWB 1JR9A 4JI5O 4H0LB 4LCUC 2EIKC 1V55B 3FAVA 2XHBA 4WFFA 4ZOLB 2UUCB 4Q6GA 4J10A 5IJ0A 3RYFA 3ZCCA 4LFAB 3QO8A 3K04A 4P30A 3RWRD 1GRJA 1XNQO 1QR8A 3J81N 2YUAA 3CC4V 1A32A 4Q20A 4IIJB 1P84F 2WSSG 2ETNA 5CBGA 1Q82W 5JQGA 1S0VA 3VQYA 3VQVA 4RQEA 1YEWA 2Q68A 2ZDIA 4FLVA 3P3PA 2GUZB 1V55C 1FPOA 4QNHB 1RP3B 4NXNB 3ZRXA 3IC9A 1YJWV 2R72A 3ICXA 2WA3A 1YTFB 4OPHA 2HG5C 4DR1B 2QJ1A 3MDSA 2WAMA 1IBMB 3WFVA 1K73W 1ZL8B 2F4VO 4FZ1A 3CCJV 4I5SA 5JJNB 4X66O 2HR3A 2UXCB 3F7VC 1NR1A 3ZMTA 1EM1A 1FYJA 1MOFA 3QVNA 1K92A 3AEIA 3RGBA 2HP8A 3D36A 2B5UA 3N2KA 5CB4A 1COWG 1TAEA 4H13B 3MHSC 1VQNV 4DYLA 4AILC 4NYKA 4JTCB 3CB2A 2ADQB 2YIBA 5KMGA 1MG1A 4DK1A 2YSUB 4MT8A 2R9AA 3QO5A 1GO3F 2WLIA 4H33A 2ZR2A 1WPBA 3I56V 1K5SA 3KCXA 5KAFZ 3T4DA 1Q6HA 2EZPA 5HFMA 4TV9B 3HPLC 1K34A 3CP1A 1IXBA 1AR5A 4B3MB 2DQ3A 5EBMC 2WLKA 3ASOB 3JAWA 1HNXO 3G4SV 4FM2A 4YY3B 1SESA 2JJ2G 1KUQA 2QM8A 2H94A 2QA4V 3U11A 5IT9N 1ORQC 4ZHQB 1J5EB 1R3IC 4DRXA 4ZI7A 3LSQA 3K08A 3OEHG 2BSKA 3CCVV 1IBLO 4K35A 3BRCA 1KBHA 5FL7G 1WNSA 3B4SA 2L6LA 3JD2A 1K9MW 2GHYA 2JS5A 1S77D 3IGAC 4XDLA 1HW7A 3Q4HA 5LP6A 2WA4A 1FXKA 3DSQA 5BXZA 2ZE6A 3ASOC 3BHPA 2FMLA 2QTOA 2HJFC 3JASA 2V1DA 1G8MA 1Y6XA 4I55B 2B9ZA 5B1NA 3FB6C 3CCUV 1N8RW 3ZS8C 4NKGB 1SQVH 2K9PA 2FKXA 5K1XA 3E8BA 1F51A 4LH7A 2R9RB 1QNMA 1K33A 2XTAA 5J2UB 4O4JB 2PYJA 3JD3A 2LFSA 2Z0AA 1JVMA 5JH7B 4DR6O 2VWKA 3RYHA 2K1EA 4LF8O 2P5OA 4O4HB 4LF5O 3RFRA 4GCZA 2VQFB 3CCQV 2WLJA 3CEIA 4UCSA 1IDSA 3A2FA 1JA8A 4WBNB 2QM7A 4J9ZB 5FLXN 1AROP 1VIBA 1N33B 3FFQA 1YJ9V 1Y76A 3RYIB 1QVGU 1NH2D 3CCEV 2QEXV 3K0DA 3CXHF 1TUBB 4JI3O 2Q6AA 4DR4O 1KMIZ 4DUZB 4FM1A 5BR8O 2IU3A 4DV1B 5LHIA 3OGCC 3E86A 4I9WA 4JI6B 3UO2A 4B3TB 4F6RA 3SR2C 3TJTA 1IBKO 2YICA 3ZRSA 4OX9B 4WFEA 1KU9A 4IL6Z 4LC1A 3ZMVA 4P9OA 3CCSV 4JI4B 4X88A 1GM8A 1Q5OA 2VRZA 4TQDA 1V9PA 4J42A 4EB6A 3E8FA 4GLXA 1OJHA 5ITZB 4G27B 2WLLA 1RSOB 3IJ4A 1Y4MA 1SQPH 4RUFA 3HR0A 4PHZA 2AHZA 2V4DA 5E1AC 1ZUQA 1PL4A 2P6JA 4Z1MG 1FXHA 3ABKC 4LFAO 2R9IA 4KXRA 4YHHB 1N32B 5JVDB 3KCYA 4DV6B 1HR0B 1K7DA 3ETGA 2RJZA 4DR3O 3RVYA 4Z2WA 1BQ0A 2OT5A 4JGSA 1UFIA 1JMKC 3VQXA 1H2KA 1GMGA 4PA7A 4BR6A 1CEZA 1M9NA 5C8YA 1VQ8V 4JI7O 2GDSA 1VQ0A 3DC5A 1N0JA 1RFYA 1ZX3A 2V7QG 3BVOA 4NXNO 5IJ9A 1HNWB 4J7ZA 3ABMB 4JAUA 4DV7B 1FXVA 3H1KH 4DR1O 5IYZA 1B6QA 3D3IA 5CBFA 1SQFA 2AHYA 4AQYO 2ZE7A 4O2AA 1G4YB 1AVMA 3QG5A 3OD4A 2YDEA 1P7BA 5FPRA 4DR5O 1GM7A 1PKXA 2OWOA 2X0LA 2YIDA 5EIBC 5IYDO 2YXYA 4GT1A 3CCRV 3DXRB 1XEQA 3K5NA 2IBZH 3NR7A 2Q4PA 1MNGA 4O4LB 3WB0A 5IWAB 5L3GA 3ABUA 4R6ZA 1MZFA 3CJHB 1HDJA 4I4TA 3B40A 5DEDA 4X1YB 1SQQH 2LW1A 1IZ3A 4DV5B 4LFCB 3LDDA 3K9AA 1N4CA 4XDKA 1H8HG 3T1YB 1QCEA 2HVJC 4U7NA 2ARHA 5CN0A 2NN4A 1OV9A 2JGUA 1XMQB 3ZMUA 4LWSA 3HKBA 1JJOA 3N2GA 2F66C 3K58A 2FB5A 3ZMZA 4UUJC 4B3SO 4UB8Z 3JATA 4J41A 1JQ0A 1L8DA 1SZXA 2VQEB 4DV4O 2WLMA 4CH4A 2GBOA 4U3FH 4B3MO 1QHTA 2ZIOA 2QWOB 3RYFB 2PYLA 3T1HO 1Q6IA 1BHBA 2Y69B 2UXDB 5LYJA 3AG3C 3FD9A 5KA6A 3JALA 2N74A 3L74H 2CTPA 5KX5B 1UPGA 2AW9A 3GVMA 3MHHC 4ZKIA 1WN7A 3S3XA 2QWPB 2P22C 1M90W 4GKKB 3WB2A 4RAIA 4MVUA 1JFFB 3OR7C 1PL0A 3ZHUA 3A0HZ 3FB7C 3SPJA 1FKAO 1JPXA 3CE2A 4NTXA 5LL6Y 3CYOA 1S5JA 2Y69C 5BMVB 5LMNO 2Y0IA 4X65O 5GTHZ 1VQLV 1NI8A 3VOUA 5AG2A 4U3JB 1VF6A 1U97A 3K03A 1BE3H 1RPRA 4K0KB 2DJVA 1V54B 4MTGA 4DXWA 2BTOA 5KHIA 4H44B 4CZZA 1F4NA 1MABG 1CP9A 4UCOA 2C2AA 3F5WC 4LF7B 3CXCU 4E4EA 4O2BA 3ETQA 3B09A 5JJEB 5DN6G 4FLYA 5BZBA 1XNRB 2GV9A 3OE7G 3RYCB 3ZN0A 2LO1A 1H2NA 2Q7HA 4FFBB 1PNKA 3OR6C 1IVSA 1V54C 3HKEB 3GWKC 1BHAA 5LGNA 2N05A 3K0GA 3MD0A 2QR4A 3AG1B 2E76B 3CCMV 4DUZO 1OCCB 4WFBV 3JD1A 4I9QA 4F6EA 3AK3A 3ETEA 5C93A 1BQZA 4JI6O 3E22B 5L3EA 3RBZA 2Q69A 3LNNA 3BA9A 4MVQA 2KG7B 1R73A 2YIBD 2WLHA 1YXBA 2XUMA 2Y4UA 4ABMA 2HKOA 3HKCA 4I7ZB 3K06A 5J2TA 4UB6Z 4JI8O 5JCOA 1FJGO 1QLEB 4IHJA 2AGAA 4FJCC 4H37A 4NXMB 4BIZA 3AG1C 1OCCC 4JAVA 3ETDA 2UUBB 3D3QA 4GYCB 3T2MA 2VS0A 1FFXA 2F93B 4LBEC 3K57A 2X6CA 2W0FC 1S72V 4LFBB 4PDLA 3SJBC 4NTYA 4JYYA 2YEVB 1AI4A 4DV6O 2Z5UA 4G28B 1HWYA 2B1GA 1HNZB 3BAAA 2AXTZ 4PI2A 4LNUB 5LXTA 2M6YA 2E75B 1X59A 2IJHA 1AB3A 2AZ0A 5L3BA 4JYCA 2EBOA 4J7KA 4JI1B 4MSWC 4JI2O 3AK2A 3L73H 5JJJB 4QE9A 1XREA 2X7RB 3JSLA 4CH5A 3H1JH 4EFEA 4DV7O 3EHBB 5EK0A 4KL1A 4CC5A 1H2GA 5LA6A 5CBHA 1AR1B 1GN4A 5LHGA 2QKCA 1NU1H 4TV8A 1Y76B 2A7WA 3OMNB 4GKJO 1SA0A 3JARB 3A8TA 1YIJV 1NQTA 1YJNV 4DV0B 2QWQB 4PELA 1Q3EA 2ZE5A 1EBOA 5IYCO 3PJSK 5CA0B 4N23A 3JAKA 2EJ7A 1I94B 1N36O 5EYPB 4X1IA 4LP8A 1M4UA 2BTQA 1GTOA 2H3OA 3EVKA 1W59A 3BFRA 2XAHA 1EZVH 4LFCO 3FYEB 4DR2B 4X1KB 1H2MA 1IX9A 1XMQO 3APQA 4XBFA 4KHPO 4HYOA 2X6AA 2WWWA 3CPWU 2Y48A 3JYCA 4O4IB 5KHGA 4FIPC 3ZJZA 2ZD9A 2VQEO 5LOVB 2R70A 4LF6B 1PPJH 3TXSA 1AI7A 2ZNIA 4I50B 4DR7O 1Z5VA 3DGEA 1B04A 3CRRA 1XILA 2O57A 5IE9A 4DV2B 2UUAO 4ZOLA 1RPOA 2Y4TA 1NT2B 2IJJA 2WLNA 4D6TH 4K3AA 3BABA 3H01A 2Q67A 1W0KG 1ZTEA 2IM9A 4IIJA 4CS4A 5IYBO 1G6UA 4YJ3A 5H5NA 1P7GA 3CRAA 3L9DA 2W0XA 5CMUA 4FZ0A 3KKYA 4QGPA 3ZHSA 1B3QA 1I5XA 1TUEB 1NH2B 4GKKO 1GAXA 1TVKB 1R1BA 4HZ3A 1US6A 3ZHRA 2GUZA 3OFNG 1VQOV 4I0XB 3CC7V 1W2BU 3LUTB 3LDCA 4LF9B 2Q5ZA 3CWBH 1AP5A 1HP8A 3BEHA 3E35A 1OCZB 3CD6V 2QE7G 4X64B 1N34B 3TCUA 2CDYA 4JASA 3P3NA 4FMTA 4JZ2A 4PDRA 1ZL8A 1E1QG 5A2QN 4DV3B 1TA8A 5IY5B 1NVPD 3STLC 4WCEV 4X62O 4JV5O 4K0KO 1EFRG 4KUMA 4RO2A 3CC2V 2UXBB 3ASNB 2EIJB 4JYAB 1VQ6V 2A3QA 2YI9A 4JTAB 3ZN1A 5CA3A 2ZM6B 1KP2A 1H8EG 3OEEG 4JYBA 1Y74B 1OCZC 4NVPA 3JD0A 1XNRO 2CAZC 4J7JA 4IT5A 3O9OA 3A0BZ 3SJQC 1E1RG 1MZEA 1YSCA 4K8ZA 4X20B 5IY5C 3OUSA 2E74B 1GK9A 2CK3G 2DMXA 2EZOA 3UQ8A 2JGDB 4GX0A 3RN4A 1ENVA 4B3RO 3ASNC 2EIJC 3K59A 4RWUA 1UJWB 2CGNA 4UXNA 4TV9A 4WFAV 1QVFU 1R6TA 1SC5B 1B06A 5EZYB 3SPHA 2D2CB 1PP9H 4JI5B 2ZIMA 3G6EV 3X2QB 3BPZA 2CH7B 1GN3A 2UXXA 2Q0OC 5L3CA 3RVZA 3ZEDA 1F7YA
chains in the Genus database with same CATH topology
2UUCB 4Q6GA 5IJ0A 2QM4A 3RYFA 2E3CA 4LFAB 4ZHQA 4UCRA 1XNQB 4CH6A 3RWRD 2UXDB 5LYJA 1ZAUA 4UCVA 1QQCA 3M7MX 3JALA 4IIJB 5JQGA 5KX5B 4YJ2B 2EX3A 3VQYA 3VQVA 4CH3A 5KHJA 1YEWA 1WN7A 4UFZA 2KKWA 2JVDA 2P22C 3CHXA 4B08A 4LH6A 4ZIBA 4FM0A 3WB2A 5C8YB 2E5LB 4GKKB 1JFFB 4FLVA 5FNVB 5FNVA 3JSNA 3OTFA 4NXNB 5LMNB 4I55A 4X65B 1S5JA 5IJ9B 2R72A 3ICXA 5BMVB 1XHZA 4DR1B 5IYZB 4JI0B 2QJ1A 4LNUA 1XMOB 4FVMA 1IBMB 2F4VB 4U3JB 4EEQA 4X66B 4O2AB 3HKDB 5JJNB 5D5PA 2UXCB 4BWAA 4K0KB 5J2UA 4O4JA 1VZYA 4D7TA 5KHHA 2BTOA 5KHIA 4FLUA 4UCOA 3RGBA 5GONB 5JH7A 5CB4A 3N2KA 4LF7B 3WB1A 4O2BA 1TAEA 1XI1A 3ETQA 4O4HA 5JJEB 4AILC 4EFBA 4FLYA 1XNRB 3CB2A 4I4TB 2GV9A 2YIBA 3RYCB 5KMGA 2Q7HA 4TUYB 2YXLA 4UCTA 4WBNA 4FFBB 3QTCA 4DK1A 5K1PA 3JARA 2R9AA 4FLWA 3RYIA 5CA1B 3SJAC 3HKEB 1TUBA 1WPBA 3HKBB 3N2GB 2PY5A 5CA0A 4I9QA 4TV9B 3JATB 5EYPA 3E22B 4B3MB 1HNXB 1Z5WA 3JAWA 2ZNJA 3LNNA 3BA9A 4FLXA 4FM2A 4YY3B 2YIBD 4X1KA 3U11A 5IJ0B 3HKCB 4D7SA 4ZHQB 2YI8A 2Q7EA 1J5EB 4CS2A 3HKCA 4DRXA 4ZI7A 1IBLB 5LYJB 4CS3A 4JI8B 1FJGB 5J2TA 4HBNA 4O4IA 3BRCA 3JALB 4IHJB 5JCOA 5ITZA 1WNSA 4IHJA 4NXMB 1SQGA 5JQGB 4K8XA 1RSOA 2PTMA 5LOVA 2UUBB 2JS5A 4GYCB 4I50A 4BW9A 3U10A 2HHHB 1FFXA 1HW7A 1Q43A 1SKVA 2F93B 5LP6A 3K57A 3DSQA 4LFBB 3SJBC 3BHPA 1I7FA 5JVDA 3JASA 4I55B 2Q7GA 1HNZB 3BAAA 3ZS8C 4PI2A 4LNUB 5LXTA 2UU9B 5K1XA 1O9GA 4LH7A 4JI1B 4JI2B 1TVKA 5J2UB 4O4JB 5JJJB 2PYJA 3MAQA 4DK0A 4PI0A 3PN1A 3B2EE 3JSLA 4CH5A 5JH7B 1DGSA 5CB4B 3N2KB 4LF8B 2VWKA 4EFEA 3K5LA 4O2BB 3RYHA 4UCUA 2P5OA 3UT5B 4O4HB 3RFRA 2VQFB 4KL1A 1M5IA 1D5AA 3UT5A 4CC5A 4UCSA 5LA6A 5FPOA 3A2FA 5KMGB 4WBNB 4GKJB 3U0ZA 4TV8A 1N33B 3FFQA 1SA0A 3JARB 3RYIB 4JI3B 1TUBB 5D5QA 4DV0B 4LF4B 5BR8B 1Q3EA 5EIBD 1KMIZ 1N36B 4DUZB 5CA0B 4FM1A 3JAKA 4O4LA 4DV1B 1I94B 4X1IB 5EYPB 4JI6B 1P49A 4X1IA 4TOIA 1IBKB 1M4UA 4B3TB 2BTQA 4F6RA 4X1YA 3SR2C 4FLTA 3JAWB 4OX9B 1KU9A 4DR2B 4X1KB 4X20A 4JI4B 4KHPB 1Q5OA 4TQDA 1TGOA 4DRXB 2HEPA 4ZI7B 3OTOB 1V9PA 3SGIA 5J2TB 4O4IB 5KHGA 4EB6A 4GLXA 5ITZB 3K5OA 1M93A 5LOVB 2R70A 5EZYA 4DR7B 4LF6B 2ZNIA 2F1MA 4I50B 4PHZA 2V4DA 2UUAB 1FFXB 5KHKA 1Z5VA 2ZINA 1B04A 5LP6B 4LR3A 4DV2B 4HNAB 4ZOLA 1H2SB 4HNAA 3IAYA 1NT2B 4YHHB 1N32B 5JVDB 3JASB 4DV6B 4CC6A 3BABA 4DR3B 1HR0B 2RJZA 4YJ3B 2IM9A 4IIJA 2ZCEA 4CS4A 1G6UA 4YJ3A 5KX5A 4YJ2A 4AHCA 5LXTB 5JCOC 3VQXA 1JMKC 2OYQA 4JI7B 3K5MA 1VF7A 3SJCC 4FLZA 5C8YA 4L8JA 1VQ0A 1TVKB 1JFFA 5LP6C 2Q0AA 1XHXA 2F95B 3CSXA 4LF9B 5IJ9A 4DR6B 1HNWB 2PGGA 5BMVA 4DV7B 3RYHB 4X64B 5IYZA 1N34B 4LF5B 1SQFA 4AQYB 4U3JA 2YIAA 3VQWA 5LA6B 4O2AA 3HKDA 4DV3B 1TA8A 4X62B 3QG5A 4JV5B 4DR5B 5FPRA 4TV8B 1O9HA 2UXBB 1SA0B 2OWOA 4JYAB 5GONA 5EIBC 2YI9A 1Q8IA 4DR4B 2ZM6B 1X4TA 3K5NA 1T5EA 3JAKB 4O4LB 3WB0A 5IWAB 3THOA 4NVPA 2CAZC 4I4TA 2BTQB 3RYCA 4F6RB 4X1YB 2RQ6A 4TUYA 4FFBA 4DV5B 4LFCB 4K8ZA 4DUYB 4X20B 3T1YB 5LMUB 2JGUA 2PUSA 5CA1A 1XMQB 4B3RB 3HKEA 3UQ8A 3BA8A 3HKBA 4B3SB 1JJOA 3N2GA 2F66C 4EB6B 3K58A 3K59A 4DV4B 1XQ8A 4TV9A 3JATA 1L8DA 2VQEB 3E22A 5EZYB 4CH4A 2VWJA 4JI5B 2ZIMA 2PZSA 3BPZA 4TQFA 1QHTA 3T1HB 2ZIOA 3QF7A 2XHBA 3RYFB 2PYLA 3ZEDA 4ZOLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HW7 A;  3M7M X;  1VQ0 A;  1I7F A;  1VZY A; 
#chains in the Genus database with same CATH topology
 4GZR B;  2E3C A;  3LSU A;  5JWP A;  4ZHQ A;  1XNQ B;  4CH6 A;  2UUC O;  3W7X A;  2LFR A;  2BE3 A;  1ZAU A;  1XUQ A;  4UV8 A;  3RW0 A;  1QQC A;  4WFH A;  2OCH A;  1VMG A;  1OCO B;  2LQT A;  3A0R A;  3G6B A;  5A9G A;  4YJ2 B;  4ZBM A;  3ZHQ A;  4MW8 A;  2EX3 A;  3JAM N;  2OCC B;  4UFZ A;  3ZBH A;  2KKW A;  2JVD A;  1R6K A;  5GW7 A;  3CHX A;  4B08 A;  4FM0 A;  2E5L B;  5LBQ A;  3LSS A;  3X2Q C;  1JJ2 U;  4LFB O;  4PJ0 Z;  5FNV A;  1M56 B;  1WP8 A;  3OTF A;  3E83 A;  3KG2 A;  4I55 A;  4TWK A;  4YIO A;  2L35 A;  1WA8 B;  1XHZ A;  1HNZ O;  2X6B A;  3ZHT A;  4JI0 B;  3OMA B;  1XMO B;  2MK3 A;  2F4V B;  4EEQ A;  4X66 B;  1OCO C;  3C3S A;  5L3F A;  3AG2 B;  4F4L A;  2B1I A;  1IBM O;  3HKD B;  3CX5 F;  4BWA A;  5J2U A;  4O4J A;  3SYA A;  2UXC O;  2QSA A;  5KUM A;  2XAF A;  1K5Q A;  2Q73 A;  1DLB A;  5GON B;  2XND G;  5JH7 A;  3N27 A;  2FL4 A;  2RCV A;  3WB1 A;  1M56 C;  4Z1V A;  4IYH A;  5B66 Z;  2ITC C;  4O4H A;  4FPP A;  1AR4 A;  4MVR A;  4ASU G;  4EFB A;  2JS3 A;  4MTO A;  1L1F A;  3ABM C;  1R3J C;  2QDO A;  5H6R A;  3W7T A;  2BOB C;  3R66 A;  3P30 A;  2P90 A;  4WBN A;  4TUY B;  3QTC A;  3GB7 C;  4KP4 A;  3AG2 C;  3J80 N;  2UXN A;  3EXA A;  3RYI A;  3FB8 C;  3H1L H;  1WJZ A;  5CA1 B;  4PDV A;  1TUB A;  1KP3 A;  4EKW A;  4DV0 O;  2PY5 A;  3AG4 B;  3KZI Z;  2LP7 A;  1HNX B;  1VQP V;  1AJN A;  3D8C A;  1GN6 A;  1Z5W A;  3ZMS A;  1R3K C;  1K4D C;  4FLX A;  3FAV B;  2M7W A;  4OPA A;  4YY3 O;  2DYS B;  5IJ0 B;  3HKC B;  4D7S A;  1XL4 A;  5B1A B;  2YI8 A;  2Q7E A;  1XOU A;  3E89 A;  4CS2 A;  1IBL B;  4CS3 A;  1J5E O;  3K3W A;  4HBN A;  4AI8 A;  4IHJ B;  5ITZ A;  2ZXW B;  4RQF A;  1SQG A;  5F2V O;  3S3W A;  5JQG B;  1RSO A;  4K8X A;  3AG4 C;  1NBM G;  4BW9 A;  2HHH B;  3L70 H;  1Q43 A;  2IJI A;  1SKV A;  4UVC A;  1QR9 A;  2JDI G;  1YHQ V;  2OIG A;  1AI5 A;  1I7F A;  3OW2 U;  4BAY A;  3OGI B;  1YVW A;  5JVD A;  2ZE8 A;  4J80 A;  1Z2G A;  5B1A C;  2Q7G A;  4J9Y B;  3JCU Z;  2EIL B;  1PNM A;  4NR1 A;  4FK5 C;  1F4M A;  3UKM A;  2UU9 B;  1D2D A;  1F23 A;  2ZXW C;  2N04 A;  1SER A;  1NTM H;  2Q9L A;  1EN6 A;  4MVM A;  3MAQ A;  2XOK G;  2QKA A;  3K79 A;  4PI0 A;  3VBB A;  3PN1 A;  2ZDI C;  2OTL V;  3F5T A;  5CB4 B;  3N2K B;  4PDM A;  3LNM B;  4LF8 B;  3J7A U;  1WPX A;  4HAM A;  4UCU A;  1N34 O;  3TK1 A;  1Q90 D;  5EBL C;  4UVB A;  3UT5 A;  2JEU A;  2VQF O;  2EIL C;  1H2L A;  2LGW A;  5FPO A;  5KMG B;  1CXZ B;  1SRY A;  3TET A;  3U0Z A;  2HJD A;  1JCH A;  4JI3 B;  2IU0 A;  1N33 O;  2WLI B;  1EN4 A;  2EIN B;  1S76 D;  1EZJ A;  1Y66 A;  4LF4 B;  2ZR3 A;  5BR8 B;  3DXR A;  2XT9 A;  4O4L A;  3TXQ A;  4X1I B;  3D36 C;  5DM6 V;  4DV1 O;  3CJH A;  1NKD A;  1DF4 A;  3CRC A;  1IBK B;  1Q6U A;  2XAQ A;  3W7U A;  2KSD A;  4X1Y A;  3T1C A;  3C3T A;  3JAW B;  4B3T O;  1Q81 W;  3CS5 A;  4OX9 O;  3H9V A;  2DE0 X;  4RUE A;  1TGO A;  4DRX B;  2HEP A;  4ZI7 B;  3OTO B;  4JI4 O;  2QTS A;  2BSK B;  2JRI A;  1LUV A;  2QWR B;  1EN5 A;  3QNE A;  3H1H H;  1M57 B;  2F1M A;  1BS3 A;  2ZIN A;  3L71 H;  1L0N H;  3L75 H;  4MTF A;  3Q4H B;  3STZ C;  5LP6 B;  1FXK B;  1H2S B;  4HNA A;  3IAY A;  1LUW A;  1W0J G;  1AIL A;  4OGQ B;  4QPJ A;  3JAS B;  1YIT V;  4E2L A;  4DR3 B;  1ROP A;  3G80 A;  4YHH O;  1N32 O;  2IH1 C;  1HR0 O;  4YJ3 B;  3QO7 A;  2DYR B;  5KX5 A;  1QU7 A;  3HB3 B;  1VQ5 V;  1D5N A;  4JI7 B;  1NS1 A;  4UV9 A;  1M57 C;  1QLE C;  3K5M A;  1VF7 A;  4FLZ A;  3EFF K;  2AZ2 A;  2E5L O;  4L8J A;  1JFF A;  2HLD G;  1VEW A;  5LP6 C;  2Q0A A;  1FXK C;  4ICG A;  2PI4 A;  2RNB A;  2F95 B;  3CSX A;  4CBC A;  2P06 A;  3E8H A;  5BMV A;  4X89 A;  1JX9 A;  4JAA A;  1HNW O;  2HFE C;  3RYH B;  1H38 A;  4JI0 O;  3SYP A;  1XMO O;  2DYR C;  4AQY B;  2D3O W;  4U3J A;  2YIA A;  2A79 B;  4PA6 A;  1N0N A;  3VQW A;  2DN9 A;  3BY6 A;  2W6I G;  4DR5 B;  1BMF G;  4DW0 A;  3BCC H;  2RN9 A;  1Y67 A;  2XAG A;  2LW7 A;  1NR7 A;  2PF4 E;  4MS2 A;  1BZK A;  4XDJ A;  1LR1 A;  4GX5 A;  3ML0 A;  3FYI B;  5IWA O;  2CTW A;  3CRQ A;  1YTF D;  3RYC A;  4F6R B;  2RQ6 A;  2JK5 C;  4FFB A;  4MW3 A;  1MA1 A;  5B1B B;  3SPC A;  2KB1 A;  4DV5 O;  1VF5 B;  4DUY B;  2F43 G;  3SPG A;  3ZHV A;  2A0L A;  5LMU B;  2PUS A;  3R65 A;  3T1Y O;  2Q8V A;  3HKE A;  3B8N A;  1AI6 A;  1VQ7 V;  4B3S B;  3ZIA G;  4EB6 B;  3SYC A;  1BGY H;  5IDJ A;  2LJ2 A;  1BL8 A;  4DV4 B;  1XQ8 A;  3OMI B;  2WLL B;  2ZKO A;  1ZLZ A;  2BCC H;  3E22 A;  3M99 B;  1JOY A;  2VWJ A;  3RT3 C;  4TQF A;  3GWO A;  3T1H B;  3ZRW A;  3QF7 A;  2KG7 A;  3M8A A;  4QPK A;  2QM4 A;  1U96 A;  4UCR A;  2JEX A;  5B1B C;  2P67 A;  1WLE A;  2NNU A;  2UXD O;  3P32 A;  1I0H A;  4UCV A;  3M7M X;  3W7S A;  1NVP B;  2DQ0 A;  4CH3 A;  4IYI A;  5KHJ A;  4C7U A;  2HHH O;  1KD1 W;  1THZ A;  4LH6 A;  1SF9 A;  4A5U B;  5H9C A;  2F23 A;  4ZIB A;  5C8Y B;  4NB5 A;  5FNV B;  5BY1 A;  2G38 A;  1NZ6 A;  3JSN A;  4WF9 V;  2BOC C;  2YEV A;  3UO3 A;  3ZRV A;  1YCI A;  3IFX A;  5LMN B;  4X65 B;  5IJ9 B;  4JZG A;  2ILM A;  3FX7 A;  1KKC A;  1SS3 A;  5E79 Z;  1G1X B;  4BIO A;  1R3L C;  2CGO A;  1R6N A;  5IYZ B;  3FKS G;  1VP7 A;  4LNU A;  4FVM A;  2LGQ A;  2UU9 O;  4O2A B;  1SQX H;  5D5P A;  2QGN A;  4X9Q A;  1AJQ A;  1VZY A;  4D7T A;  5KHH A;  4FLU A;  3CCL V;  3E8G A;  2P4V A;  1FS0 G;  4PA4 A;  1IXM A;  1YI2 V;  2GTS A;  1XI1 A;  4LF7 O;  1URF A;  4QE7 A;  2ZQM A;  4I4T B;  3JD4 A;  1PNL A;  2DOS A;  3SDL A;  1AJP A;  1KEC A;  2YXL A;  4UCT A;  3TGU H;  2XAJ A;  1MMM A;  1OCR B;  4B7K A;  5K1P A;  1PM9 A;  3IC7 A;  2ITD C;  5HFL A;  3JAR A;  4TSF G;  1GH6 A;  4FLW A;  1CPY A;  1FAF A;  4R8C A;  3SJA C;  1LNQ A;  1K8A W;  3CMA V;  4LWS B;  5DEC A;  3E2E A;  4LF4 O;  3HKB B;  3N2G B;  5EC1 C;  2EJR A;  5CA0 A;  2KQX A;  4BIU A;  2ATK C;  3O65 A;  3JAT B;  5EYP A;  1K4C C;  4R50 A;  1YDX A;  4DO2 A;  1Q7Y W;  3G71 V;  3ABK B;  1RM1 B;  1DF5 A;  2ZNJ A;  4J11 A;  1P4R A;  4GX1 A;  2EUL A;  5J9P C;  1NTK H;  3CRM A;  4X1K A;  1FFT B;  2IJK A;  1OCR C;  4L87 A;  5LYJ B;  3OTO O;  4JI8 B;  1BSM A;  1YZB A;  1FJG B;  4O4I A;  2DWD C;  1ZSP A;  2Z3Y A;  3JAL B;  1BT8 A;  1Q86 W;  4MVZ A;  4MVO A;  2PTM A;  5LOV A;  4NXM O;  4I50 A;  3U10 A;  2JIZ G;  5L3D A;  2UUB O;  2CUG A;  2DW4 A;  5KLV H;  1RM1 C;  3WU2 Z;  4X8A A;  2DWE C;  5KAI Z;  1VQ9 V;  5EC2 C;  1I5Y A;  3DC6 A;  1AP6 A;  4B7E A;  2IW5 A;  3H1I H;  4PA9 A;  1WB7 A;  3K9S A;  1O9G A;  3B8M A;  1SZT A;  4JI2 B;  1WB8 A;  4W4L A;  4JI1 O;  3SYQ A;  1TVK A;  4IGG A;  2OCC C;  4DK0 A;  1PV0 A;  4TT3 G;  4I0X A;  5KA5 A;  3B2E E;  1KYO F;  1DGS A;  1DK1 A;  1KC8 W;  2A9H A;  3K5L A;  4N21 A;  4O2B B;  1K97 A;  4JPR A;  4DW1 A;  3SPI A;  2P7T C;  3I5D A;  1DTO A;  3UT5 B;  3G67 A;  3JCZ A;  2RMK B;  1KKD A;  1M5I A;  1D5A A;  1NTZ H;  2W6J G;  2Y0P A;  5B5E Z;  1J95 A;  2GSM B;  4QJF B;  5B1O A;  1MSD A;  1S5L Z;  1VF6 C;  4GKJ B;  1FD9 A;  5TIS Z;  1IUR A;  5D5Q A;  3OAA G;  2ADP A;  4R7C A;  5EIB D;  3I55 V;  1N36 B;  2NLJ C;  2QWN B;  5LHH A;  2YS8 A;  1Y74 A;  2EIM B;  2CTQ A;  3T4Z A;  2CTR A;  1P49 A;  1I94 O;  1OZ0 A;  4TOI A;  2A06 H;  2PI5 A;  2P4K A;  3OT7 A;  4FLT A;  1SET A;  2IH3 C;  4GX2 A;  3ZX6 A;  1PD3 A;  3AG3 B;  2NR5 A;  1YF2 A;  3C90 A;  4X20 A;  4DUY O;  3UCS C;  4WFG A;  4KHP B;  4BW5 A;  4DR2 O;  5LMU O;  2RDC A;  2JGD A;  3SGI A;  5J2T B;  2CE4 A;  3LDE A;  4PD4 F;  1S5H C;  3OM3 B;  3K5O A;  4FFK A;  2H8P C;  1M93 A;  4UVA A;  5EZY A;  4MVS A;  4DR7 B;  2EIM C;  2QKS A;  4LF6 O;  2UUA B;  1FFX B;  2CH7 A;  5KHK A;  5B3S B;  2WPD G;  4LR3 A;  4HNA B;  3FB5 C;  4PA3 A;  1KB9 F;  2FTK A;  2ZT9 B;  4DV2 O;  3NXS A;  1WP7 A;  4GUN A;  1S3J A;  4CC6 A;  4NTW A;  2DYS C;  2ZCE A;  1XDC A;  1VQM V;  1SQB H;  1VQK V;  3WG7 B;  1L0L H;  4YJ2 A;  4AHC A;  5EBW C;  2MW2 B;  5LXT B;  3APO A;  5JCO C;  2JJ1 G;  2OYQ A;  1E79 G;  3SJC C;  1GM9 A;  1NJI W;  3AG7 A;  3L72 H;  1VAR A;  5B3S C;  1XHX A;  5KUK A;  4DR6 B;  4YIP A;  5GTI Z;  2PGG A;  1WA8 A;  4LF9 O;  3F7Y C;  3DTU B;  1QLN A;  1K3E A;  1XBL A;  4LF5 B;  4X64 O;  1M1K W;  1MSW D;  3SYO A;  3B77 A;  5LA6 B;  3WG7 C;  3HKD A;  4X62 B;  4JV5 B;  1GKF A;  4DV3 O;  1WAZ A;  1GN2 A;  1BCC H;  1XL6 A;  4JF3 A;  4TV8 B;  1O9H A;  2OIE A;  5LGU A;  1SA0 B;  5H2F Z;  4G2K A;  3ABT A;  1ZWI C;  2UXB O;  2XAS A;  5GON A;  1OHH G;  4JYA O;  1Q8I A;  4DR4 B;  1X4T A;  2ODM A;  1VQ4 V;  2OTJ V;  1T5E A;  2ZM6 O;  3JAK B;  5LGT A;  3THO A;  3ABL B;  4PV1 B;  2YXH A;  2EIK B;  4P9P A;  2BTQ B;  3CME V;  1I08 A;  4U7O A;  4TUY A;  3OUF A;  2HVK C;  1KQS U;  2YC0 A;  3W7W A;  4YXW G;  4MTX A;  3UM7 A;  4OXS A;  5CA1 A;  2FYU H;  5H6Q A;  4B3R B;  2GTA A;  3BA8 A;  4JTD B;  4W4K A;  4QIW F;  1QBZ A;  4P2Z A;  3AK1 A;  2EIN C;  4KFM A;  2PZS A;  3ABL C;  3ZRW B;  1JR9 A;  4JI5 O;  4H0L B;  4LCU C;  2EIK C;  1V55 B;  3FAV A;  2XHB A;  4WFF A;  4ZOL B;  2UUC B;  4Q6G A;  4J10 A;  5IJ0 A;  3RYF A;  3ZCC A;  4LFA B;  3QO8 A;  3K04 A;  4P30 A;  3RWR D;  1GRJ A;  1XNQ O;  1QR8 A;  3J81 N;  2YUA A;  3CC4 V;  1A32 A;  4Q20 A;  4IIJ B;  1P84 F;  2WSS G;  2ETN A;  5CBG A;  1Q82 W;  5JQG A;  1S0V A;  3VQY A;  3VQV A;  4RQE A;  1YEW A;  2Q68 A;  2ZDI A;  4FLV A;  3P3P A;  2GUZ B;  1V55 C;  1FPO A;  4QNH B;  1RP3 B;  4NXN B;  3ZRX A;  3IC9 A;  1YJW V;  2R72 A;  3ICX A;  2WA3 A;  1YTF B;  4OPH A;  2HG5 C;  4DR1 B;  2QJ1 A;  3MDS A;  2WAM A;  1IBM B;  3WFV A;  1K73 W;  1ZL8 B;  2F4V O;  4FZ1 A;  3CCJ V;  4I5S A;  5JJN B;  4X66 O;  2HR3 A;  2UXC B;  3F7V C;  1NR1 A;  3ZMT A;  1EM1 A;  1FYJ A;  1MOF A;  3QVN A;  1K92 A;  3AEI A;  3RGB A;  2HP8 A;  3D36 A;  2B5U A;  3N2K A;  5CB4 A;  1COW G;  1TAE A;  4H13 B;  3MHS C;  1VQN V;  4DYL A;  4AIL C;  4NYK A;  4JTC B;  3CB2 A;  2ADQ B;  2YIB A;  5KMG A;  1MG1 A;  4DK1 A;  2YSU B;  4MT8 A;  2R9A A;  3QO5 A;  1GO3 F;  2WLI A;  4H33 A;  2ZR2 A;  1WPB A;  3I56 V;  1K5S A;  3KCX A;  5KAF Z;  3T4D A;  1Q6H A;  2EZP A;  5HFM A;  4TV9 B;  3HPL C;  1K34 A;  3CP1 A;  1IXB A;  1AR5 A;  4B3M B;  2DQ3 A;  5EBM C;  2WLK A;  3ASO B;  3JAW A;  1HNX O;  3G4S V;  4FM2 A;  4YY3 B;  1SES A;  2JJ2 G;  1KUQ A;  2QM8 A;  2H94 A;  2QA4 V;  3U11 A;  5IT9 N;  1ORQ C;  4ZHQ B;  1J5E B;  1R3I C;  4DRX A;  4ZI7 A;  3LSQ A;  3K08 A;  3OEH G;  2BSK A;  3CCV V;  1IBL O;  4K35 A;  3BRC A;  1KBH A;  5FL7 G;  1WNS A;  3B4S A;  2L6L A;  3JD2 A;  1K9M W;  2GHY A;  2JS5 A;  1S77 D;  3IGA C;  4XDL A;  1HW7 A;  3Q4H A;  5LP6 A;  2WA4 A;  1FXK A;  3DSQ A;  5BXZ A;  2ZE6 A;  3ASO C;  3BHP A;  2FML A;  2QTO A;  2HJF C;  3JAS A;  2V1D A;  1G8M A;  1Y6X A;  4I55 B;  2B9Z A;  5B1N A;  3FB6 C;  3CCU V;  1N8R W;  3ZS8 C;  4NKG B;  1SQV H;  2K9P A;  2FKX A;  5K1X A;  3E8B A;  1F51 A;  4LH7 A;  2R9R B;  1QNM A;  1K33 A;  2XTA A;  5J2U B;  4O4J B;  2PYJ A;  3JD3 A;  2LFS A;  2Z0A A;  1JVM A;  5JH7 B;  4DR6 O;  2VWK A;  3RYH A;  2K1E A;  4LF8 O;  2P5O A;  4O4H B;  4LF5 O;  3RFR A;  4GCZ A;  2VQF B;  3CCQ V;  2WLJ A;  3CEI A;  4UCS A;  1IDS A;  3A2F A;  1JA8 A;  4WBN B;  2QM7 A;  4J9Z B;  5FLX N;  1ARO P;  1VIB A;  1N33 B;  3FFQ A;  1YJ9 V;  1Y76 A;  3RYI B;  1QVG U;  1NH2 D;  3CCE V;  2QEX V;  3K0D A;  3CXH F;  1TUB B;  4JI3 O;  2Q6A A;  4DR4 O;  1KMI Z;  4DUZ B;  4FM1 A;  5BR8 O;  2IU3 A;  4DV1 B;  5LHI A;  3OGC C;  3E86 A;  4I9W A;  4JI6 B;  3UO2 A;  4B3T B;  4F6R A;  3SR2 C;  3TJT A;  1IBK O;  2YIC A;  3ZRS A;  4OX9 B;  4WFE A;  1KU9 A;  4IL6 Z;  4LC1 A;  3ZMV A;  4P9O A;  3CCS V;  4JI4 B;  4X88 A;  1GM8 A;  1Q5O A;  2VRZ A;  4TQD A;  1V9P A;  4J42 A;  4EB6 A;  3E8F A;  4GLX A;  1OJH A;  5ITZ B;  4G27 B;  2WLL A;  1RSO B;  3IJ4 A;  1Y4M A;  1SQP H;  4RUF A;  3HR0 A;  4PHZ A;  2AHZ A;  2V4D A;  5E1A C;  1ZUQ A;  1PL4 A;  2P6J A;  4Z1M G;  1FXH A;  3ABK C;  4LFA O;  2R9I A;  4KXR A;  4YHH B;  1N32 B;  5JVD B;  3KCY A;  4DV6 B;  1HR0 B;  1K7D A;  3ETG A;  2RJZ A;  4DR3 O;  3RVY A;  4Z2W A;  1BQ0 A;  2OT5 A;  4JGS A;  1UFI A;  1JMK C;  3VQX A;  1H2K A;  1GMG A;  4PA7 A;  4BR6 A;  1CEZ A;  1M9N A;  5C8Y A;  1VQ8 V;  4JI7 O;  2GDS A;  1VQ0 A;  3DC5 A;  1N0J A;  1RFY A;  1ZX3 A;  2V7Q G;  3BVO A;  4NXN O;  5IJ9 A;  1HNW B;  4J7Z A;  3ABM B;  4JAU A;  4DV7 B;  1FXV A;  3H1K H;  4DR1 O;  5IYZ A;  1B6Q A;  3D3I A;  5CBF A;  1SQF A;  2AHY A;  4AQY O;  2ZE7 A;  4O2A A;  1G4Y B;  1AVM A;  3QG5 A;  3OD4 A;  2YDE A;  1P7B A;  5FPR A;  4DR5 O;  1GM7 A;  1PKX A;  2OWO A;  2X0L A;  2YID A;  5EIB C;  5IYD O;  2YXY A;  4GT1 A;  3CCR V;  3DXR B;  1XEQ A;  3K5N A;  2IBZ H;  3NR7 A;  2Q4P A;  1MNG A;  4O4L B;  3WB0 A;  5IWA B;  5L3G A;  3ABU A;  4R6Z A;  1MZF A;  3CJH B;  1HDJ A;  4I4T A;  3B40 A;  5DED A;  4X1Y B;  1SQQ H;  2LW1 A;  1IZ3 A;  4DV5 B;  4LFC B;  3LDD A;  3K9A A;  1N4C A;  4XDK A;  1H8H G;  3T1Y B;  1QCE A;  2HVJ C;  4U7N A;  2ARH A;  5CN0 A;  2NN4 A;  1OV9 A;  2JGU A;  1XMQ B;  3ZMU A;  4LWS A;  3HKB A;  1JJO A;  3N2G A;  2F66 C;  3K58 A;  2FB5 A;  3ZMZ A;  4UUJ C;  4B3S O;  4UB8 Z;  3JAT A;  4J41 A;  1JQ0 A;  1L8D A;  1SZX A;  2VQE B;  4DV4 O;  2WLM A;  4CH4 A;  2GBO A;  4U3F H;  4B3M O;  1QHT A;  2ZIO A;  2QWO B;  3RYF B;  2PYL A;  3T1H O;  1Q6I A;  1BHB A;  2Y69 B;  2UXD B;  5LYJ A;  3AG3 C;  3FD9 A;  5KA6 A;  3JAL A;  2N74 A;  3L74 H;  2CTP A;  5KX5 B;  1UPG A;  2AW9 A;  3GVM A;  3MHH C;  4ZKI A;  1WN7 A;  3S3X A;  2QWP B;  2P22 C;  1M90 W;  4GKK B;  3WB2 A;  4RAI A;  4MVU A;  1JFF B;  3OR7 C;  1PL0 A;  3ZHU A;  3A0H Z;  3FB7 C;  3SPJ A;  1FKA O;  1JPX A;  3CE2 A;  4NTX A;  5LL6 Y;  3CYO A;  1S5J A;  2Y69 C;  5BMV B;  5LMN O;  2Y0I A;  4X65 O;  5GTH Z;  1VQL V;  1NI8 A;  3VOU A;  5AG2 A;  4U3J B;  1VF6 A;  1U97 A;  3K03 A;  1BE3 H;  1RPR A;  4K0K B;  2DJV A;  1V54 B;  4MTG A;  4DXW A;  2BTO A;  5KHI A;  4H44 B;  4CZZ A;  1F4N A;  1MAB G;  1CP9 A;  4UCO A;  2C2A A;  3F5W C;  4LF7 B;  3CXC U;  4E4E A;  4O2B A;  3ETQ A;  3B09 A;  5JJE B;  5DN6 G;  4FLY A;  5BZB A;  1XNR B;  2GV9 A;  3OE7 G;  3RYC B;  3ZN0 A;  2LO1 A;  1H2N A;  2Q7H A;  4FFB B;  1PNK A;  3OR6 C;  1IVS A;  1V54 C;  3HKE B;  3GWK C;  1BHA A;  5LGN A;  2N05 A;  3K0G A;  3MD0 A;  2QR4 A;  3AG1 B;  2E76 B;  3CCM V;  4DUZ O;  1OCC B;  4WFB V;  3JD1 A;  4I9Q A;  4F6E A;  3AK3 A;  3ETE A;  5C93 A;  1BQZ A;  4JI6 O;  3E22 B;  5L3E A;  3RBZ A;  2Q69 A;  3LNN A;  3BA9 A;  4MVQ A;  2KG7 B;  1R73 A;  2YIB D;  2WLH A;  1YXB A;  2XUM A;  2Y4U A;  4ABM A;  2HKO A;  3HKC A;  4I7Z B;  3K06 A;  5J2T A;  4UB6 Z;  4JI8 O;  5JCO A;  1FJG O;  1QLE B;  4IHJ A;  2AGA A;  4FJC C;  4H37 A;  4NXM B;  4BIZ A;  3AG1 C;  1OCC C;  4JAV A;  3ETD A;  2UUB B;  3D3Q A;  4GYC B;  3T2M A;  2VS0 A;  1FFX A;  2F93 B;  4LBE C;  3K57 A;  2X6C A;  2W0F C;  1S72 V;  4LFB B;  4PDL A;  3SJB C;  4NTY A;  4JYY A;  2YEV B;  1AI4 A;  4DV6 O;  2Z5U A;  4G28 B;  1HWY A;  2B1G A;  1HNZ B;  3BAA A;  2AXT Z;  4PI2 A;  4LNU B;  5LXT A;  2M6Y A;  2E75 B;  1X59 A;  2IJH A;  1AB3 A;  2AZ0 A;  5L3B A;  4JYC A;  2EBO A;  4J7K A;  4JI1 B;  4MSW C;  4JI2 O;  3AK2 A;  3L73 H;  5JJJ B;  4QE9 A;  1XRE A;  2X7R B;  3JSL A;  4CH5 A;  3H1J H;  4EFE A;  4DV7 O;  3EHB B;  5EK0 A;  4KL1 A;  4CC5 A;  1H2G A;  5LA6 A;  5CBH A;  1AR1 B;  1GN4 A;  5LHG A;  2QKC A;  1NU1 H;  4TV8 A;  1Y76 B;  2A7W A;  3OMN B;  4GKJ O;  1SA0 A;  3JAR B;  3A8T A;  1YIJ V;  1NQT A;  1YJN V;  4DV0 B;  2QWQ B;  4PEL A;  1Q3E A;  2ZE5 A;  1EBO A;  5IYC O;  3PJS K;  5CA0 B;  4N23 A;  3JAK A;  2EJ7 A;  1I94 B;  1N36 O;  5EYP B;  4X1I A;  4LP8 A;  1M4U A;  2BTQ A;  1GTO A;  2H3O A;  3EVK A;  1W59 A;  3BFR A;  2XAH A;  1EZV H;  4LFC O;  3FYE B;  4DR2 B;  4X1K B;  1H2M A;  1IX9 A;  1XMQ O;  3APQ A;  4XBF A;  4KHP O;  4HYO A;  2X6A A;  2WWW A;  3CPW U;  2Y48 A;  3JYC A;  4O4I B;  5KHG A;  4FIP C;  3ZJZ A;  2ZD9 A;  2VQE O;  5LOV B;  2R70 A;  4LF6 B;  1PPJ H;  3TXS A;  1AI7 A;  2ZNI A;  4I50 B;  4DR7 O;  1Z5V A;  3DGE A;  1B04 A;  3CRR A;  1XIL A;  2O57 A;  5IE9 A;  4DV2 B;  2UUA O;  4ZOL A;  1RPO A;  2Y4T A;  1NT2 B;  2IJJ A;  2WLN A;  4D6T H;  4K3A A;  3BAB A;  3H01 A;  2Q67 A;  1W0K G;  1ZTE A;  2IM9 A;  4IIJ A;  4CS4 A;  5IYB O;  1G6U A;  4YJ3 A;  5H5N A;  1P7G A;  3CRA A;  3L9D A;  2W0X A;  5CMU A;  4FZ0 A;  3KKY A;  4QGP A;  3ZHS A;  1B3Q A;  1I5X A;  1TUE B;  1NH2 B;  4GKK O;  1GAX A;  1TVK B;  1R1B A;  4HZ3 A;  1US6 A;  3ZHR A;  2GUZ A;  3OFN G;  1VQO V;  4I0X B;  3CC7 V;  1W2B U;  3LUT B;  3LDC A;  4LF9 B;  2Q5Z A;  3CWB H;  1AP5 A;  1HP8 A;  3BEH A;  3E35 A;  1OCZ B;  3CD6 V;  2QE7 G;  4X64 B;  1N34 B;  3TCU A;  2CDY A;  4JAS A;  3P3N A;  4FMT A;  4JZ2 A;  4PDR A;  1ZL8 A;  1E1Q G;  5A2Q N;  4DV3 B;  1TA8 A;  5IY5 B;  1NVP D;  3STL C;  4WCE V;  4X62 O;  4JV5 O;  4K0K O;  1EFR G;  4KUM A;  4RO2 A;  3CC2 V;  2UXB B;  3ASN B;  2EIJ B;  4JYA B;  1VQ6 V;  2A3Q A;  2YI9 A;  4JTA B;  3ZN1 A;  5CA3 A;  2ZM6 B;  1KP2 A;  1H8E G;  3OEE G;  4JYB A;  1Y74 B;  1OCZ C;  4NVP A;  3JD0 A;  1XNR O;  2CAZ C;  4J7J A;  4IT5 A;  3O9O A;  3A0B Z;  3SJQ C;  1E1R G;  1MZE A;  1YSC A;  4K8Z A;  4X20 B;  5IY5 C;  3OUS A;  2E74 B;  1GK9 A;  2CK3 G;  2DMX A;  2EZO A;  3UQ8 A;  2JGD B;  4GX0 A;  3RN4 A;  1ENV A;  4B3R O;  3ASN C;  2EIJ C;  3K59 A;  4RWU A;  1UJW B;  2CGN A;  4UXN A;  4TV9 A;  4WFA V;  1QVF U;  1R6T A;  1SC5 B;  1B06 A;  5EZY B;  3SPH A;  2D2C B;  1PP9 H;  4JI5 B;  2ZIM A;  3G6E V;  3X2Q B;  3BPZ A;  2CH7 B;  1GN3 A;  2UXX A;  2Q0O C;  5L3C A;  3RVZ A;  3ZED A;  1F7Y A; 
#chains in the Genus database with same CATH homology
 2UUC B;  4Q6G A;  5IJ0 A;  2QM4 A;  3RYF A;  2E3C A;  4LFA B;  4ZHQ A;  4UCR A;  1XNQ B;  4CH6 A;  3RWR D;  2UXD B;  5LYJ A;  1ZAU A;  4UCV A;  1QQC A;  3M7M X;  3JAL A;  4IIJ B;  5JQG A;  5KX5 B;  4YJ2 B;  2EX3 A;  3VQY A;  3VQV A;  4CH3 A;  5KHJ A;  1YEW A;  1WN7 A;  4UFZ A;  2KKW A;  2JVD A;  2P22 C;  3CHX A;  4B08 A;  4LH6 A;  4ZIB A;  4FM0 A;  3WB2 A;  5C8Y B;  2E5L B;  4GKK B;  1JFF B;  4FLV A;  5FNV B;  5FNV A;  3JSN A;  3OTF A;  4NXN B;  5LMN B;  4I55 A;  4X65 B;  1S5J A;  5IJ9 B;  2R72 A;  3ICX A;  5BMV B;  1XHZ A;  4DR1 B;  5IYZ B;  4JI0 B;  2QJ1 A;  4LNU A;  1XMO B;  4FVM A;  1IBM B;  2F4V B;  4U3J B;  4EEQ A;  4X66 B;  4O2A B;  3HKD B;  5JJN B;  5D5P A;  2UXC B;  4BWA A;  4K0K B;  5J2U A;  4O4J A;  1VZY A;  4D7T A;  5KHH A;  2BTO A;  5KHI A;  4FLU A;  4UCO A;  3RGB A;  5GON B;  5JH7 A;  5CB4 A;  3N2K A;  4LF7 B;  3WB1 A;  4O2B A;  1TAE A;  1XI1 A;  3ETQ A;  4O4H A;  5JJE B;  4AIL C;  4EFB A;  4FLY A;  1XNR B;  3CB2 A;  4I4T B;  2GV9 A;  2YIB A;  3RYC B;  5KMG A;  2Q7H A;  4TUY B;  2YXL A;  4UCT A;  4WBN A;  4FFB B;  3QTC A;  4DK1 A;  5K1P A;  3JAR A;  2R9A A;  4FLW A;  3RYI A;  5CA1 B;  3SJA C;  3HKE B;  1TUB A;  1WPB A;  3HKB B;  3N2G B;  2PY5 A;  5CA0 A;  4I9Q A;  4TV9 B;  3JAT B;  5EYP A;  3E22 B;  4B3M B;  1HNX B;  1Z5W A;  3JAW A;  2ZNJ A;  3LNN A;  3BA9 A;  4FLX A;  4FM2 A;  4YY3 B;  2YIB D;  4X1K A;  3U11 A;  5IJ0 B;  3HKC B;  4D7S A;  4ZHQ B;  2YI8 A;  2Q7E A;  1J5E B;  4CS2 A;  3HKC A;  4DRX A;  4ZI7 A;  1IBL B;  5LYJ B;  4CS3 A;  4JI8 B;  1FJG B;  5J2T A;  4HBN A;  4O4I A;  3BRC A;  3JAL B;  4IHJ B;  5JCO A;  5ITZ A;  1WNS A;  4IHJ A;  4NXM B;  1SQG A;  5JQG B;  4K8X A;  1RSO A;  2PTM A;  5LOV A;  2UUB B;  2JS5 A;  4GYC B;  4I50 A;  4BW9 A;  3U10 A;  2HHH B;  1FFX A;  1HW7 A;  1Q43 A;  1SKV A;  2F93 B;  5LP6 A;  3K57 A;  3DSQ A;  4LFB B;  3SJB C;  3BHP A;  1I7F A;  5JVD A;  3JAS A;  4I55 B;  2Q7G A;  1HNZ B;  3BAA A;  3ZS8 C;  4PI2 A;  4LNU B;  5LXT A;  2UU9 B;  5K1X A;  1O9G A;  4LH7 A;  4JI1 B;  4JI2 B;  1TVK A;  5J2U B;  4O4J B;  5JJJ B;  2PYJ A;  3MAQ A;  4DK0 A;  4PI0 A;  3PN1 A;  3B2E E;  3JSL A;  4CH5 A;  5JH7 B;  1DGS A;  5CB4 B;  3N2K B;  4LF8 B;  2VWK A;  4EFE A;  3K5L A;  4O2B B;  3RYH A;  4UCU A;  2P5O A;  3UT5 B;  4O4H B;  3RFR A;  2VQF B;  4KL1 A;  1M5I A;  1D5A A;  3UT5 A;  4CC5 A;  4UCS A;  5LA6 A;  5FPO A;  3A2F A;  5KMG B;  4WBN B;  4GKJ B;  3U0Z A;  4TV8 A;  1N33 B;  3FFQ A;  1SA0 A;  3JAR B;  3RYI B;  4JI3 B;  1TUB B;  5D5Q A;  4DV0 B;  4LF4 B;  5BR8 B;  1Q3E A;  5EIB D;  1KMI Z;  1N36 B;  4DUZ B;  5CA0 B;  4FM1 A;  3JAK A;  4O4L A;  4DV1 B;  1I94 B;  4X1I B;  5EYP B;  4JI6 B;  1P49 A;  4X1I A;  4TOI A;  1IBK B;  1M4U A;  4B3T B;  2BTQ A;  4F6R A;  4X1Y A;  3SR2 C;  4FLT A;  3JAW B;  4OX9 B;  1KU9 A;  4DR2 B;  4X1K B;  4X20 A;  4JI4 B;  4KHP B;  1Q5O A;  4TQD A;  1TGO A;  4DRX B;  2HEP A;  4ZI7 B;  3OTO B;  1V9P A;  3SGI A;  5J2T B;  4O4I B;  5KHG A;  4EB6 A;  4GLX A;  5ITZ B;  3K5O A;  1M93 A;  5LOV B;  2R70 A;  5EZY A;  4DR7 B;  4LF6 B;  2ZNI A;  2F1M A;  4I50 B;  4PHZ A;  2V4D A;  2UUA B;  1FFX B;  5KHK A;  1Z5V A;  2ZIN A;  1B04 A;  5LP6 B;  4LR3 A;  4DV2 B;  4HNA B;  4ZOL A;  1H2S B;  4HNA A;  3IAY A;  1NT2 B;  4YHH B;  1N32 B;  5JVD B;  3JAS B;  4DV6 B;  4CC6 A;  3BAB A;  4DR3 B;  1HR0 B;  2RJZ A;  4YJ3 B;  2IM9 A;  4IIJ A;  2ZCE A;  4CS4 A;  1G6U A;  4YJ3 A;  5KX5 A;  4YJ2 A;  4AHC A;  5LXT B;  5JCO C;  3VQX A;  1JMK C;  2OYQ A;  4JI7 B;  3K5M A;  1VF7 A;  3SJC C;  4FLZ A;  5C8Y A;  4L8J A;  1VQ0 A;  1TVK B;  1JFF A;  5LP6 C;  2Q0A A;  1XHX A;  2F95 B;  3CSX A;  4LF9 B;  5IJ9 A;  4DR6 B;  1HNW B;  2PGG A;  5BMV A;  4DV7 B;  3RYH B;  4X64 B;  5IYZ A;  1N34 B;  4LF5 B;  1SQF A;  4AQY B;  4U3J A;  2YIA A;  3VQW A;  5LA6 B;  4O2A A;  3HKD A;  4DV3 B;  1TA8 A;  4X62 B;  3QG5 A;  4JV5 B;  4DR5 B;  5FPR A;  4TV8 B;  1O9H A;  2UXB B;  1SA0 B;  2OWO A;  4JYA B;  5GON A;  5EIB C;  2YI9 A;  1Q8I A;  4DR4 B;  2ZM6 B;  1X4T A;  3K5N A;  1T5E A;  3JAK B;  4O4L B;  3WB0 A;  5IWA B;  3THO A;  4NVP A;  2CAZ C;  4I4T A;  2BTQ B;  3RYC A;  4F6R B;  4X1Y B;  2RQ6 A;  4TUY A;  4FFB A;  4DV5 B;  4LFC B;  4K8Z A;  4DUY B;  4X20 B;  3T1Y B;  5LMU B;  2JGU A;  2PUS A;  5CA1 A;  1XMQ B;  4B3R B;  3HKE A;  3UQ8 A;  3BA8 A;  3HKB A;  4B3S B;  1JJO A;  3N2G A;  2F66 C;  4EB6 B;  3K58 A;  3K59 A;  4DV4 B;  1XQ8 A;  4TV9 A;  3JAT A;  1L8D A;  2VQE B;  3E22 A;  5EZY B;  4CH4 A;  2VWJ A;  4JI5 B;  2ZIM A;  2PZS A;  3BPZ A;  4TQF A;  1QHT A;  3T1H B;  2ZIO A;  3QF7 A;  2XHB A;  3RYF B;  2PYL A;  3ZED A;  4ZOL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...