1HW7A

Hsp33, heat shock protein with redox-regulated chaperone activity
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
229
structure length
229
Chain Sequence
b'HDQLHRYLFENFAVRGELVTVSETLQQILENHDYPQPVKNVLAELLVATSLLTATLKFDGDITVQLQGDGPMNLAVINGNNNQQMRGVARVQGEIPENADLKTLVGNGYVVITITPSEGERYQGVVGLEGDTLAACLEDYFMRSEQLPTRLFIRTGDVDGKPAAGGMLLQVMPAQNAQQDDFDHLATLTETIKTEELLTLPANEVLWRLYHEEEVTVYDPQDVEFKCTC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEAT SHOCK PROTEIN HSP33
publication title The 2.2 A crystal structure of Hsp33: a heat shock protein with redox-regulated chaperone activity.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone
total genus 51
structure length 229
sequence length 229
ec nomenclature
pdb deposition date 2001-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.480 Mainly Alpha Orthogonal Bundle Helix Hairpins helix hairpin bin 1hw7A02
3.55.30.10 Alpha Beta 3-Layer(bab) Sandwich Hsp33 domain Hsp33 domain 1hw7A01
1VZYA 1HW7A 1I7FA 1VQ0A 3M7MX
chains in the Genus database with same CATH superfamily
4JI2O 1D5AA 1YSCA 1X59A 2DN9A 1N36B 5LA6B 1CEZA 5BZBA 2JK5C 4OXSA 5IWAB 2XUMA 3D8CA 4HAMA 3ICXA 3ABTA 3U11A 3ABKB 2IJIA 1M57C 3KG2A 4ZOLA 2N74A 3E8BA 3DTUB 2PYJA 1NJIW 2F66C 4X1IA 5A9GA 1FXKC 1XOUA 1VQ4V 1LNQA 3U0ZA 2RMKB 4LR3A 4L87A 3QO5A 2WSSG 1I5YA 4JI4B 3AG1C 3LNNA 3JD1A 4FMTA 1YVWA 5LMUB 3JD3A 2O57A 2DE0X 5KHIA 1YZBA 2F43G 2P5OA 3ASOC 3B8NA 2K1EA 2Y69B 3OM3B 4G27B 3RYHA 2UXNA 3L9DA 4IYIA 5HFLA 4B3SO 1FPOA 4DV1B 3E35A 5JCOC 3AK2A 2WAMA 4FPPA 4BW5A 2LQTA 3AG7A 4DW1A 3ZMSA 2LW1A 2OCCB 2JEUA 3CRCA 1FFXA 4DV6O 4UV8A 4ABMA 4TV8A 3RYHB 2E3CA 3CRQA 4JTDB 5KHKA 3CXCU 4PI0A 1EN4A 2DMXA 1SQGA 1X4TA 2LP7A 4MVOA 5FNVB 2Y48A 5ITZA 3WG7C 3OFNG 3K5NA 1YHQV 3AG4B 5LGTA 4EB6A 1W2BU 2YUAA 1OV9A 4DR7O 4TUYA 2HLDG 4O4IA 3D36C 4X62O 2Y0IA 1NTMH 2JS5A 2ZNJA 3SJQC 3CWBH 1N8RW 3LDDA 3FB8C 4JI1O 1BZKA 1VQNV 1J5EB 1PNKA 2A7WA 3OD4A 2GUZB 5CB4B 3SYAA 2PI4A 3LNMB 4F6EA 1S72V 5KUKA 1HNWB 4WFHA 3JYCA 1ZL8B 1XHZA 2WWWA 1FYJA 1IX9A 3DSQA 3M8AA 2OWOA 3HR0A 2LFSA 2JGUA 2VS0A 3RVZA 1M9NA 4CC6A 3KZIZ 2LGQA 1H38A 4LF4B 1L8DA 3ZS8C 5EBLC 1PNLA 1QLNA 1BT8A 1LUWA 5LP6B 4OPAA 4WFAV 4JAUA 3BAAA 3SJAC 5CBFA 3SGIA 3ZRVA 2WLMA 4JTCB 4DR5B 2G38A 1AJQA 4RUEA 1H2SB 5BR8B 2FKXA 3SR2C 1S0VA 5CA0A 3TETA 4D6TH 3ZRSA 3K08A 2C2AA 3EHBB 5KUMA 3LUTB 2P22C 1WA8B 4I9WA 5GTHZ 4P9PA 1HP8A 4X8AA 1P84F 4YJ2A 2WLLB 4I4TB 2XAHA 1S5HC 3LDEA 4O4HA 2X0LA 4O4JA 1JFFB 3L70H 4CS4A 2XAQA 1ZTEA 3ZCCA 4AHCA 1JJOA 3T1CA 2WLKA 4FZ1A 1WB8A 2HP8A 3QNEA 2RQ6A 3BA9A 4QPJA 1Q82W 4B3RB 5IE9A 3CCMV 3ZEDA 4JGSA 5H2FZ 1R3KC 4WF9V 4YY3B 2AW9A 1FJGO 5B1AC 2CH7A 4DV0B 2YS8A 4EFBA 3MD0A 1BCCH 2NLJC 4MVUA 3CCRV 2FTKA 4I5SA 4LC1A 4JYAB 2KQXA 1N36O 4O2AA 5LBQA 4J7ZA 1I94B 1RSOB 3W7SA 3LSQA 3MAQA 4O4LA 3UQ8A 2DYSB 5HFMA 1CP9A 2GV9A 2R70A 2UXXA 1EZJA 4X66O 3E22A 4DO2A 1VIBA 4IT5A 4K8XA 5J9PC 2RJZA 4UVAA 2JS3A 1HDJA 4PDLA 1K7DA 4LFBB 1EFRG 3A0BZ 5EZYB 3H1KH 3JALB 3JASB 4J7KA 4XBFA 3IFXA 5LMUO 2Q7GA 1TUBB 3JCUZ 3OTFA 1Z5WA 4MSWC 2E76B 4HNAB 5JJNB 2ZM6O 1Q81W 1IBKB 4U7OA 2ZE5A 5A2QN 2ZCEA 1MABG 2QJ1A 1JMKC 1PD3A 2IU0A 4DV1O 1Y6XA 2ZR3A 3JATB 5F2VO 3ZRWB 5BMVB 4BW9A 3UCSC 4DV5B 3FAVA 2UUAO 5EYPB 3MHHC 3HKBB 1CPYA 4O2BA 4I50B 4OPHA 3JAKA 4LF7B 1GKFA 3SPGA 2R9AA 4PA3A 3VOUA 4JF3A 3L74H 4F4LA 5H6QA 2YEVA 2WA4A 2KG7A 4B3MO 4KFMA 1GTOA 3CRMA 3GB7C 5AG2A 1AROP 1AILA 4ZKIA 1R6TA 3N2KA 4QE7A 1V55C 3ABLB 5D5PA 4UV9A 2AGAA 1NS1A 1J5EO 1SRYA 4Q20A 2DYRC 1N32B 4UCRA 2QWRB 1WP7A 1FXKA 5JVDB 2ZINA 3D3IA 3ETDA 1I7FA 1KKDA 1PKXA 1E1QG 4FLVA 2PGGA 1H2KA 1XREA 4PDMA 3FB7C 3ZMVA 1L0NH 3I5DA 3RT3C 4H44B 1IVSA 3CHXA 4RO2A 3G6BA 3UT5B 1N0JA 4PDRA 1SS3A 3U10A 3H1JH 1AR4A 3O9OA 4DV2B 2HG5C 2QM8A 1K3EA 4H0LB 2RDCA 3H1LH 1JX9A 4MVZA 4LF4O 1XQ8A 3AG1B 4JV5B 2UXBB 3ZRXA 2LW7A 3ABMC 3CCSV 3ASOB 2N05A 3E8GA 1YTFB 1M5IA 4KL1A 4LWSA 1VARA 4QIWF 3FD9A 4DR5O 1SZXA 1Y74B 4RWUA 4FM1A 1J95A 3GVMA 2OIEA 2JEXA 4PA9A 4EEQA 2W0FC 1UJWB 2OYQA 2P67A 1BGYH 3T4DA 1VZYA 1VF5B 2JGDB 1TGOA 3I55V 5EC1C 5LYJA 1B06A 3H01A 5CA1B 1HR0B 1OCRC 4X1KA 3WG7B 3W7UA 1HNZO 1YEWA 1WPBA 2YIDA 1THZA 2ZKOA 3OMAB 4MVQA 4DR1O 4FLTA 4LFCB 4B7KA 3QTCA 2LJ2A 5JJEB 1WJZA 1Q6IA 4B3RO 4MT8A 3BRCA 1UPGA 3OUSA 4YY3O 3P3NA 2B9ZA 1R73A 1BQ0A 2Y4TA 2H8PC 3THOA 1R1BA 2PF4E 4TT3G 1HNXO 4I7ZB 2L6LA 4D7SA 3ZHVA 4JYAO 3K06A 2XTAA 4B08A 5L3CA 1I94O 2V7QG 3UO2A 5L3FA 1XUQA 3BVOA 1KKCA 1VQKV 3B40A 3ZJZA 1YDXA 1YTFD 3G67A 3M7MX 2KB1A 1D5NA 2EILC 3G4SV 4DV7B 4DRXB 4HZ3A 4NXNO 2WLIB 4I0XA 4UFZA 3P30A 1IDSA 3E83A 5JJJB 2QKAA 3JAWA 4UB6Z 1NR1A 2F4VB 1K34A 4X88A 5H9CA 4LFBO 1AB3A 3OR7C 2OTLV 1OHHG 3PN1A 1GN6A 4JI8O 1MSWD 2ZIOA 1SA0B 4LNUA 4AI8A 1ROPA 4MW8A 3ZN0A 3OT7A 2DWDC 2IH1C 4J41A 1BE3H 2HEPA 5CN0A 1IBKO 3OW2U 5B3SC 4OX9B 3ZIAG 2ADQB 1XMQB 5KLVH 4MVRA 3VQXA 3D3QA 2VQFB 1GAXA 4C7UA 2Q69A 3STZC 1HWYA 3W7XA 4UCTA 1KP3A 2F95B 1AI4A 2YSUB 4CC5A 2JJ1G 4X89A 1XL4A 4QGPA 4LF7O 4U7NA 3RYFB 1NZ6A 2AHYA 4X20A 3TCUA 3WB0A 5L3DA 1Q3EA 5E1AC 5GONA 2ZE7A 1XNQB 3QF7A 4JI3B 4F6RB 5JWPA 1N33B 1MNGA 4JAAA 4CH4A 3CJHB 2P06A 1OCZC 1YCIA 4P2ZA 2UUBB 4U3FH 4P30A 2BOCC 1IBLB 4D7TA 2UXDB 1F7YA 2EJRA 3CC2V 1L1FA 3RYIA 5B1AB 4YJ3A 1AR5A 3C90A 5JQGB 3JD4A 4WFBV 1M56C 1VQPV 3HKEA 4GCZA 3TJTA 1SQBH 3ZHRA 2QWOB 2YIBA 1KD1W 1T5EA 4JI6B 3AK1A 1MOFA 1IXBA 5B1NA 5KAIZ 2XT9A 3FX7A 4DR2O 1OCOC 4B7EA 5FLXN 3LDCA 2D2CB 3E8FA 3ZMZA 3TK1A 3OMIB 1QLEC 4LF6B 2ATKC 4ZOLB 4DV2O 2BTQA 4X64B 4BIZA 4BWAA 2D3OW 4MTXA 2YDEA 3CC4V 1GMGA 3RW0A 4X1IB 4ZI7A 4JV5O 3STLC 4R8CA 4DR4O 1MMMA 1AI6A 3TGUH 5H6RA 4Q6GA 2HHHB 2A9HA 3JAMN 4I9QA 3CCUV 2CDYA 2P7TC 1KQSU 1PNMA 5EBMC 4QJFB 4GYCB 2ZXWC 1VF7A 2GBOA 4ZHQA 4DUYO 3OGIB 4FJCC 5LHIA 2NN4A 1FFXB 4HBNA 4TV8B 3C3TA 2EIKC 2HVJC 4G2KA 4WCEV 3OEEG 5LXTA 2ZE6A 2Q73A 2K9PA 5EC2C 3AG2B 1KYOF 1ZAUA 4LFCO 5ITZB 4JTAB 2UU9B 4BAYA 3IJ4A 4NTXA 1IBMB 3CB2A 4EB6B 2E75B 1V55B 1FS0G 5KHJA 4TUYB 4O4IB 3OTOB 1XNRB 1NTKH 4K3AA 2DYRB 4DV4B 4MTGA 2H3OA 2YIBD 2ZQMA 1S77D 3CSXA 3K9AA 1FAFA 3F7VC 5KMGA 4U3JA 2NNUA 1QR9A 1PV0A 1ZWIC 4YXWG 3F7YC 3RVYA 2AXTZ 4LF5B 4FM2A 3JD0A 5IYZA 1SF9A 3SPHA 4XDKA 4X65B 3L73H 2P90A 4LH6A 1M4UA 2Q4PA 1KECA 3NXSA 4DV7O 4GLXA 3TXQA 1RM1C 1GM8A 5LMNB 4DXWA 1GRJA 3QG5A 4WFGA 4X1YA 4IYHA 3ABMB 3SYQA 3IC7A 2JJ2G 4DYLA 2Q7HA 4J10A 5TISZ 1EZVH 1URFA 2CTRA 5J2TA 2LFRA 4MS2A 3AK3A 1JJ2U 5CMUA 3I56V 1AJNA 5KHHA 3N2GA 2EIJC 1XMQO 3WB1A 5L3EA 1V54C 2VQFO 1OCCC 4KXRA 2VQEB 5CA0B 1PL4A 3CP1A 3FKSG 1OCRB 4DR6O 1UFIA 1Y66A 4YJ2B 4YIOA 1LUVA 1Q8IA 4O4HB 4O4JB 1ZSPA 1N33O 3K3WA 1O9GA 2NR5A 1VQMV 1IZ3A 3T1HO 1QVGU 3VQVA 3Q4HA 3FFQA 4WBNA 4JI0B 3JSNA 5CBHA 5EIBC 1U96A 2UUBO 4FIPC 3DXRA 5IJ0A 1IBLO 2ZR2A 2UXDO 3KCYA 3FB5C 3VBBA 1SETA 4K0KB 1SZTA 1NVPB 5IWAO 2V1DA 1F4NA 4RAIA 4XDJA 2A06H 3CMEV 4NR1A 2W0XA 4J80A 5CBGA 2CH7B 5IJ9A 1YI2V 3RBZA 4GKJB 1AI5A 4DR3B 3ZN1A 4O2AB 4AQYB 1MA1A 3ABKC 2EILB 3W7TA 1P7BA 1YJ9V 2FYUH 4I55A 1VP7A 4O4LB 2XAFA 4KUMA 2BOBC 2DWEC 2UXCB 1GO3F 3N27A 1QNMA 1NTZH 4JI4O 1PPJH 1VQ0A 3CRRA 3E22B 2M7WA 4B3TB 3O65A 5C8YA 3EXAA 4LP8A 1DLBA 3T1YB 3EVKA 5K1XA 1H2NA 2M6YA 1K8AW 5B3SB 2BSKA 3A8TA 4NKGB 2PY5A 1SQPH 1BL8A 2Y69C 5GTIZ 4UCUA 3RYCA 4GX2A 1K5SA 1Y76A 1K5QA 2A79B 1YF2A 1QVFU 1R3LC 4LFAB 2AZ2A 4J9ZB 3R65A 4MVSA 3BY6A 2OCCC 2HVKC 2EZOA 1WPXA 1NR7A 3FAVB 2FL4A 3UKMA 1MG1A 4O2BB 2EULA 1NVPD 3JAKB 2Q5ZA 4JAVA 4FZ0A 1OCZB 2P4VA 3ASNC 1AVMA 3ZMTA 1W0KG 3ETEA 2Q6AA 1OJHA 3K59A 2DQ0A 2YEVB 2KG7B 2XAGA 1Z5VA 3K03A 2XOKG 4JASA 2IH3C 4JI7B 1IBMO 1DTOA 4UXNA 1QU7A 1TUEB 1M56B 4FFKA 3OTOO 1XNRO 3VQYA 1HNWO 4JZGA 2F23A 3N2KB 2R9RB 2EINC 3G80A 1SERA 1M57B 3SDLA 2JRIA 5D5QA 1JPXA 2LGWA 3CCJV 3K5LA 5IYBO 3HKCA 5JH7A 1FXKB 3A0HZ 1OCOB 2YXLA 5E79Z 2DW4A 4X65O 3WU2Z 1QLEB 3FB6C 1XEQA 1KC8W 1M90W 1GM9A 3ABUA 4Z2WA 5EK0A 4DK1A 1F51A 3CYOA 3K04A 4A5UB 4BIUA 1OZ0A 1QBZA 4CS3A 3W7WA 3PJSK 5LP6C 1DGSA 3E89A 1KU9A 4R6ZA 2ZNIA 5BR8O 2KKWA 1Q5OA 4XDLA 2V4DA 1XDCA 5KA5A 4LF8B 4LWSB 5LOVA 4NYKA 1TVKA 4FFBA 4FLWA 5H5NA 1SQQH 5DN6G 2ZXWB 2QM4A 5KHGA 1TAEA 2VQEO 1EN5A 4DV6B 2XHBA 3T2MA 1P4RA 3T4ZA 4IL6Z 3HB3B 2X6BA 1PM9A 3OAAG 1RPOA 5LYJB 1ENVA 2P4KA 3CE2A 4X1KB 5IDJA 1Z2GA 3DC6A 2WLHA 2IW5A 1AJPA 4IIJA 1IURA 3H1HH 2BE3A 2VRZA 4FLYA 3RWRD 2YI8A 4DV0O 2QEXV 1S5JA 3CRAA 4CH5A 4E4EA 2OIGA 4TV9A 2QR4A 4K0KO 2CAZC 1SC5B 2QWPB 1SQVH 1R3JC 4ZIBA 3KKYA 4E2LA 4H33A 2F93B 1PP9H 5FL7G 4TQDA 3X2QC 4GKJO 3SPCA 2UUCB 4AQYO 2QWQB 1K97A 1FXHA 3BPZA 4UVBA 1H2MA 1RM1B 5IYCO 4RUFA 5EBWC 1YXBA 4LF9B 3KCXA 3RGBA 5KX5A 2E74B 4I0XB 2XNDG 2YXHA 3WFVA 3JAWB 3GWOA 2OCHA 4X9QA 2PUSA 4CH6A 2ZE8A 2GHYA 4UCSA 2WLJA 3FYEB 4LNUB 3LSSA 1N34B 4DV5O 1V54B 1B04A 1VF6A 2HKOA 1SQFA 5LL6Y 1VQLV 2L35A 2CTPA 2YI9A 3HKDA 2AZ0A 2ZIMA 2PZSA 1XMOB 5J2UA 3BA8A 2MW2B 3MHSC 3K9SA 1U97A 2Q8VA 3VQWA 2GTSA 4X20B 2H94A 4J9YB 1GK9A 3H1IH 1YJWV 4QNHB 4DW0A 3B77A 5GONB 1YIJV 3IAYA 5LA6A 1V9PA 1VMGA 2DOSA 3P32A 1B6QA 4UVCA 5BY1A 2CTWA 1N32O 5C93A 1US6A 2PTMA 3CX5F 2QM7A 2YICA 2MK3A 3APQA 3DC5A 3RYIB 4FLZA 4YJ3B 4UUJC 2Y0PA 3HKEB 5IY5C 3K58A 1I0HA 2RNBA 4ASUG 5L3GA 1G4YB 2XAJA 4R50A 1JCHA 2Y4UA 1W59A 4X66B 5K1PA 3JD2A 5B1OA 4CH3A 1VQ6V 2R9IA 2UXBO 2CE4A 1K92A 2E5LB 1KP2A 2IJKA 4DV3B 1FKAO 1GN2A 3A0RA 3B2EE 5B1BC 1P49A 2BTQB 3K79A 3B8MA 4IHJA 3IGAC 1AI7A 4ZI7B 2FMLA 4NVPA 1N4CA 2ZM6B 3P3PA 4Z1VA 2ITDC 3GWKC 4FLUA 3L72H 4LF8O 2KSDA 1ZLZA 4LCUC 4P9OA 4IHJB 5FNVA 4TWKA 5EIBD 2UUAB 3BABA 1HR0O 4J11A 1S5LZ 2Q7EA 5IYDO 1NH2D 3B4SA 4ZHQB 3J80N 1NU1H 2QKSA 4MTOA 3ASNB 1KB9F 4B3MB 2ITCC 4PDVA 2EBOA 2GUZA 5CB4A 1FD9A 1Y67A 2Z3YA 1XI1A 2ILMA 4EKWA 1K9MW 5LXTB 4FM0A 2W6IG 1GH6A 4NXMB 3CCQV 4PELA 1ZL8A 2YIAA 1DF5A 1JOYA 4BIOA 3SJBC 1EN6A 3BFRA 3J7AU 2EINB 2GSMB 1H8EG 3ZHQA 4FLXA 1MZEA 1D2DA 1EBOA 2X6CA 4CS2A 1XHXA 3E2EA 4K8ZA 3AEIA 4NB5A 4NTWA 4DK0A 2EIMC 5DECA 1ZX3A 1A32A 1XBLA 3AG3C 5KMGB 4U3JB 4PI2A 2UUCO 3E86A 1KBHA 5LP6A 1G8MA 2F4VO 5IYZB 5L3BA 1BMFG 4GUNA 4H37A 2RCVA 1LR1A 3E8HA 4LF9O 2ETNA 3CXHF 4EFEA 2PI5A 1NI8A 3QO7A 3OEHG 1VQ8V 3SJCC 3OE7G 2HFEC 1ORQC 2ARHA 1Q6UA 2ZDIA 3TXSA 3CMAV 4X1YB 4OX9O 5B66Z 1WA8A 1Y4MA 2QTSA 4TOIA 2LO1A 2WLLA 4I4TA 1JFFA 4NTYA 1N34O 5J2TB 1B3QA 5IT9N 2WLNA 3BHPA 3N2GB 3CEIA 3K0DA 1VEWA 1VF6C 4DUZB 1XNQO 4JI3O 4PA7A 2QE7G 1XILA 2QA4V 1HNZB 4KHPB 1XMOO 1Q43A 1VQOV 2JDIG 1BS3A 4FK5C 1KUQA 4DR1B 3SYOA 2GTAA 1AP5A 3MDSA 4JYBA 1RSOA 1Q90D 2ZD9A 3OR6C 3Q4HB 4WBNB 1WNSA 3DXRB 2Q68A 5IJ0B 3G6EV 4N21A 1P7GA 4JI6O 1HNXB 1QR8A 4YHHB 1GN4A 4GZRB 3ETQA 4AILC 3X2QB 5KAFZ 3OUFA 3S3XA 2EJ7A 4GKKB 2ADPA 2CGOA 3M99B 5EZYA 5IJ9B 4LF6O 4W4LA 2DQ3A 1MSDA 4X64O 3JALA 3JASA 4MW3A 4NXNB 5BXZA 1TUBA 4JZ2A 2PYLA 2WA3A 3APOA 3F5WC 4HNAA 1S3JA 3G71V 4I55B 2E5LO 2WPDG 3JARA 4YIPA 4DV3O 4JI8B 1H2LA 4N23A 2B1GA 4PHZA 1NQTA 4UCOA 1BHAA 2HHHO 3JATA 1K4CC 1NBMG 3ZRWA 5BMVA 1M1KW 5C8YB 1EM1A 4TQFA 5EYPA 2IU3A 3NR7A 3HKBA 4I50A 4FVMA 3JARB 1E1RG 2HJFC 1QQCA 4JI5B 4KP4A 2BCCH 3CCEV 1YJNV 2BSKB 2VWJA 1W0JG 4JPRA 2R72A 2QTOA 1RFYA 1WB7A 3RYCB 1VQ7V 1Y76B 3ZX6A 3SPIA 3ZHSA 5LHHA 3WB2A 3H9VA 4CBCA 1DK1A 4MVMA 3CD6V 1G1XB 4OGQB 4PV1B 2JVDA 1COWG 3AG4C 1JA8A 4PJ0Z 3ZHTA 2CUGA 5DM6V 2UU9O 2VWKA 2ZT9B 2IBZH 4UCVA 4GX0A 2CK3G 1ZUQA 5JVDA 2Q0AA 3AG2C 4HYOA 4JYYA 4DV4O 4JI2B 2DJVA 5DEDA 3OGCC 4J42A 4L8JA 4NXMO 2GDSA 1RPRA 1GN3A 2OT5A 2EZPA 3UT5A 2BTOA 1VQ9V 4LF5O 5IY5B 1K33A 1FFTB 4LBEC 4PA6A 1AR1B 5CA3A 1XL6A 3SPJA 4GX1A 3F5TA 4H13B 5LGUA 4DR2B 1FXVA 2EX3A 4GX5A 3HKCB 5LMNO 5JH7B 3EFFK 2CTQA 2X6AA 3S3WA 1F4MA 1WLEA 5B1BB 2X7RB 5JCOA 1Y74A 2IJJA 3ZBHA 4DR4B 1HW7A 3UO3A 3BCCH 4B3SB 2P6JA 3K57A 2XASA 4R7CA 4G28B 2JGDA 2YC0A 3SYPA 2Q9LA 3R66A 5CA1A 2ZDIC 1I5XA 4K35A 4PA4A 1R6NA 2JIZG 1L0LH 4MTFA 2B1IA 3L71H 5LOVB 1TVKB 4FFBB 3ZMUA 4DUYB 3A2FA 2EIKB 2W6JG 1G6UA 3D36A 2IJHA 1JR9A 1N0NA 1MZFA 3UM7A 4DUZO 1S76D 1O9HA 1K73W 4DR7B 4WFEA 4X62B 4KHPO 4JI0O 3CS5A 1DF4A 4ZBMA 2B5UA 4JI1B 5FPRA 1TA8A 1WP8A 4WFFA 1NT2B 1QHTA 2FB5A 3C3SA 3K5OA 1Q86W 4RQEA 4IIJB 4ICGA 2HR3A 1SESA 5KA6A 5LGNA 5B5EZ 3CC7V 1Q6HA 3L75H 1CXZB 1BQZA 1M93A 2OTJV 4DRXA 4DR3O 4TV9B 4J7JA 2ODMA 2QGNA 2EIMB 2HJDA 2QKCA 2WLIA 3ZHUA 4YHHO 2DYSC 3AG3B 1Q7YW 1R6KA 4IGGA 2YXYA 3K5MA 2A3QA 4UB8Z 1BHBA 2QSAA 4GKKO 2UXCO 1SA0A 1SQXH 2QDOA 3FYIB 4B3TO 2N04A 1BSMA 4QE9A 1K4DC 1IXMA 4W4KA 3CCVV 3IC9A 4GT1A 4JYCA 5LHGA 2Q67A 1WN7A 2QWNB 3T1YO 2F1MA 4LH7A 3ML0A 1I08A 3ETGA 1KMIZ 2EIJB 2A0LA 5KX5B 2IM9A 1R3IC 1OCCB 1QCEA 5FPOA 1VQ5V 3B09A 2AHZA 3BEHA 4BR6A 3RYFA 2CGNA 4LFAO 4JI5O 3RFRA 1RP3B 3SYCA 3CPWU 4TSFG 2Q0OC 4F6RA 3DGEA 4RQFA 2Z0AA 3LSUA 3JSLA 3CJHA 3K0GA 3QO8A 1E79G 4CZZA 1JQ0A 4QPKA 3CCLV 1H2GA 1WAZA 1GM7A 1NKDA 1PL0A 3HKDB 2Z5UA 5GW7A 4DR6B 1H8HG 1AP6A 2RN9A 3JCZA 1SKVA 3J81N 5JQGA 3T1HB 3QVNA 1F23A 5J2UB 3RN4A 1NH2B 4JI7O 3HPLC 4Z1MG 1FJGB 1YITV 1JVMA 4PD4F 3OMNB 3ABLC
chains in the Genus database with same CATH topology
4X1KA 1D5AA 1YEWA 2PY5A 5IYZB 1N36B 5LA6B 1WPBA 4UCUA 5IWAB 3RYCA 4FLTA 3ICXA 4LFCB 3U11A 4LFAB 4EFEA 3QTCA 4ZOLA 3SJCC 5JJEB 2PYJA 2F66C 3BRCA 4X1IA 4X1YB 4O2BB 3THOA 3JAKB 4TOIA 3U0ZA 4LR3A 4D7SA 4I4TA 4JI4B 1JFFA 4B08A 3LNNA 5J2TB 3K59A 5LMUB 5KHIA 2P5OA 1Z5VA 3BHPA 3N2GB 4JI7B 3M7MX 3RYHA 4DV7B 4DRXB 4DUZB 3VQYA 4UFZA 4DV1B 5JJJB 5JCOC 3JAWA 1HNZB 3N2KB 2F4VB 4KHPB 1Q43A 3PN1A 5D5QA 4DR1B 1FFXA 2ZIOA 1SA0B 3K5LA 4TV8A 3HKCA 3RYHB 2E3CA 5JH7A 4LNUA 5KHKA 2YXLA 4PI0A 1RSOA 4WBNB 1SQGA 1X4TA 5FNVB 1WNSA 2HEPA 4OX9B 5ITZA 1XMQB 5IJ0B 3K5NA 3VQXA 2VQFB 4EB6A 1HNXB 4DK1A 4TUYA 4O4IA 4YHHB 4UCTA 2JS5A 2ZNJA 3ETQA 4CS3A 4AILC 5LP6C 2F95B 4CC5A 1DGSA 4GKKB 1KU9A 3RYFB 2ZNIA 1J5EB 5IJ9B 5EZYA 4X20A 5CB4B 2KKWA 1Q5OA 3WB0A 1Q3EA 2V4DA 3JALA 3JASA 4NXNB 5GONA 1XNQB 3QF7A 4JI3B 4F6RB 4LF8B 1TUBA 1N33B 2PYLA 1HNWB 5LOVA 1TVKA 4FFBA 4CH4A 4FLWA 4HNAA 1XHZA 4I55B 2QM4A 3DSQA 3JARA 5KHGA 2UUBB 4JI8B 1IBLB 1TAEA 4D7TA 2OWOA 2UXDB 4PHZA 4DV6B 2XHBA 4UCOA 2JGUA 3JATA 3RYIA 4CC6A 5BMVA 4YJ3A 5C8YB 5JQGB 4TQFA 5EYPA 3HKEA 3HKBA 4LF4B 1L8DA 4I50A 3ZS8C 4FVMA 3JARB 2YIBA 5LYJB 1QQCA 1T5EA 4JI5B 5LP6B 4JI6B 4X1KB 2VWJA 4IIJA 3BAAA 3SJAC 4FLYA 2R72A 3SGIA 3RWRD 3RYCB 2YI8A 4DR5B 1S5JA 4CH5A 3WB2A 4TV9A 1H2SB 5BR8B 4LF6B 2CAZC 3SR2C 4ZOLB 2BTQA 4X64B 4BWAA 5CA0A 2JVDA 4ZIBA 4X1IB 4ZI7A 2F93B 2P22C 2VWKA 4TQDA 4UCVA 4YJ2A 4I4TB 2UUCB 5JVDA 2Q0AA 4Q6GA 4O4HA 4O4JA 1JFFB 4CS4A 2HHHB 4JI2B 4I9QA 4L8JA 3BPZA 4AHCA 1JJOA 4LF9B 3UT5A 3RGBA 4GYCB 2BTOA 5KX5A 1VF7A 2RQ6A 3BA9A 4ZHQA 3JAWB 4B3RB 3ZEDA 2PUSA 4CH6A 4YY3B 4DR2B 1FFXB 4DV0B 2EX3A 4EFBA 4HBNA 4TV8B 3HKCB 4UCSA 4JYAB 5JH7B 4LNUB 5LXTA 1N34B 4O2AA 1I94B 1B04A 1SQFA 3MAQA 4O4LA 3UQ8A 1ZAUA 5ITZB 2GV9A 2UU9B 5JCOA 1IBMB 2R70A 4DR4B 1HW7A 2YI9A 3CB2A 3HKDA 4EB6B 3E22A 5KHJA 4TUYB 4O4IB 3OTOB 4B3SB 1XNRB 3K57A 4DV4B 2ZIMA 4K8XA 2RJZA 2YIBD 2PZSA 1XMOB 5J2UA 4LFBB 3CSXA 3BA8A 5KMGA 4U3JA 5CA1A 5EZYB 3VQWA 4X20B 3JALB 3JASB 2Q7GA 5GONB 4FM2A 4LF5B 5IYZA 1TUBB 5LA6A 3IAYA 1V9PA 5LOVB 3OTFA 1TVKB 4FFBB 4DUYB 1Z5WA 4X65B 3A2FA 4LH6A 4HNAB 5JJNB 1G6UA 1M4UA 1IBKB 2ZCEA 2PTMA 2QJ1A 4GLXA 1JMKC 1O9HA 5LMNB 4DR7B 3JATB 3RYIB 4FLZA 5BMVB 4X62B 4YJ3B 3QG5A 4BW9A 4DV5B 4X1YA 5EYPB 3HKEB 3HKBB 3K58A 4O2BA 4I50B 2Q7HA 3JAKA 4JI1B 5FPRA 4LF7B 1TA8A 2R9AA 1NT2B 1QHTA 3K5OA 4X66B 5J2TA 5K1PA 4IIJB 4CH3A 5KHHA 3N2GA 3WB1A 2E5LB 1M93A 4DV3B 2VQEB 4DRXA 4TV9B 3B2EE 1P49A 2BTQB 5CA0B 3N2KA 4IHJA 3K5MA 4ZI7B 5D5PA 4NVPA 2ZM6B 1SA0A 1N32B 4UCRA 4YJ2B 5JVDB 1Q8IA 2ZINA 4FLUA 4O4HB 4O4JB 1I7FA 1O9GA 4FLVA 3VQVA 2PGGA 3FFQA 4IHJB 1WN7A 4WBNA 4JI0B 3JSNA 5FNVA 5EIBC 5EIBD 2UUAB 3BABA 2F1MA 5IJ0A 4LH7A 3CHXA 3UT5B 1KMIZ 5KX5B 2Q7EA 4K0KB 3U10A 4DV2B 2IM9A 4ZHQB 5FPOA 1XQ8A 4B3MB 4JV5B 3RYFA 2UXBB 5IJ9A 5CB4A 1XI1A 4GKJB 3RFRA 4DR3B 4F6RA 1M5IA 4KL1A 5LXTB 4FM0A 4O2AB 4AQYB 3JSLA 4NXMB 2YIAA 4I55A 4O4LB 3SJBC 2UXCB 1VQ0A 3HKDB 4DR6B 4FM1A 3E22B 4FLXA 4B3TB 4EEQA 1SKVA 5C8YA 5JQGA 2OYQA 4CS2A 3T1HB 1XHXA 1VZYA 4K8ZA 5J2UB 4DK0A 1TGOA 3T1YB 5K1XA 1FJGB 5KMGB 5LYJA 4U3JB 5CA1B 1HR0B 4PI2A 5LP6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VZY A;  1HW7 A;  1I7F A;  1VQ0 A;  3M7M X; 
#chains in the Genus database with same CATH topology
 4JI2 O;  1D5A A;  1YSC A;  1X59 A;  2DN9 A;  1N36 B;  5LA6 B;  1CEZ A;  5BZB A;  2JK5 C;  4OXS A;  5IWA B;  2XUM A;  3D8C A;  4HAM A;  3ICX A;  3ABT A;  3U11 A;  3ABK B;  2IJI A;  1M57 C;  3KG2 A;  4ZOL A;  2N74 A;  3E8B A;  3DTU B;  2PYJ A;  1NJI W;  2F66 C;  4X1I A;  5A9G A;  1FXK C;  1XOU A;  1VQ4 V;  1LNQ A;  3U0Z A;  2RMK B;  4LR3 A;  4L87 A;  3QO5 A;  2WSS G;  1I5Y A;  4JI4 B;  3AG1 C;  3LNN A;  3JD1 A;  4FMT A;  1YVW A;  5LMU B;  3JD3 A;  2O57 A;  2DE0 X;  5KHI A;  1YZB A;  2F43 G;  2P5O A;  3ASO C;  3B8N A;  2K1E A;  2Y69 B;  3OM3 B;  4G27 B;  3RYH A;  2UXN A;  3L9D A;  4IYI A;  5HFL A;  4B3S O;  1FPO A;  4DV1 B;  3E35 A;  5JCO C;  3AK2 A;  2WAM A;  4FPP A;  4BW5 A;  2LQT A;  3AG7 A;  4DW1 A;  3ZMS A;  2LW1 A;  2OCC B;  2JEU A;  3CRC A;  1FFX A;  4DV6 O;  4UV8 A;  4ABM A;  4TV8 A;  3RYH B;  2E3C A;  3CRQ A;  4JTD B;  5KHK A;  3CXC U;  4PI0 A;  1EN4 A;  2DMX A;  1SQG A;  1X4T A;  2LP7 A;  4MVO A;  5FNV B;  2Y48 A;  5ITZ A;  3WG7 C;  3OFN G;  3K5N A;  1YHQ V;  3AG4 B;  5LGT A;  4EB6 A;  1W2B U;  2YUA A;  1OV9 A;  4DR7 O;  4TUY A;  2HLD G;  4O4I A;  3D36 C;  4X62 O;  2Y0I A;  1NTM H;  2JS5 A;  2ZNJ A;  3SJQ C;  3CWB H;  1N8R W;  3LDD A;  3FB8 C;  4JI1 O;  1BZK A;  1VQN V;  1J5E B;  1PNK A;  2A7W A;  3OD4 A;  2GUZ B;  5CB4 B;  3SYA A;  2PI4 A;  3LNM B;  4F6E A;  1S72 V;  5KUK A;  1HNW B;  4WFH A;  3JYC A;  1ZL8 B;  1XHZ A;  2WWW A;  1FYJ A;  1IX9 A;  3DSQ A;  3M8A A;  2OWO A;  3HR0 A;  2LFS A;  2JGU A;  2VS0 A;  3RVZ A;  1M9N A;  4CC6 A;  3KZI Z;  2LGQ A;  1H38 A;  4LF4 B;  1L8D A;  3ZS8 C;  5EBL C;  1PNL A;  1QLN A;  1BT8 A;  1LUW A;  5LP6 B;  4OPA A;  4WFA V;  4JAU A;  3BAA A;  3SJA C;  5CBF A;  3SGI A;  3ZRV A;  2WLM A;  4JTC B;  4DR5 B;  2G38 A;  1AJQ A;  4RUE A;  1H2S B;  5BR8 B;  2FKX A;  3SR2 C;  1S0V A;  5CA0 A;  3TET A;  4D6T H;  3ZRS A;  3K08 A;  2C2A A;  3EHB B;  5KUM A;  3LUT B;  2P22 C;  1WA8 B;  4I9W A;  5GTH Z;  4P9P A;  1HP8 A;  4X8A A;  1P84 F;  4YJ2 A;  2WLL B;  4I4T B;  2XAH A;  1S5H C;  3LDE A;  4O4H A;  2X0L A;  4O4J A;  1JFF B;  3L70 H;  4CS4 A;  2XAQ A;  1ZTE A;  3ZCC A;  4AHC A;  1JJO A;  3T1C A;  2WLK A;  4FZ1 A;  1WB8 A;  2HP8 A;  3QNE A;  2RQ6 A;  3BA9 A;  4QPJ A;  1Q82 W;  4B3R B;  5IE9 A;  3CCM V;  3ZED A;  4JGS A;  5H2F Z;  1R3K C;  4WF9 V;  4YY3 B;  2AW9 A;  1FJG O;  5B1A C;  2CH7 A;  4DV0 B;  2YS8 A;  4EFB A;  3MD0 A;  1BCC H;  2NLJ C;  4MVU A;  3CCR V;  2FTK A;  4I5S A;  4LC1 A;  4JYA B;  2KQX A;  1N36 O;  4O2A A;  5LBQ A;  4J7Z A;  1I94 B;  1RSO B;  3W7S A;  3LSQ A;  3MAQ A;  4O4L A;  3UQ8 A;  2DYS B;  5HFM A;  1CP9 A;  2GV9 A;  2R70 A;  2UXX A;  1EZJ A;  4X66 O;  3E22 A;  4DO2 A;  1VIB A;  4IT5 A;  4K8X A;  5J9P C;  2RJZ A;  4UVA A;  2JS3 A;  1HDJ A;  4PDL A;  1K7D A;  4LFB B;  1EFR G;  3A0B Z;  5EZY B;  3H1K H;  3JAL B;  3JAS B;  4J7K A;  4XBF A;  3IFX A;  5LMU O;  2Q7G A;  1TUB B;  3JCU Z;  3OTF A;  1Z5W A;  4MSW C;  2E76 B;  4HNA B;  5JJN B;  2ZM6 O;  1Q81 W;  1IBK B;  4U7O A;  2ZE5 A;  5A2Q N;  2ZCE A;  1MAB G;  2QJ1 A;  1JMK C;  1PD3 A;  2IU0 A;  4DV1 O;  1Y6X A;  2ZR3 A;  3JAT B;  5F2V O;  3ZRW B;  5BMV B;  4BW9 A;  3UCS C;  4DV5 B;  3FAV A;  2UUA O;  5EYP B;  3MHH C;  3HKB B;  1CPY A;  4O2B A;  4I50 B;  4OPH A;  3JAK A;  4LF7 B;  1GKF A;  3SPG A;  2R9A A;  4PA3 A;  3VOU A;  4JF3 A;  3L74 H;  4F4L A;  5H6Q A;  2YEV A;  2WA4 A;  2KG7 A;  4B3M O;  4KFM A;  1GTO A;  3CRM A;  3GB7 C;  5AG2 A;  1ARO P;  1AIL A;  4ZKI A;  1R6T A;  3N2K A;  4QE7 A;  1V55 C;  3ABL B;  5D5P A;  4UV9 A;  2AGA A;  1NS1 A;  1J5E O;  1SRY A;  4Q20 A;  2DYR C;  1N32 B;  4UCR A;  2QWR B;  1WP7 A;  1FXK A;  5JVD B;  2ZIN A;  3D3I A;  3ETD A;  1I7F A;  1KKD A;  1PKX A;  1E1Q G;  4FLV A;  2PGG A;  1H2K A;  1XRE A;  4PDM A;  3FB7 C;  3ZMV A;  1L0N H;  3I5D A;  3RT3 C;  4H44 B;  1IVS A;  3CHX A;  4RO2 A;  3G6B A;  3UT5 B;  1N0J A;  4PDR A;  1SS3 A;  3U10 A;  3H1J H;  1AR4 A;  3O9O A;  4DV2 B;  2HG5 C;  2QM8 A;  1K3E A;  4H0L B;  2RDC A;  3H1L H;  1JX9 A;  4MVZ A;  4LF4 O;  1XQ8 A;  3AG1 B;  4JV5 B;  2UXB B;  3ZRX A;  2LW7 A;  3ABM C;  3CCS V;  3ASO B;  2N05 A;  3E8G A;  1YTF B;  1M5I A;  4KL1 A;  4LWS A;  1VAR A;  4QIW F;  3FD9 A;  4DR5 O;  1SZX A;  1Y74 B;  4RWU A;  4FM1 A;  1J95 A;  3GVM A;  2OIE A;  2JEX A;  4PA9 A;  4EEQ A;  2W0F C;  1UJW B;  2OYQ A;  2P67 A;  1BGY H;  3T4D A;  1VZY A;  1VF5 B;  2JGD B;  1TGO A;  3I55 V;  5EC1 C;  5LYJ A;  1B06 A;  3H01 A;  5CA1 B;  1HR0 B;  1OCR C;  4X1K A;  3WG7 B;  3W7U A;  1HNZ O;  1YEW A;  1WPB A;  2YID A;  1THZ A;  2ZKO A;  3OMA B;  4MVQ A;  4DR1 O;  4FLT A;  4LFC B;  4B7K A;  3QTC A;  2LJ2 A;  5JJE B;  1WJZ A;  1Q6I A;  4B3R O;  4MT8 A;  3BRC A;  1UPG A;  3OUS A;  4YY3 O;  3P3N A;  2B9Z A;  1R73 A;  1BQ0 A;  2Y4T A;  2H8P C;  3THO A;  1R1B A;  2PF4 E;  4TT3 G;  1HNX O;  4I7Z B;  2L6L A;  4D7S A;  3ZHV A;  4JYA O;  3K06 A;  2XTA A;  4B08 A;  5L3C A;  1I94 O;  2V7Q G;  3UO2 A;  5L3F A;  1XUQ A;  3BVO A;  1KKC A;  1VQK V;  3B40 A;  3ZJZ A;  1YDX A;  1YTF D;  3G67 A;  3M7M X;  2KB1 A;  1D5N A;  2EIL C;  3G4S V;  4DV7 B;  4DRX B;  4HZ3 A;  4NXN O;  2WLI B;  4I0X A;  4UFZ A;  3P30 A;  1IDS A;  3E83 A;  5JJJ B;  2QKA A;  3JAW A;  4UB6 Z;  1NR1 A;  2F4V B;  1K34 A;  4X88 A;  5H9C A;  4LFB O;  1AB3 A;  3OR7 C;  2OTL V;  1OHH G;  3PN1 A;  1GN6 A;  4JI8 O;  1MSW D;  2ZIO A;  1SA0 B;  4LNU A;  4AI8 A;  1ROP A;  4MW8 A;  3ZN0 A;  3OT7 A;  2DWD C;  2IH1 C;  4J41 A;  1BE3 H;  2HEP A;  5CN0 A;  1IBK O;  3OW2 U;  5B3S C;  4OX9 B;  3ZIA G;  2ADQ B;  1XMQ B;  5KLV H;  4MVR A;  3VQX A;  3D3Q A;  2VQF B;  1GAX A;  4C7U A;  2Q69 A;  3STZ C;  1HWY A;  3W7X A;  4UCT A;  1KP3 A;  2F95 B;  1AI4 A;  2YSU B;  4CC5 A;  2JJ1 G;  4X89 A;  1XL4 A;  4QGP A;  4LF7 O;  4U7N A;  3RYF B;  1NZ6 A;  2AHY A;  4X20 A;  3TCU A;  3WB0 A;  5L3D A;  1Q3E A;  5E1A C;  5GON A;  2ZE7 A;  1XNQ B;  3QF7 A;  4JI3 B;  4F6R B;  5JWP A;  1N33 B;  1MNG A;  4JAA A;  4CH4 A;  3CJH B;  2P06 A;  1OCZ C;  1YCI A;  4P2Z A;  2UUB B;  4U3F H;  4P30 A;  2BOC C;  1IBL B;  4D7T A;  2UXD B;  1F7Y A;  2EJR A;  3CC2 V;  1L1F A;  3RYI A;  5B1A B;  4YJ3 A;  1AR5 A;  3C90 A;  5JQG B;  3JD4 A;  4WFB V;  1M56 C;  1VQP V;  3HKE A;  4GCZ A;  3TJT A;  1SQB H;  3ZHR A;  2QWO B;  2YIB A;  1KD1 W;  1T5E A;  4JI6 B;  3AK1 A;  1MOF A;  1IXB A;  5B1N A;  5KAI Z;  2XT9 A;  3FX7 A;  4DR2 O;  1OCO C;  4B7E A;  5FLX N;  3LDC A;  2D2C B;  3E8F A;  3ZMZ A;  3TK1 A;  3OMI B;  1QLE C;  4LF6 B;  2ATK C;  4ZOL B;  4DV2 O;  2BTQ A;  4X64 B;  4BIZ A;  4BWA A;  2D3O W;  4MTX A;  2YDE A;  3CC4 V;  1GMG A;  3RW0 A;  4X1I B;  4ZI7 A;  4JV5 O;  3STL C;  4R8C A;  4DR4 O;  1MMM A;  1AI6 A;  3TGU H;  5H6R A;  4Q6G A;  2HHH B;  2A9H A;  3JAM N;  4I9Q A;  3CCU V;  2CDY A;  2P7T C;  1KQS U;  1PNM A;  5EBM C;  4QJF B;  4GYC B;  2ZXW C;  1VF7 A;  2GBO A;  4ZHQ A;  4DUY O;  3OGI B;  4FJC C;  5LHI A;  2NN4 A;  1FFX B;  4HBN A;  4TV8 B;  3C3T A;  2EIK C;  2HVJ C;  4G2K A;  4WCE V;  3OEE G;  5LXT A;  2ZE6 A;  2Q73 A;  2K9P A;  5EC2 C;  3AG2 B;  1KYO F;  1ZAU A;  4LFC O;  5ITZ B;  4JTA B;  2UU9 B;  4BAY A;  3IJ4 A;  4NTX A;  1IBM B;  3CB2 A;  4EB6 B;  2E75 B;  1V55 B;  1FS0 G;  5KHJ A;  4TUY B;  4O4I B;  3OTO B;  1XNR B;  1NTK H;  4K3A A;  2DYR B;  4DV4 B;  4MTG A;  2H3O A;  2YIB D;  2ZQM A;  1S77 D;  3CSX A;  3K9A A;  1FAF A;  3F7V C;  5KMG A;  4U3J A;  2NNU A;  1QR9 A;  1PV0 A;  1ZWI C;  4YXW G;  3F7Y C;  3RVY A;  2AXT Z;  4LF5 B;  4FM2 A;  3JD0 A;  5IYZ A;  1SF9 A;  3SPH A;  4XDK A;  4X65 B;  3L73 H;  2P90 A;  4LH6 A;  1M4U A;  2Q4P A;  1KEC A;  3NXS A;  4DV7 O;  4GLX A;  3TXQ A;  1RM1 C;  1GM8 A;  5LMN B;  4DXW A;  1GRJ A;  3QG5 A;  4WFG A;  4X1Y A;  4IYH A;  3ABM B;  3SYQ A;  3IC7 A;  2JJ2 G;  4DYL A;  2Q7H A;  4J10 A;  5TIS Z;  1EZV H;  1URF A;  2CTR A;  5J2T A;  2LFR A;  4MS2 A;  3AK3 A;  1JJ2 U;  5CMU A;  3I56 V;  1AJN A;  5KHH A;  3N2G A;  2EIJ C;  1XMQ O;  3WB1 A;  5L3E A;  1V54 C;  2VQF O;  1OCC C;  4KXR A;  2VQE B;  5CA0 B;  1PL4 A;  3CP1 A;  3FKS G;  1OCR B;  4DR6 O;  1UFI A;  1Y66 A;  4YJ2 B;  4YIO A;  1LUV A;  1Q8I A;  4O4H B;  4O4J B;  1ZSP A;  1N33 O;  3K3W A;  1O9G A;  2NR5 A;  1VQM V;  1IZ3 A;  3T1H O;  1QVG U;  3VQV A;  3Q4H A;  3FFQ A;  4WBN A;  4JI0 B;  3JSN A;  5CBH A;  5EIB C;  1U96 A;  2UUB O;  4FIP C;  3DXR A;  5IJ0 A;  1IBL O;  2ZR2 A;  2UXD O;  3KCY A;  3FB5 C;  3VBB A;  1SET A;  4K0K B;  1SZT A;  1NVP B;  5IWA O;  2V1D A;  1F4N A;  4RAI A;  4XDJ A;  2A06 H;  3CME V;  4NR1 A;  2W0X A;  4J80 A;  5CBG A;  2CH7 B;  5IJ9 A;  1YI2 V;  3RBZ A;  4GKJ B;  1AI5 A;  4DR3 B;  3ZN1 A;  4O2A B;  4AQY B;  1MA1 A;  3ABK C;  2EIL B;  3W7T A;  1P7B A;  1YJ9 V;  2FYU H;  4I55 A;  1VP7 A;  4O4L B;  2XAF A;  4KUM A;  2BOB C;  2DWE C;  2UXC B;  1GO3 F;  3N27 A;  1QNM A;  1NTZ H;  4JI4 O;  1PPJ H;  1VQ0 A;  3CRR A;  3E22 B;  2M7W A;  4B3T B;  3O65 A;  5C8Y A;  3EXA A;  4LP8 A;  1DLB A;  3T1Y B;  3EVK A;  5K1X A;  1H2N A;  2M6Y A;  1K8A W;  5B3S B;  2BSK A;  3A8T A;  4NKG B;  2PY5 A;  1SQP H;  1BL8 A;  2Y69 C;  5GTI Z;  4UCU A;  3RYC A;  4GX2 A;  1K5S A;  1Y76 A;  1K5Q A;  2A79 B;  1YF2 A;  1QVF U;  1R3L C;  4LFA B;  2AZ2 A;  4J9Z B;  3R65 A;  4MVS A;  3BY6 A;  2OCC C;  2HVK C;  2EZO A;  1WPX A;  1NR7 A;  3FAV B;  2FL4 A;  3UKM A;  1MG1 A;  4O2B B;  2EUL A;  1NVP D;  3JAK B;  2Q5Z A;  4JAV A;  4FZ0 A;  1OCZ B;  2P4V A;  3ASN C;  1AVM A;  3ZMT A;  1W0K G;  3ETE A;  2Q6A A;  1OJH A;  3K59 A;  2DQ0 A;  2YEV B;  2KG7 B;  2XAG A;  1Z5V A;  3K03 A;  2XOK G;  4JAS A;  2IH3 C;  4JI7 B;  1IBM O;  1DTO A;  4UXN A;  1QU7 A;  1TUE B;  1M56 B;  4FFK A;  3OTO O;  1XNR O;  3VQY A;  1HNW O;  4JZG A;  2F23 A;  3N2K B;  2R9R B;  2EIN C;  3G80 A;  1SER A;  1M57 B;  3SDL A;  2JRI A;  5D5Q A;  1JPX A;  2LGW A;  3CCJ V;  3K5L A;  5IYB O;  3HKC A;  5JH7 A;  1FXK B;  3A0H Z;  1OCO B;  2YXL A;  5E79 Z;  2DW4 A;  4X65 O;  3WU2 Z;  1QLE B;  3FB6 C;  1XEQ A;  1KC8 W;  1M90 W;  1GM9 A;  3ABU A;  4Z2W A;  5EK0 A;  4DK1 A;  1F51 A;  3CYO A;  3K04 A;  4A5U B;  4BIU A;  1OZ0 A;  1QBZ A;  4CS3 A;  3W7W A;  3PJS K;  5LP6 C;  1DGS A;  3E89 A;  1KU9 A;  4R6Z A;  2ZNI A;  5BR8 O;  2KKW A;  1Q5O A;  4XDL A;  2V4D A;  1XDC A;  5KA5 A;  4LF8 B;  4LWS B;  5LOV A;  4NYK A;  1TVK A;  4FFB A;  4FLW A;  5H5N A;  1SQQ H;  5DN6 G;  2ZXW B;  2QM4 A;  5KHG A;  1TAE A;  2VQE O;  1EN5 A;  4DV6 B;  2XHB A;  3T2M A;  1P4R A;  3T4Z A;  4IL6 Z;  3HB3 B;  2X6B A;  1PM9 A;  3OAA G;  1RPO A;  5LYJ B;  1ENV A;  2P4K A;  3CE2 A;  4X1K B;  5IDJ A;  1Z2G A;  3DC6 A;  2WLH A;  2IW5 A;  1AJP A;  4IIJ A;  1IUR A;  3H1H H;  2BE3 A;  2VRZ A;  4FLY A;  3RWR D;  2YI8 A;  4DV0 O;  2QEX V;  1S5J A;  3CRA A;  4CH5 A;  4E4E A;  2OIG A;  4TV9 A;  2QR4 A;  4K0K O;  2CAZ C;  1SC5 B;  2QWP B;  1SQV H;  1R3J C;  4ZIB A;  3KKY A;  4E2L A;  4H33 A;  2F93 B;  1PP9 H;  5FL7 G;  4TQD A;  3X2Q C;  4GKJ O;  3SPC A;  2UUC B;  4AQY O;  2QWQ B;  1K97 A;  1FXH A;  3BPZ A;  4UVB A;  1H2M A;  1RM1 B;  5IYC O;  4RUF A;  5EBW C;  1YXB A;  4LF9 B;  3KCX A;  3RGB A;  5KX5 A;  2E74 B;  4I0X B;  2XND G;  2YXH A;  3WFV A;  3JAW B;  3GWO A;  2OCH A;  4X9Q A;  2PUS A;  4CH6 A;  2ZE8 A;  2GHY A;  4UCS A;  2WLJ A;  3FYE B;  4LNU B;  3LSS A;  1N34 B;  4DV5 O;  1V54 B;  1B04 A;  1VF6 A;  2HKO A;  1SQF A;  5LL6 Y;  1VQL V;  2L35 A;  2CTP A;  2YI9 A;  3HKD A;  2AZ0 A;  2ZIM A;  2PZS A;  1XMO B;  5J2U A;  3BA8 A;  2MW2 B;  3MHS C;  3K9S A;  1U97 A;  2Q8V A;  3VQW A;  2GTS A;  4X20 B;  2H94 A;  4J9Y B;  1GK9 A;  3H1I H;  1YJW V;  4QNH B;  4DW0 A;  3B77 A;  5GON B;  1YIJ V;  3IAY A;  5LA6 A;  1V9P A;  1VMG A;  2DOS A;  3P32 A;  1B6Q A;  4UVC A;  5BY1 A;  2CTW A;  1N32 O;  5C93 A;  1US6 A;  2PTM A;  3CX5 F;  2QM7 A;  2YIC A;  2MK3 A;  3APQ A;  3DC5 A;  3RYI B;  4FLZ A;  4YJ3 B;  4UUJ C;  2Y0P A;  3HKE B;  5IY5 C;  3K58 A;  1I0H A;  2RNB A;  4ASU G;  5L3G A;  1G4Y B;  2XAJ A;  4R50 A;  1JCH A;  2Y4U A;  1W59 A;  4X66 B;  5K1P A;  3JD2 A;  5B1O A;  4CH3 A;  1VQ6 V;  2R9I A;  2UXB O;  2CE4 A;  1K92 A;  2E5L B;  1KP2 A;  2IJK A;  4DV3 B;  1FKA O;  1GN2 A;  3A0R A;  3B2E E;  5B1B C;  1P49 A;  2BTQ B;  3K79 A;  3B8M A;  4IHJ A;  3IGA C;  1AI7 A;  4ZI7 B;  2FML A;  4NVP A;  1N4C A;  2ZM6 B;  3P3P A;  4Z1V A;  2ITD C;  3GWK C;  4FLU A;  3L72 H;  4LF8 O;  2KSD A;  1ZLZ A;  4LCU C;  4P9O A;  4IHJ B;  5FNV A;  4TWK A;  5EIB D;  2UUA B;  3BAB A;  1HR0 O;  4J11 A;  1S5L Z;  2Q7E A;  5IYD O;  1NH2 D;  3B4S A;  4ZHQ B;  3J80 N;  1NU1 H;  2QKS A;  4MTO A;  3ASN B;  1KB9 F;  4B3M B;  2ITC C;  4PDV A;  2EBO A;  2GUZ A;  5CB4 A;  1FD9 A;  1Y67 A;  2Z3Y A;  1XI1 A;  2ILM A;  4EKW A;  1K9M W;  5LXT B;  4FM0 A;  2W6I G;  1GH6 A;  4NXM B;  3CCQ V;  4PEL A;  1ZL8 A;  2YIA A;  1DF5 A;  1JOY A;  4BIO A;  3SJB C;  1EN6 A;  3BFR A;  3J7A U;  2EIN B;  2GSM B;  1H8E G;  3ZHQ A;  4FLX A;  1MZE A;  1D2D A;  1EBO A;  2X6C A;  4CS2 A;  1XHX A;  3E2E A;  4K8Z A;  3AEI A;  4NB5 A;  4NTW A;  4DK0 A;  2EIM C;  5DEC A;  1ZX3 A;  1A32 A;  1XBL A;  3AG3 C;  5KMG B;  4U3J B;  4PI2 A;  2UUC O;  3E86 A;  1KBH A;  5LP6 A;  1G8M A;  2F4V O;  5IYZ B;  5L3B A;  1BMF G;  4GUN A;  4H37 A;  2RCV A;  1LR1 A;  3E8H A;  4LF9 O;  2ETN A;  3CXH F;  4EFE A;  2PI5 A;  1NI8 A;  3QO7 A;  3OEH G;  1VQ8 V;  3SJC C;  3OE7 G;  2HFE C;  1ORQ C;  2ARH A;  1Q6U A;  2ZDI A;  3TXS A;  3CMA V;  4X1Y B;  4OX9 O;  5B66 Z;  1WA8 A;  1Y4M A;  2QTS A;  4TOI A;  2LO1 A;  2WLL A;  4I4T A;  1JFF A;  4NTY A;  1N34 O;  5J2T B;  1B3Q A;  5IT9 N;  2WLN A;  3BHP A;  3N2G B;  3CEI A;  3K0D A;  1VEW A;  1VF6 C;  4DUZ B;  1XNQ O;  4JI3 O;  4PA7 A;  2QE7 G;  1XIL A;  2QA4 V;  1HNZ B;  4KHP B;  1XMO O;  1Q43 A;  1VQO V;  2JDI G;  1BS3 A;  4FK5 C;  1KUQ A;  4DR1 B;  3SYO A;  2GTA A;  1AP5 A;  3MDS A;  4JYB A;  1RSO A;  1Q90 D;  2ZD9 A;  3OR6 C;  3Q4H B;  4WBN B;  1WNS A;  3DXR B;  2Q68 A;  5IJ0 B;  3G6E V;  4N21 A;  1P7G A;  4JI6 O;  1HNX B;  1QR8 A;  4YHH B;  1GN4 A;  4GZR B;  3ETQ A;  4AIL C;  3X2Q B;  5KAF Z;  3OUF A;  3S3X A;  2EJ7 A;  4GKK B;  2ADP A;  2CGO A;  3M99 B;  5EZY A;  5IJ9 B;  4LF6 O;  4W4L A;  2DQ3 A;  1MSD A;  4X64 O;  3JAL A;  3JAS A;  4MW3 A;  4NXN B;  5BXZ A;  1TUB A;  4JZ2 A;  2PYL A;  2WA3 A;  3APO A;  3F5W C;  4HNA A;  1S3J A;  3G71 V;  4I55 B;  2E5L O;  2WPD G;  3JAR A;  4YIP A;  4DV3 O;  4JI8 B;  1H2L A;  4N23 A;  2B1G A;  4PHZ A;  1NQT A;  4UCO A;  1BHA A;  2HHH O;  3JAT A;  1K4C C;  1NBM G;  3ZRW A;  5BMV A;  1M1K W;  5C8Y B;  1EM1 A;  4TQF A;  5EYP A;  2IU3 A;  3NR7 A;  3HKB A;  4I50 A;  4FVM A;  3JAR B;  1E1R G;  2HJF C;  1QQC A;  4JI5 B;  4KP4 A;  2BCC H;  3CCE V;  1YJN V;  2BSK B;  2VWJ A;  1W0J G;  4JPR A;  2R72 A;  2QTO A;  1RFY A;  1WB7 A;  3RYC B;  1VQ7 V;  1Y76 B;  3ZX6 A;  3SPI A;  3ZHS A;  5LHH A;  3WB2 A;  3H9V A;  4CBC A;  1DK1 A;  4MVM A;  3CD6 V;  1G1X B;  4OGQ B;  4PV1 B;  2JVD A;  1COW G;  3AG4 C;  1JA8 A;  4PJ0 Z;  3ZHT A;  2CUG A;  5DM6 V;  2UU9 O;  2VWK A;  2ZT9 B;  2IBZ H;  4UCV A;  4GX0 A;  2CK3 G;  1ZUQ A;  5JVD A;  2Q0A A;  3AG2 C;  4HYO A;  4JYY A;  4DV4 O;  4JI2 B;  2DJV A;  5DED A;  3OGC C;  4J42 A;  4L8J A;  4NXM O;  2GDS A;  1RPR A;  1GN3 A;  2OT5 A;  2EZP A;  3UT5 A;  2BTO A;  1VQ9 V;  4LF5 O;  5IY5 B;  1K33 A;  1FFT B;  4LBE C;  4PA6 A;  1AR1 B;  5CA3 A;  1XL6 A;  3SPJ A;  4GX1 A;  3F5T A;  4H13 B;  5LGU A;  4DR2 B;  1FXV A;  2EX3 A;  4GX5 A;  3HKC B;  5LMN O;  5JH7 B;  3EFF K;  2CTQ A;  2X6A A;  3S3W A;  1F4M A;  1WLE A;  5B1B B;  2X7R B;  5JCO A;  1Y74 A;  2IJJ A;  3ZBH A;  4DR4 B;  1HW7 A;  3UO3 A;  3BCC H;  4B3S B;  2P6J A;  3K57 A;  2XAS A;  4R7C A;  4G28 B;  2JGD A;  2YC0 A;  3SYP A;  2Q9L A;  3R66 A;  5CA1 A;  2ZDI C;  1I5X A;  4K35 A;  4PA4 A;  1R6N A;  2JIZ G;  1L0L H;  4MTF A;  2B1I A;  3L71 H;  5LOV B;  1TVK B;  4FFB B;  3ZMU A;  4DUY B;  3A2F A;  2EIK B;  2W6J G;  1G6U A;  3D36 A;  2IJH A;  1JR9 A;  1N0N A;  1MZF A;  3UM7 A;  4DUZ O;  1S76 D;  1O9H A;  1K73 W;  4DR7 B;  4WFE A;  4X62 B;  4KHP O;  4JI0 O;  3CS5 A;  1DF4 A;  4ZBM A;  2B5U A;  4JI1 B;  5FPR A;  1TA8 A;  1WP8 A;  4WFF A;  1NT2 B;  1QHT A;  2FB5 A;  3C3S A;  3K5O A;  1Q86 W;  4RQE A;  4IIJ B;  4ICG A;  2HR3 A;  1SES A;  5KA6 A;  5LGN A;  5B5E Z;  3CC7 V;  1Q6H A;  3L75 H;  1CXZ B;  1BQZ A;  1M93 A;  2OTJ V;  4DRX A;  4DR3 O;  4TV9 B;  4J7J A;  2ODM A;  2QGN A;  2EIM B;  2HJD A;  2QKC A;  2WLI A;  3ZHU A;  4YHH O;  2DYS C;  3AG3 B;  1Q7Y W;  1R6K A;  4IGG A;  2YXY A;  3K5M A;  2A3Q A;  4UB8 Z;  1BHB A;  2QSA A;  4GKK O;  2UXC O;  1SA0 A;  1SQX H;  2QDO A;  3FYI B;  4B3T O;  2N04 A;  1BSM A;  4QE9 A;  1K4D C;  1IXM A;  4W4K A;  3CCV V;  3IC9 A;  4GT1 A;  4JYC A;  5LHG A;  2Q67 A;  1WN7 A;  2QWN B;  3T1Y O;  2F1M A;  4LH7 A;  3ML0 A;  1I08 A;  3ETG A;  1KMI Z;  2EIJ B;  2A0L A;  5KX5 B;  2IM9 A;  1R3I C;  1OCC B;  1QCE A;  5FPO A;  1VQ5 V;  3B09 A;  2AHZ A;  3BEH A;  4BR6 A;  3RYF A;  2CGN A;  4LFA O;  4JI5 O;  3RFR A;  1RP3 B;  3SYC A;  3CPW U;  4TSF G;  2Q0O C;  4F6R A;  3DGE A;  4RQF A;  2Z0A A;  3LSU A;  3JSL A;  3CJH A;  3K0G A;  3QO8 A;  1E79 G;  4CZZ A;  1JQ0 A;  4QPK A;  3CCL V;  1H2G A;  1WAZ A;  1GM7 A;  1NKD A;  1PL0 A;  3HKD B;  2Z5U A;  5GW7 A;  4DR6 B;  1H8H G;  1AP6 A;  2RN9 A;  3JCZ A;  1SKV A;  3J81 N;  5JQG A;  3T1H B;  3QVN A;  1F23 A;  5J2U B;  3RN4 A;  1NH2 B;  4JI7 O;  3HPL C;  4Z1M G;  1FJG B;  1YIT V;  1JVM A;  4PD4 F;  3OMN B;  3ABL C; 
#chains in the Genus database with same CATH homology
 4X1K A;  1D5A A;  1YEW A;  2PY5 A;  5IYZ B;  1N36 B;  5LA6 B;  1WPB A;  4UCU A;  5IWA B;  3RYC A;  4FLT A;  3ICX A;  4LFC B;  3U11 A;  4LFA B;  4EFE A;  3QTC A;  4ZOL A;  3SJC C;  5JJE B;  2PYJ A;  2F66 C;  3BRC A;  4X1I A;  4X1Y B;  4O2B B;  3THO A;  3JAK B;  4TOI A;  3U0Z A;  4LR3 A;  4D7S A;  4I4T A;  4JI4 B;  1JFF A;  4B08 A;  3LNN A;  5J2T B;  3K59 A;  5LMU B;  5KHI A;  2P5O A;  1Z5V A;  3BHP A;  3N2G B;  4JI7 B;  3M7M X;  3RYH A;  4DV7 B;  4DRX B;  4DUZ B;  3VQY A;  4UFZ A;  4DV1 B;  5JJJ B;  5JCO C;  3JAW A;  1HNZ B;  3N2K B;  2F4V B;  4KHP B;  1Q43 A;  3PN1 A;  5D5Q A;  4DR1 B;  1FFX A;  2ZIO A;  1SA0 B;  3K5L A;  4TV8 A;  3HKC A;  3RYH B;  2E3C A;  5JH7 A;  4LNU A;  5KHK A;  2YXL A;  4PI0 A;  1RSO A;  4WBN B;  1SQG A;  1X4T A;  5FNV B;  1WNS A;  2HEP A;  4OX9 B;  5ITZ A;  1XMQ B;  5IJ0 B;  3K5N A;  3VQX A;  2VQF B;  4EB6 A;  1HNX B;  4DK1 A;  4TUY A;  4O4I A;  4YHH B;  4UCT A;  2JS5 A;  2ZNJ A;  3ETQ A;  4CS3 A;  4AIL C;  5LP6 C;  2F95 B;  4CC5 A;  1DGS A;  4GKK B;  1KU9 A;  3RYF B;  2ZNI A;  1J5E B;  5IJ9 B;  5EZY A;  4X20 A;  5CB4 B;  2KKW A;  1Q5O A;  3WB0 A;  1Q3E A;  2V4D A;  3JAL A;  3JAS A;  4NXN B;  5GON A;  1XNQ B;  3QF7 A;  4JI3 B;  4F6R B;  4LF8 B;  1TUB A;  1N33 B;  2PYL A;  1HNW B;  5LOV A;  1TVK A;  4FFB A;  4CH4 A;  4FLW A;  4HNA A;  1XHZ A;  4I55 B;  2QM4 A;  3DSQ A;  3JAR A;  5KHG A;  2UUB B;  4JI8 B;  1IBL B;  1TAE A;  4D7T A;  2OWO A;  2UXD B;  4PHZ A;  4DV6 B;  2XHB A;  4UCO A;  2JGU A;  3JAT A;  3RYI A;  4CC6 A;  5BMV A;  4YJ3 A;  5C8Y B;  5JQG B;  4TQF A;  5EYP A;  3HKE A;  3HKB A;  4LF4 B;  1L8D A;  4I50 A;  3ZS8 C;  4FVM A;  3JAR B;  2YIB A;  5LYJ B;  1QQC A;  1T5E A;  4JI5 B;  5LP6 B;  4JI6 B;  4X1K B;  2VWJ A;  4IIJ A;  3BAA A;  3SJA C;  4FLY A;  2R72 A;  3SGI A;  3RWR D;  3RYC B;  2YI8 A;  4DR5 B;  1S5J A;  4CH5 A;  3WB2 A;  4TV9 A;  1H2S B;  5BR8 B;  4LF6 B;  2CAZ C;  3SR2 C;  4ZOL B;  2BTQ A;  4X64 B;  4BWA A;  5CA0 A;  2JVD A;  4ZIB A;  4X1I B;  4ZI7 A;  2F93 B;  2P22 C;  2VWK A;  4TQD A;  4UCV A;  4YJ2 A;  4I4T B;  2UUC B;  5JVD A;  2Q0A A;  4Q6G A;  4O4H A;  4O4J A;  1JFF B;  4CS4 A;  2HHH B;  4JI2 B;  4I9Q A;  4L8J A;  3BPZ A;  4AHC A;  1JJO A;  4LF9 B;  3UT5 A;  3RGB A;  4GYC B;  2BTO A;  5KX5 A;  1VF7 A;  2RQ6 A;  3BA9 A;  4ZHQ A;  3JAW B;  4B3R B;  3ZED A;  2PUS A;  4CH6 A;  4YY3 B;  4DR2 B;  1FFX B;  4DV0 B;  2EX3 A;  4EFB A;  4HBN A;  4TV8 B;  3HKC B;  4UCS A;  4JYA B;  5JH7 B;  4LNU B;  5LXT A;  1N34 B;  4O2A A;  1I94 B;  1B04 A;  1SQF A;  3MAQ A;  4O4L A;  3UQ8 A;  1ZAU A;  5ITZ B;  2GV9 A;  2UU9 B;  5JCO A;  1IBM B;  2R70 A;  4DR4 B;  1HW7 A;  2YI9 A;  3CB2 A;  3HKD A;  4EB6 B;  3E22 A;  5KHJ A;  4TUY B;  4O4I B;  3OTO B;  4B3S B;  1XNR B;  3K57 A;  4DV4 B;  2ZIM A;  4K8X A;  2RJZ A;  2YIB D;  2PZS A;  1XMO B;  5J2U A;  4LFB B;  3CSX A;  3BA8 A;  5KMG A;  4U3J A;  5CA1 A;  5EZY B;  3VQW A;  4X20 B;  3JAL B;  3JAS B;  2Q7G A;  5GON B;  4FM2 A;  4LF5 B;  5IYZ A;  1TUB B;  5LA6 A;  3IAY A;  1V9P A;  5LOV B;  3OTF A;  1TVK B;  4FFB B;  4DUY B;  1Z5W A;  4X65 B;  3A2F A;  4LH6 A;  4HNA B;  5JJN B;  1G6U A;  1M4U A;  1IBK B;  2ZCE A;  2PTM A;  2QJ1 A;  4GLX A;  1JMK C;  1O9H A;  5LMN B;  4DR7 B;  3JAT B;  3RYI B;  4FLZ A;  5BMV B;  4X62 B;  4YJ3 B;  3QG5 A;  4BW9 A;  4DV5 B;  4X1Y A;  5EYP B;  3HKE B;  3HKB B;  3K58 A;  4O2B A;  4I50 B;  2Q7H A;  3JAK A;  4JI1 B;  5FPR A;  4LF7 B;  1TA8 A;  2R9A A;  1NT2 B;  1QHT A;  3K5O A;  4X66 B;  5J2T A;  5K1P A;  4IIJ B;  4CH3 A;  5KHH A;  3N2G A;  3WB1 A;  2E5L B;  1M93 A;  4DV3 B;  2VQE B;  4DRX A;  4TV9 B;  3B2E E;  1P49 A;  2BTQ B;  5CA0 B;  3N2K A;  4IHJ A;  3K5M A;  4ZI7 B;  5D5P A;  4NVP A;  2ZM6 B;  1SA0 A;  1N32 B;  4UCR A;  4YJ2 B;  5JVD B;  1Q8I A;  2ZIN A;  4FLU A;  4O4H B;  4O4J B;  1I7F A;  1O9G A;  4FLV A;  3VQV A;  2PGG A;  3FFQ A;  4IHJ B;  1WN7 A;  4WBN A;  4JI0 B;  3JSN A;  5FNV A;  5EIB C;  5EIB D;  2UUA B;  3BAB A;  2F1M A;  5IJ0 A;  4LH7 A;  3CHX A;  3UT5 B;  1KMI Z;  5KX5 B;  2Q7E A;  4K0K B;  3U10 A;  4DV2 B;  2IM9 A;  4ZHQ B;  5FPO A;  1XQ8 A;  4B3M B;  4JV5 B;  3RYF A;  2UXB B;  5IJ9 A;  5CB4 A;  1XI1 A;  4GKJ B;  3RFR A;  4DR3 B;  4F6R A;  1M5I A;  4KL1 A;  5LXT B;  4FM0 A;  4O2A B;  4AQY B;  3JSL A;  4NXM B;  2YIA A;  4I55 A;  4O4L B;  3SJB C;  2UXC B;  1VQ0 A;  3HKD B;  4DR6 B;  4FM1 A;  3E22 B;  4FLX A;  4B3T B;  4EEQ A;  1SKV A;  5C8Y A;  5JQG A;  2OYQ A;  4CS2 A;  3T1H B;  1XHX A;  1VZY A;  4K8Z A;  5J2U B;  4DK0 A;  1TGO A;  3T1Y B;  5K1X A;  1FJG B;  5KMG B;  5LYJ A;  4U3J B;  5CA1 B;  1HR0 B;  4PI2 A;  5LP6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...