1HW7A

Hsp33, heat shock protein with redox-regulated chaperone activity
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
229
structure length
229
Chain Sequence
HDQLHRYLFENFAVRGELVTVSETLQQILENHDYPQPVKNVLAELLVATSLLTATLKFDGDITVQLQGDGPMNLAVINGNNNQQMRGVARVQGEIPENADLKTLVGNGYVVITITPSEGERYQGVVGLEGDTLAACLEDYFMRSEQLPTRLFIRTGDVDGKPAAGGMLLQVMPAQNAQQDDFDHLATLTETIKTEELLTLPANEVLWRLYHEEEVTVYDPQDVEFKCTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEAT SHOCK PROTEIN HSP33
publication title The 2.2 A crystal structure of Hsp33: a heat shock protein with redox-regulated chaperone activity.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone
total genus 51
structure length 229
sequence length 229
ec nomenclature
pdb deposition date 2001-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.480 Mainly Alpha Orthogonal Bundle Helix Hairpins helix hairpin bin 1hw7A02
3.55.30.10 Alpha Beta 3-Layer(bab) Sandwich Hsp33 domain Hsp33 domain 1hw7A01
1I7FA 1VQ0A 3M7MX 1VZYA 1HW7A
chains in the Genus database with same CATH superfamily
4RWUA 2B1IA 2OT5A 1I0HA 3CHXA 3RYCA 1EN5A 4O4IB 3D36C 4UVBA 1NQTA 4JI0O 4MVSA 1OCRC 1IXBA 3ETQA 4B3RB 1ENVA 1XUQA 5L3CA 1ROPA 3CD6V 4JTAB 2KSDA 1SZTA 2LGQA 3OT7A 1JCHA 2DYSC 2WAMA 1PM9A 3TJTA 4R8CA 4P9PA 1VQ9V 2IH3C 3CE2A 2UXBO 4JI6O 2GUZA 2OTLV 3E22A 5IYZA 1XL6A 4H13B 4PA4A 4TUYB 4B7EA 1SF9A 4NXNO 1TUEB 2BTQB 4JI2O 4R50A 5CA0A 3LNMB 1TUBA 5CB4A 1H38A 2Q5ZA 4G28B 1DF4A 3OGCC 4DR3B 5JJEB 4J80A 1M1KW 2EIJC 1W0KG 4GZRB 4LWSB 5L3FA 4K8ZA 2OWOA 1H8HG 4X62O 1FS0G 2JS3A 2X7RB 1MMMA 2UUBB 2Q7GA 3CPWU 1N0JA 2ZM6B 2IJJA 5LP6A 3K5LA 5LHGA 1TAEA 2ZIMA 2VQFB 4RUEA 3JSNA 3I56V 3AG2B 1VQ8V 3Q4HA 2M7WA 2WLLA 2PZSA 5KUKA 1JOYA 5JQGB 1OV9A 3ABKC 3F7YC 2YI8A 4B3RO 1P84F 1MZFA 3ABTA 3RYIA 3M8AA 3DXRA 1BE3H 1Q5OA 3AG3C 3ASOC 2NNUA 3EXAA 4ZOLA 3GB7C 4X1YA 1IBLO 2GSMB 2HEPA 3RYHB 4BIUA 1R3JC 5F2VO 1NJIW 3THOA 5JCOC 2ZDIA 5KA5A 2RDCA 1BQZA 3T1HB 5EZYA 4ZHQB 2IJHA 1SA0B 1THZA 5LXTB 1NTMH 2P7TC 2RQ6A 1WAZA 4LH7A 2V1DA 1RFYA 5TISZ 3ZIAG 3SR2C 1B04A 4EFEA 3JALB 4KHPB 2CUGA 1AJNA 1P7BA 2CTPA 1EN6A 4DV2B 3CWBH 1LNQA 1MG1A 2XTAA 1XL4A 2IJIA 1XMOB 1NZ6A 1HR0O 2GBOA 2PYLA 4Z2WA 1SKVA 1M57B 1D5NA 1SQGA 4FM2A 2QEXV 2W6IG 1XHXA 4IL6Z 4YHHO 2F4VB 1FXKA 4D6TH 3ZHTA 3LUTB 2R70A 5J2UB 4JAUA 3OMIB 1B3QA 3ZHQA 4P2ZA 4LF5B 1XNQO 4XBFA 5FLXN 3EHBB 1SQXH 3AG2C 2Q6AA 3UO2A 4OPAA 2XASA 2IBZH 4F6RA 5BMVB 1FXHA 4X66B 1VQNV 1IBKB 3K5NA 1YTFB 3CCMV 1ZTEA 2Q0OC 3M99B 1H2LA 1MABG 2WLNA 1W0JG 5KX5A 4LFCB 2HR3A 3W7TA 2DYRB 3HKDB 3T4ZA 1VQ7V 2ZR3A 5ITZA 5GONB 3OAAG 5LYJB 1RM1C 3CYOA 4BR6A 1YSCA 2PGGA 4DV1B 4I50A 3EVKA 3LDEA 3GVMA 3OMNB 1LR1A 1COWG 3BPZA 1NH2B 3MHHC 1WP8A 2AW9A 5IJ0B 1YHQV 4BIZA 2KG7A 3F5WC 2OIEA 3G4SV 1S5JA 3WG7B 4NKGB 4JYBA 1AJPA 1M56B 1AP6A 4I4TA 4D7TA 2EILB 2LW7A 3ETDA 3RFRA 2Q68A 4AQYB 4MW8A 3ABLB 4MVZA 1FAFA 3IGAC 2Q7HA 4B3MO 4FFKA 3JASB 2XHBA 3D3QA 4TV8A 3L73H 2QKCA 3F5TA 4J9ZB 2OCCB 3CRAA 3CJHA 4KL1A 1M57C 2JGDA 1N33O 4X65B 3ZN1A 2WLHA 2BSKB 2XOKG 4YJ3B 4H37A 3D3IA 1RSOA 1PNLA 3T4DA 1MZEA 5JJNB 1S77D 4Q20A 3CCVV 4DV5O 1R3KC 3F7VC 2EULA 3K9SA 4BAYA 4C7UA 2XAHA 3I55V 4U7NA 5EIBC 5KA6A 1R1BA 4X1IB 1M5IA 2A9HA 2M6YA 2UUCB 1IX9A 3FB5C 4DR4O 4JI8O 4CBCA 1VZYA 4GX2A 1VQ5V 5EBMC 3K5MA 3ZBHA 3FB6C 1ORQC 4O2BB 2FKXA 5A2QN 4QNHB 2P22C 2Y0PA 4O4HA 1H2MA 4DUYO 1OCOC 3RYFA 2X0LA 2A3QA 5IYBO 5IYCO 2HJDA 4YIPA 1VQLV 5B3SB 3ZRWA 3RVZA 4AQYO 1P4RA 2ZE7A 3UT5B 4B3SO 2ILMA 3FAVA 4EFBA 1DTOA 3ZS8C 3W7UA 4TV9B 4GKKB 1WNSA 2UXNA 3RN4A 1EFRG 1Z5WA 3ZJZA 3LSUA 3SPHA 3TCUA 3WG7C 4G27B 4X88A 1M56C 2DW4A 5KAIZ 4KXRA 4UCOA 2EILC 5KHJA 2JRIA 2X6CA 5LA6B 3ABLC 3CX5F 3ZRSA 1E1RG 4PV1B 1K97A 4EB6A 4HNAB 3ZX6A 2XAQA 2P67A 1SRYA 4H44B 3VQVA 1Y67A 3SPCA 1QR9A 3HB3B 2OCCC 1UPGA 4R6ZA 4DRXA 4U3JB 2IW5A 5IJ9A 2UUCO 3JATB 2EJ7A 1I94O 2WA4A 4JI1B 4O2AA 1HW7A 2F1MA 4BW9A 1SETA 2QSAA 2QA4V 1HNWB 4DYLA 4W4LA 4JTDB 4QGPA 3N2GA 1M93A 4NXMB 2Y48A 4JYYA 1SERA 2CH7B 1Q6IA 5L3DA 2IU0A 4LF4B 1IBMB 3RYCB 3UQ8A 3OUSA 4CS4A 3R66A 4U3FH 1NU1H 2CTRA 3P30A 1VF6A 1M9NA 3ZEDA 3ZMZA 2UXXA 2UUAO 1K4CC 1AI6A 2RMKB 2W0XA 3IJ4A 4X89A 4DR1B 5BR8B 3HKCA 1S5HC 1N34B 1TVKB 1Q6HA 1Y4MA 1KKDA 4UCRA 2ZNIA 4MTXA 3P32A 5EYPA 1KMIZ 4CC6A 2FTKA 1CP9A 4DV0O 5B3SC 1B06A 3JAMN 3FX7A 5IWAO 1K3EA 4JYAB 5LHHA 2VQEB 5JJJB 1OCCB 3HKBA 2E74B 3CCSV 1NVPB 1TUBB 3CCJV 3JAWA 4UCSA 4LF6B 3AEIA 5EBWC 4CH3A 2YDEA 3HKEA 3E83A 1FPOA 1PL4A 3CSXA 4AHCA 3O65A 5C8YB 3SGIA 2QR4A 2QM8A 1JVMA 3A0BZ 1XEQA 3K3WA 4LF7O 2CGOA 4K0KO 2Y4TA 1J95A 2YC0A 4E2LA 5L3EA 4FLTA 4PDMA 1H2GA 2Z3YA 4X64B 2FB5A 3DC5A 4LF4O 1BHBA 1HDJA 4PDRA 2H8PC 4G2KA 4JV5B 3AG4B 4JI3B 1OZ0A 5AG2A 5KLVH 4UVAA 4J7KA 3CXHF 1NR7A 3GWKC 3MAQA 3B09A 5B1BB 1S0VA 5DM6V 3VBBA 1FFXB 3H1KH 1Q43A 3OMAB 2CTQA 3JARA 4LFBB 1XMQB 4OX9B 1YJ9V 1XNRB 3WB2A 3CCEV 3SPJA 4X1YB 2FMLA 5B1OA 2B9ZA 2H3OA 3JD2A 3A0HZ 2AHZA 3SPIA 2DWEC 3WB1A 2VQEO 2QWOB 5H2FZ 5LMUO 4DR2B 1RPRA 5LGTA 1N32B 4LF9O 2LGWA 4IYHA 5A9GA 4DR6B 2ZR2A 2HJFC 1Y6XA 2UXCB 4CS2A 3U10A 1W59A 2FL4A 1Q82W 1AR5A 3IFXA 4PA6A 2RN9A 3L9DA 3P3PA 1GM9A 4DW0A 2ZQMA 3IAYA 1OCCC 2O57A 2F93B 1CEZA 3LDDA 1DGSA 4UUJC 1GM8A 1S76D 2HVJC 1VMGA 4IIJB 1G6UA 3H1LH 4K8XA 3W7XA 1PD3A 5HFMA 4I55B 1KUQA 2CK3G 2OCHA 1K92A 4B08A 3A8TA 4ZI7A 3T1CA 2PI4A 2JEXA 3UO3A 3K79A 3B40A 4J9YB 3ZN0A 3ZHSA 2LP7A 4MVOA 1UJWB 5KMGB 4OX9O 1XNRO 4FFBB 1CPYA 3AG4C 1PV0A 3K0DA 1JFFA 1SQBH 5KX5B 2WLIA 5IDJA 5ITZB 1AB3A 5GTIZ 3K57A 1QNMA 4HBNA 4U7OA 1JX9A 1EZJA 4UB6Z 3ZRVA 4DR6O 1BCCH 3DGEA 4N23A 3BFRA 2YIDA 4JTCB 1KQSU 4TWKA 1WB7A 2MW2B 3WU2Z 4YY3B 1AVMA 3E8GA 1HNXB 1FKAO 3NXSA 4O4IA 3QO7A 4ZIBA 5JCOA 1NKDA 2MK3A 4QIWF 1IXMA 4GYCB 3U11A 1X4TA 4JPRA 4L87A 2JK5C 4DR3O 4LF8B 2KG7B 5JVDA 4XDJA 1LUWA 1KD1W 1YIJV 2VS0A 1HWYA 4DR5B 2GDSA 2L35A 1YDXA 1F4MA 2UUBO 2Q9LA 2QM7A 1L8DA 2QWRB 3BY6A 4FLVA 4NVPA 2ZM6O 3E35A 2W0FC 1B6QA 2KKWA 4DR7B 4TUYA 2D2CB 4X8AA 2VQFO 1LUVA 3T2MA 3A0RA 3SJAC 2BTOA 3FB8C 2IU3A 1VQ6V 1GRJA 2BTQA 3C3SA 3G6EV 1K8AW 3JSLA 1US6A 2B5UA 1BQ0A 2Z0AA 3H1JH 2WA3A 1SC5B 5FL7G 2LO1A 4I0XB 1GM7A 4DV7B 3E2EA 4HYOA 3E89A 4LWSA 1Q81W 1RSOB 1FXVA 3VQXA 4NTYA 2R9AA 2WWWA 1VQKV 4RQEA 1J5EB 2X6BA 2HLDG 5EC1C 5JWPA 2G38A 1WP7A 4O4LA 5H6QA 4UCTA 4CH5A 2EZPA 3SPGA 4X1KB 1Q3EA 1FJGB 2EINB 1XDCA 3VOUA 2AZ2A 5KHKA 2YICA 3T1HO 1Y74A 2E76B 3ABMB 1WB8A 2YEVA 4GX0A 1KYOF 5LOVA 3JAKA 4B3TB 4WBNA 4YJ2B 4DV3B 3K04A 4K3AA 2XAJA 2ITDC 2GTAA 3OGIB 4O4HB 4KHPO 4WFBV 4ABMA 4IGGA 2P5OA 4DV2O 2QDOA 3ZRWB 3ZMUA 4ICGA 4WFGA 4LFAB 5CA1B 3H01A 2HHHB 2Q8VA 3TETA 1XMOO 1YVWA 2ODMA 3ASNB 4ZKIA 1Y76B 2PTMA 3FAVB 4IT5A 5CA3A 4NTXA 5IT9N 2N04A 1SA0A 5CMUA 3CXCU 2JGUA 1H2SB 4N21A 3OEHG 4PHZA 4F4LA 4WFAV 3OW2U 1WA8B 4O4JB 2Q69A 2PI5A 2F4VO 1VARA 4PA7A 3BCCH 3S3XA 4X20B 3BA8A 5FNVA 2EX3A 3CEIA 3CRCA 1MA1A 1ZL8B 3K08A 3G71V 4LNUA 4LF5O 5E1AC 4EB6B 1J5EO 1SZXA 4JI7B 2Q67A 1L0LH 2B1GA 3QNEA 4JZ2A 4X66O 1IBKO 1XREA 3CMAV 4FZ0A 4LFCO 3HR0A 1I5XA 4DV4B 4O2AB 1Z2GA 4B3TO 1U97A 4LBEC 1GMGA 1GTOA 2F95B 3N2GB 4DV1O 3ZMVA 3J7AU 4XDKA 1EN4A 3JCZA 2VRZA 3ZMSA 4PDLA 4ASUG 5CBHA 3K5OA 1S5LZ 1BMFG 5J2UA 1KP2A 2Q0AA 2YXLA 1DK1A 2EINC 2EIKB 2DYRC 4AILC 2KQXA 3ABMC 4DUZB 4LFAO 4FM1A 2HHHO 5GTHZ 2RCVA 4TSFG 2AZ0A 5L3GA 3ML0A 1MSWD 4P30A 4RQFA 4FIPC 2JIZG 1JMKC 2A06H 1EBOA 4XDLA 1NI8A 5HFLA 3N2KB 5EYPB 3ICXA 2YXYA 4JASA 1F23A 1L1FA 4CH6A 4QPJA 3KCYA 3CRQA 4JI5B 1IZ3A 3SJCC 2Q4PA 4JI7O 5IJ0A 2HKOA 1BHAA 3PN1A 3SYPA 4X65O 2R9RB 2AXTZ 1NTZH 2GHYA 3NR7A 5KUMA 4FM0A 5FPRA 1VQPV 3SDLA 1IDSA 2Y69B 1Q8IA 2YS8A 1GN4A 4TQDA 3FFQA 2EBOA 1AP5A 5DECA 1XOUA 2F43G 3AG1B 1QVGU 4PJ0Z 3OUFA 2WLMA 1HNZB 1GN2A 3CC4V 2P4VA 3T1YB 1SQVH 5FPOA 1Y66A 5C93A 2BSKA 4YJ3A 1KBHA 3BEHA 1T5EA 4H33A 4PDVA 5DEDA 3QF7A 4UVCA 2ZKOA 2LQTA 1Q86W 1M90W 4MVMA 3APOA 2P4KA 3JARB 1V54B 5IE9A 5EK0A 2EJRA 2LJ2A 4I9QA 1SESA 2EIKC 3CCLV 3CB2A 3RVYA 1XILA 1VF6C 4D7SA 1BT8A 4WCEV 4JF3A 4E4EA 4JAVA 5EC2C 4FLUA 4GKKO 1X59A 2EIMB 1IURA 2GUZB 1AR4A 3MDSA 3E22B 3J80N 2ZINA 1Q7YW 5IYZB 4O2BA 4FLZA 1R6NA 4IYIA 1PPJH 3WB0A 1K7DA 3BVOA 4J10A 2QM4A 4JI0B 4LP8A 5CA0B 1YJWV 4FVMA 1W2BU 3VQWA 5CB4B 3B77A 2GTSA 3X2QB 4KP4A 1XHZA 3IC7A 3KCXA 3OM3B 1S3JA 3CC7V 2K9PA 1E79G 1MOFA 3UT5A 1PP9H 3UKMA 3B8NA 3AK2A 4MSWC 4HAMA 4GCZA 4YXWG 3L75H 4NYKA 2HVKC 1P49A 2UXBB 4JI6B 1VQMV 4JI1O 3AG7A 1HNZO 3BA9A 4GX5A 1HNWO 2P90A 1SS3A 5CBGA 1N4CA 5LP6B 2BE3A 3CMEV 2Y69C 3A2FA 5LGUA 4NXMO 4ZI7B 4MT8A 4DV6B 4NXNB 3Q4HB 3L74H 3W7WA 1IBMO 4JI2B 5IY5B 2EZOA 3CRMA 1KECA 2WLLB 1YITV 2ADPA 4LR3A 3C90A 1PKXA 4HNAA 1URFA 1GKFA 1BSMA 4BIOA 3AG1C 4WFFA 5BXZA 2LFRA 1K4DC 1VF5B 3RYIB 5BZBA 1K33A 1M4UA 2ZE8A 4FLWA 4FLYA 3CS5A 1K5SA 4X62B 1BGYH 3DXRB 4DR1O 1F4NA 2DE0X 4PD4F 5BR8O 1H2KA 5H6RA 2NR5A 4ZOLB 1K73W 3DTUB 1I7FA 1PL0A 4A5UB 2IH1C 3RWRD 3KKYA 1N34O 2QWNB 2VWJA 4F6EA 2PY5A 1V54C 3D36A 4MVRA 2CH7A 3E86A 4EEQA 5EZYB 4UV9A 5J2TA 4JYAO 1K34A 2BOBC 3B4SA 3CCRV 3TXQA 3CP1A 3JYCA 4LF6O 4MW3A 2R72A 2PF4E 5H5NA 5JVDB 2Q7EA 2EIMC 4PI2A 2UXDB 1JA8A 4YIOA 1NTKH 1KP3A 3KG2A 4LCUC 1TVKA 1IBLB 2ZXWB 4J41A 2QJ1A 3G80A 1JJOA 5B1NA 2ITCC 1RP3B 5CN0A 3X2QC 4X64O 4DV6O 1VQOV 4JV5O 4NB5A 4JI3O 4FPPA 2CDYA 3LSQA 4NTWA 5JH7A 1R73A 1I08A 4FJCC 4IHJA 1GO3F 2BOCC 2YIBD 4BWAA 1FXKB 3J81N 1N36B 1GAXA 5LMNB 1VEWA 5H9CA 5LP6C 2PUSA 5C8YA 3ZHVA 4J7JA 4DK0A 3ETGA 4LFBO 1XMQO 4F6RB 2JEUA 4O4LB 3RBZA 3DC6A 3I5DA 5IY5C 4JZGA 4UCVA 3SYQA 4CZZA 4AI8A 3H9VA 4MTGA 4UFZA 1HR0B 1IVSA 4DXWA 1WPBA 1ZLZA 2ZE6A 1Y74B 2AHYA 2QE7G 5B1BC 2YEVB 2YI9A 3K0GA 3M7MX 5LOVB 4DR2O 3JAKB 4WBNB 2CE4A 4J11A 1N32O 2CTWA 2IJKA 4YHHB 3ZHUA 3O9OA 4I50B 2K1EA 3FB7C 5LBQA 4I7ZB 1YEWA 4GKJB 1RM1B 2UXCO 2ZD9A 1XNQB 2UXDO 5KHHA 1O9GA 1FFXA 1AILA 2ZDIC 1YZBA 2YIBA 5KHIA 4OGQB 3OTOB 1OCZB 4WF9V 4UB8Z 5LL6Y 1K9MW 1NT2B 1JJ2U 3K9AA 1PNMA 2AGAA 5BY1A 1SQQH 1SQPH 1F7YA 5B1AB 2QKAA 3JCUZ 4X9QA 4I4TB 4WFEA 3JD0A 2V7QG 2OIGA 2QTOA 4PELA 5FNVB 2ZCEA 2IM9A 3P3NA 4Z1MG 2FYUH 2ZXWC 1XI1A 1V55B 2Y4UA 1N36O 4J7ZA 4TV8B 3QG5A 5LMNO 4LNUB 1QR8A 2DJVA 3CJHB 2JGDB 4QPKA 1NS1A 4BW5A 2ATKC 3OFNG 1FYJA 1O9HA 1AR1B 3QTCA 4OXSA 2OTJV 1FXKC 4IIJA 2QWPB 3SYOA 1Q6UA 3SYAA 1YF2A 4L8JA 3K59A 4I55A 4Q6GA 3ZHRA 5IYDO 2XAGA 5KHGA 3OE7G 1I5YA 2HFEC 2L6LA 3JD1A 4B3MB 3K06A 4YY3O 4GKJO 1SQFA 1HNXO 1WJZA 5D5QA 2CAZC 3L70H 3D8CA 5JQGA 5KMGA 4FFBA 3OTOO 3LNNA 1AI4A 4MTFA 1N33B 3DSQA 3ABUA 5CBFA 3EFFK 4LF8O 3B2EE 4W4KA 3UM7A 3E8HA 4RO2A 4TOIA 1P7GA 3ETEA 3RYFB 4CS3A 4DV5B 4DR5O 3GWOA 4TQFA 1JPXA 2ARHA 4DK1A 2WLJA 1VQ4V 3RYHA 3KZIZ 1OCOB 2F23A 2P6JA 1OCZC 4DR7O 1QCEA 3U0ZA 4DR4B 4MTOA 1PNKA 3H1HH 4HZ3A 4JI8B 4GUNA 4ZHQA 1DF5A 2F66C 5LXTA 1VQ0A 3TK1A 2A79B 2E75B 5EIBD 1Z5VA 5B1AC 2A0LA 1AJQA 1G1XB 3LDCA 4DV7O 3JALA 2DOSA 2ZIOA 2DQ0A 4DUYB 3MD0A 1YTFD 3ZCCA 2D3OW 1U96A 4UV8A 2H94A 3ZMTA 1FD9A 1V55C 3AK1A 2WPDG 4GT1A 2PYJA 4B3SB 1QQCA 4DRXB 1FJGO 2NN4A 3H1IH 3OEEG 1BS3A 2N74A 4Z1VA 5IJ9B 4FZ1A 2P06A 4K35A 1ZSPA 5KAFZ 3IC9A 1E1QG 3CRRA 2KB1A 4TT3G 3QO5A 2YXHA 2JS5A 4DV3O 2N05A 2JVDA 4I0XA 1NH2D 4JYCA 5E79Z 4ZBMA 2OYQA 4KUMA 2XAFA 1YCIA 5GW7A 3OTFA 4DW1A 3S3WA 1R3LC 2WSSG 3FKSG 1AI7A 1H8EG 3JD4A 3OD4A 3G67A 1XQ8A 1ZAUA 1VF7A 2QKSA 4PA3A 1R3IC 3STZC 5BMVA 1AROP 3B8MA 5K1XA 3BRCA 4MVQA 1AI5A 4X1KA 2E5LB 4JGSA 1CXZB 3HKDA 3K58A 1ZX3A 1I94B 4OPHA 3HPLC 3HKCB 1HP8A 3BABA 3K03A 1EM1A 1QLEB 5GONA 5LYJA 2C2AA 4CH4A 4YJ2A 5J9PC 1GN3A 2NLJC 4FK5C 1VIBA 1KB9F 4KFMA 4RAIA 1NR1A 2XNDG 5LGNA 4EKWA 4JI4B 2QWQB 5B66Z 2E3CA 1D2DA 3FYIB 1JQ0A 3HKBB 1TGOA 2RNBA 4MVUA 1D5AA 3BHPA 3CCQV 3RW0A 3ASNC 3JAWB 4DO2A 1BL8A 1MSDA 5K1PA 2UUAB 5CA1A 1WLEA 3FYEB 4JAAA 3HKEB 5EBLC 3MHSC 1QHTA 2DWDC 2LFSA 2GV9A 4WFHA 1Y76A 1H2NA 5D5PA 3SJQC 1QVFU 1WPXA 1OJHA 3PJSK 4DV4O 3CCUV 4P9OA 5DN6G 3G6BA 1WA8A 4O4JA 3N27A 2DQ3A 1K5QA 1A32A 2Q73A 5B5EZ 4LC1A 4DV0B 1DLBA 1RPOA 1MNGA 4X20A 1S72V 5IWAB 1ZL8A 2YUAA 3JASA 3R65A 4H0LB 4MS2A 3FD9A 3RGBA 1ZUQA 2UU9B 5L3BA 1Q90D 4CC5A 1GK9A 3QO8A 2LW1A 4J42A 2X6AA 4DUZO 3TXSA 2CGNA 1WN7A 3C3TA 2XUMA 3SJBC 3TGUH 2ETNA 2E5LO 3L72H 4PA9A 4LF7B 2Z5UA 4K0KB 2JDIG 1YI2V 4GLXA 3RT3C 1VP7A 3ZRXA 4PI0A 1KKCA 4FLXA 1QBZA 3OR6C 4X1IA 2ZT9B 1OCRB 2JJ1G 5J2TB 4JI4O 3BAAA 2JJ2G 2WLKA 4I9WA 4JI5O 1F51A 1L0NH 1EZVH 1R6KA 1QU7A 2DYSB 3STLC 1KC8W 1JR9A 4B7KA 1QLEC 3SYCA 1BZKA 2DN9A 1V9PA 3W7SA 1UFIA 1G4YB 3L71H 1NBMG 1FFTB 4FMTA 1G8MA 2ADQB 1QLNA 4QE7A 1GH6A 3N2KA 2ZE5A 2HP8A 4GX1A 1R6TA 5LMUB 3E8BA 4NR1A 4TV9A 3APQA 4R7CA 4LF9B 2UU9O 4LH6A 2EIJB 5JH7B 4IHJB 3WFVA 3T1YO 5LHIA 2BCCH 3CC2V 3VQYA 3UCSC 5LA6A 1YXBA 1GN6A 2Y0IA 2RJZA 1JFFB 2VWKA 2QTSA 1KU9A 2YIAA 1N8RW 2W6JG 1TA8A 4QE9A 2R9IA 3QVNA 4QJFB 2V4DA 4UXNA 4UCUA 1N0NA 2WLIB 2ZNJA 4U3JA 2DMXA 3ABKB 2YSUB 4I5SA 3JD3A 3JATA 3OR7C 2QGNA 3LSSA 3E8FA 1ZWIC 1OHHG 1YJNV 2HG5C 2XT9A 1NVPD 3AK3A 1XBLA 4RUFA 3AG3B 3ASOB 2A7WA
chains in the Genus database with same CATH topology
2EX3A 4U3JB 5IJ9A 3CHXA 3RYCA 3JATB 4O4IB 4LNUA 4EB6B 4JI1B 4O2AA 1HW7A 2F1MA 4BW9A 4I4TB 1HNWB 4JI7B 3ETQA 4B3RB 3N2GA 1M93A 4NXMB 5FNVB 2ZCEA 2IM9A 4LF4B 1XI1A 1IBMB 3RYCB 4TV8B 3QG5A 4LNUB 3UQ8A 4DV4B 4O2AB 4CS4A 2F95B 3N2GB 3ZEDA 3E22A 5IYZA 1O9HA 4TUYB 3QTCA 3K5OA 5J2UA 4DR1B 2Q0AA 4IIJA 5BR8B 2YXLA 2BTQB 3HKCA 4L8JA 5CA0A 3K59A 4I55A 1TUBA 5CB4A 1N34B 1TVKB 4Q6GA 4AILC 4DUZB 4UCRA 5KHGA 2ZNIA 4DR3B 4FM1A 5JJEB 5EYPA 1KMIZ 4CC6A 4B3MB 4K8ZA 2OWOA 4JYAB 2VQEB 5JJJB 1SQFA 3HKBA 5D5QA 2CAZC 1JMKC 1TUBB 3JAWA 2UUBB 2Q7GA 5JQGA 5KMGA 4FFBA 3LNNA 2ZM6B 4UCSA 4LF6B 1N33B 3DSQA 3N2KB 5LP6A 4CH3A 5EYPB 3K5LA 1TAEA 3ICXA 3HKEA 2ZIMA 2VQFB 3B2EE 3JSNA 3CSXA 4AHCA 4TOIA 4CH6A 5C8YB 3SGIA 3RYFB 4CS3A 4JI5B 4DV5B 2PZSA 3SJCC 5JQGB 4TQFA 2YI8A 4DK1A 5IJ0A 4FLTA 3RYHA 3PN1A 3RYIA 4X64B 3U0ZA 4DR4B 4JI8B 4JV5B 4ZHQA 4FM0A 5FPRA 4JI3B 2F66C 1Q5OA 5LXTA 1VQ0A 4ZOLA 1Q8IA 4X1YA 2HEPA 3RYHB 5EIBD 3MAQA 1Z5VA 4TQDA 3THOA 5JCOC 3FFQA 3JALA 3T1HB 5EZYA 2ZIOA 4ZHQB 4DUYB 1FFXB 1SA0B 1Q43A 3JARA 5LXTB 4LFBB 1XMQB 1HNZB 4OX9B 1XNRB 2RQ6A 3WB2A 4LH7A 3T1YB 4X1YB 2PYJA 5FPOA 3SR2C 1B04A 4EFEA 4B3SB 1QQCA 3JALB 4DRXB 4KHPB 4YJ3A 1T5EA 3QF7A 3WB1A 5IJ9B 4DR2B 4DV2B 3JARB 1N32B 4DR6B 4I9QA 2JS5A 2JVDA 1XMOB 3CB2A 2OYQA 2UXCB 4CS2A 4D7SA 2PYLA 3U10A 1SKVA 3OTFA 4FLUA 1SQGA 4FM2A 1XQ8A 1ZAUA 1VF7A 3IAYA 1XHXA 5BMVA 2F4VB 3E22B 2F93B 2ZINA 5IYZB 5K1XA 4O2BA 4FLZA 3BRCA 4X1KA 1DGSA 2E5LB 2R70A 5J2UB 3WB0A 3HKDA 3K58A 4LF5B 1I94B 4IIJB 1G6UA 2QM4A 3HKCB 4K8XA 4JI0B 3BABA 5CA0B 5GONA 4I55B 4FVMA 5LYJA 3VQWA 5CB4B 4CH4A 4YJ2A 4F6RA 5BMVB 1XHZA 4X66B 4B08A 3K5NA 1IBKB 3UT5A 4ZI7A 5KX5A 4LFCB 4JI4B 3HKDB 2E3CA 5ITZA 3HKBB 1TGOA 1D5AA 3BHPA 1P49A 5GONB 2UXBB 4JI6B 5LYJB 3JAWB 5KMGB 4FFBB 3BA9A 2PGGA 4DV1B 4I50A 1JFFA 5K1PA 2UUAB 5CA1A 5LP6B 3A2FA 3HKEB 1QHTA 4ZI7B 5KX5B 2GV9A 4DV6B 4NXNB 5D5PA 5ITZB 3K57A 4JI2B 3BPZA 4LR3A 4HBNA 4HNAA 4O4JA 5IJ0B 4DV0B 3RYIB 4X20A 1M4UA 4FLWA 4YY3B 5IWAB 4FLYA 4X62B 1HNXB 1S5JA 3JASA 4O4IA 3RGBA 4ZIBA 2UU9B 4ZOLB 5JCOA 4CC5A 1I7FA 4I4TA 4D7TA 3RWRD 4GYCB 2VWJA 3RFRA 3U11A 4AQYB 1X4TA 2PY5A 4LF8B 2Q7HA 5JVDA 1WN7A 4EEQA 3SJBC 5EZYB 5J2TA 3JASB 2XHBA 4TV8A 4DR5B 4LF7B 4K0KB 4GLXA 4KL1A 1L8DA 4FLVA 4NVPA 4X65B 2R72A 4PI0A 4FLXA 2KKWA 4DR7B 4TUYA 2Q7EA 4X1IA 5JVDB 4PI2A 4YJ3B 2UXDB 5J2TB 1RSOA 3SJAC 2BTOA 3BAAA 5JJNB 2BTQA 3JSLA 1TVKA 1IBLB 2QJ1A 1JJOA 5EIBC 4DV7B 4X1IB 1M5IA 2UUCB 3VQXA 1V9PA 2R9AA 1VZYA 3K5MA 1J5EB 5JH7A 4IHJA 4O4LA 2YIBD 4UCTA 4BWAA 4CH5A 4O2BB 3N2KA 4X1KB 1Q3EA 1FJGB 2P22C 1N36B 4O4HA 5KHKA 5LMNB 5LMUB 5LP6C 2PUSA 5C8YA 3RYFA 4TV9A 5LOVA 3JAKA 4DK0A 4LF9B 4B3TB 4WBNA 4LH6A 4YJ2B 5JH7B 4F6RB 4IHJB 4O4LB 4DV3B 4UCVA 4UFZA 1HR0B 3VQYA 3UT5B 1WPBA 4O4HB 4EFBA 5LA6A 2YI9A 3ZS8C 3M7MX 4TV9B 5LOVB 4GKKB 1WNSA 2P5OA 3JAKB 4WBNB 1Z5WA 2RJZA 4YHHB 4I50B 1JFFB 2VWKA 5CA1B 4LFAB 1KU9A 2HHHB 2YIAA 1TA8A 1YEWA 2V4DA 4UCOA 4UCUA 4GKJB 5KHJA 2ZNJA 4U3JA 2PTMA 1XNQB 5KHHA 5LA6B 1O9GA 1FFXA 3JATA 1SA0A 2YIBA 2JGUA 1H2SB 4PHZA 4EB6A 5KHIA 4HNAB 3OTOB 4O4JB 3VQVA 1NT2B 4X20B 3BA8A 5FNVA 4DRXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I7F A;  1VQ0 A;  3M7M X;  1VZY A;  1HW7 A; 
#chains in the Genus database with same CATH topology
 4RWU A;  2B1I A;  2OT5 A;  1I0H A;  3CHX A;  3RYC A;  1EN5 A;  4O4I B;  3D36 C;  4UVB A;  1NQT A;  4JI0 O;  4MVS A;  1OCR C;  1IXB A;  3ETQ A;  4B3R B;  1ENV A;  1XUQ A;  5L3C A;  1ROP A;  3CD6 V;  4JTA B;  2KSD A;  1SZT A;  2LGQ A;  3OT7 A;  1JCH A;  2DYS C;  2WAM A;  1PM9 A;  3TJT A;  4R8C A;  4P9P A;  1VQ9 V;  2IH3 C;  3CE2 A;  2UXB O;  4JI6 O;  2GUZ A;  2OTL V;  3E22 A;  5IYZ A;  1XL6 A;  4H13 B;  4PA4 A;  4TUY B;  4B7E A;  1SF9 A;  4NXN O;  1TUE B;  2BTQ B;  4JI2 O;  4R50 A;  5CA0 A;  3LNM B;  1TUB A;  5CB4 A;  1H38 A;  2Q5Z A;  4G28 B;  1DF4 A;  3OGC C;  4DR3 B;  5JJE B;  4J80 A;  1M1K W;  2EIJ C;  1W0K G;  4GZR B;  4LWS B;  5L3F A;  4K8Z A;  2OWO A;  1H8H G;  4X62 O;  1FS0 G;  2JS3 A;  2X7R B;  1MMM A;  2UUB B;  2Q7G A;  3CPW U;  1N0J A;  2ZM6 B;  2IJJ A;  5LP6 A;  3K5L A;  5LHG A;  1TAE A;  2ZIM A;  2VQF B;  4RUE A;  3JSN A;  3I56 V;  3AG2 B;  1VQ8 V;  3Q4H A;  2M7W A;  2WLL A;  2PZS A;  5KUK A;  1JOY A;  5JQG B;  1OV9 A;  3ABK C;  3F7Y C;  2YI8 A;  4B3R O;  1P84 F;  1MZF A;  3ABT A;  3RYI A;  3M8A A;  3DXR A;  1BE3 H;  1Q5O A;  3AG3 C;  3ASO C;  2NNU A;  3EXA A;  4ZOL A;  3GB7 C;  4X1Y A;  1IBL O;  2GSM B;  2HEP A;  3RYH B;  4BIU A;  1R3J C;  5F2V O;  1NJI W;  3THO A;  5JCO C;  2ZDI A;  5KA5 A;  2RDC A;  1BQZ A;  3T1H B;  5EZY A;  4ZHQ B;  2IJH A;  1SA0 B;  1THZ A;  5LXT B;  1NTM H;  2P7T C;  2RQ6 A;  1WAZ A;  4LH7 A;  2V1D A;  1RFY A;  5TIS Z;  3ZIA G;  3SR2 C;  1B04 A;  4EFE A;  3JAL B;  4KHP B;  2CUG A;  1AJN A;  1P7B A;  2CTP A;  1EN6 A;  4DV2 B;  3CWB H;  1LNQ A;  1MG1 A;  2XTA A;  1XL4 A;  2IJI A;  1XMO B;  1NZ6 A;  1HR0 O;  2GBO A;  2PYL A;  4Z2W A;  1SKV A;  1M57 B;  1D5N A;  1SQG A;  4FM2 A;  2QEX V;  2W6I G;  1XHX A;  4IL6 Z;  4YHH O;  2F4V B;  1FXK A;  4D6T H;  3ZHT A;  3LUT B;  2R70 A;  5J2U B;  4JAU A;  3OMI B;  1B3Q A;  3ZHQ A;  4P2Z A;  4LF5 B;  1XNQ O;  4XBF A;  5FLX N;  3EHB B;  1SQX H;  3AG2 C;  2Q6A A;  3UO2 A;  4OPA A;  2XAS A;  2IBZ H;  4F6R A;  5BMV B;  1FXH A;  4X66 B;  1VQN V;  1IBK B;  3K5N A;  1YTF B;  3CCM V;  1ZTE A;  2Q0O C;  3M99 B;  1H2L A;  1MAB G;  2WLN A;  1W0J G;  5KX5 A;  4LFC B;  2HR3 A;  3W7T A;  2DYR B;  3HKD B;  3T4Z A;  1VQ7 V;  2ZR3 A;  5ITZ A;  5GON B;  3OAA G;  5LYJ B;  1RM1 C;  3CYO A;  4BR6 A;  1YSC A;  2PGG A;  4DV1 B;  4I50 A;  3EVK A;  3LDE A;  3GVM A;  3OMN B;  1LR1 A;  1COW G;  3BPZ A;  1NH2 B;  3MHH C;  1WP8 A;  2AW9 A;  5IJ0 B;  1YHQ V;  4BIZ A;  2KG7 A;  3F5W C;  2OIE A;  3G4S V;  1S5J A;  3WG7 B;  4NKG B;  4JYB A;  1AJP A;  1M56 B;  1AP6 A;  4I4T A;  4D7T A;  2EIL B;  2LW7 A;  3ETD A;  3RFR A;  2Q68 A;  4AQY B;  4MW8 A;  3ABL B;  4MVZ A;  1FAF A;  3IGA C;  2Q7H A;  4B3M O;  4FFK A;  3JAS B;  2XHB A;  3D3Q A;  4TV8 A;  3L73 H;  2QKC A;  3F5T A;  4J9Z B;  2OCC B;  3CRA A;  3CJH A;  4KL1 A;  1M57 C;  2JGD A;  1N33 O;  4X65 B;  3ZN1 A;  2WLH A;  2BSK B;  2XOK G;  4YJ3 B;  4H37 A;  3D3I A;  1RSO A;  1PNL A;  3T4D A;  1MZE A;  5JJN B;  1S77 D;  4Q20 A;  3CCV V;  4DV5 O;  1R3K C;  3F7V C;  2EUL A;  3K9S A;  4BAY A;  4C7U A;  2XAH A;  3I55 V;  4U7N A;  5EIB C;  5KA6 A;  1R1B A;  4X1I B;  1M5I A;  2A9H A;  2M6Y A;  2UUC B;  1IX9 A;  3FB5 C;  4DR4 O;  4JI8 O;  4CBC A;  1VZY A;  4GX2 A;  1VQ5 V;  5EBM C;  3K5M A;  3ZBH A;  3FB6 C;  1ORQ C;  4O2B B;  2FKX A;  5A2Q N;  4QNH B;  2P22 C;  2Y0P A;  4O4H A;  1H2M A;  4DUY O;  1OCO C;  3RYF A;  2X0L A;  2A3Q A;  5IYB O;  5IYC O;  2HJD A;  4YIP A;  1VQL V;  5B3S B;  3ZRW A;  3RVZ A;  4AQY O;  1P4R A;  2ZE7 A;  3UT5 B;  4B3S O;  2ILM A;  3FAV A;  4EFB A;  1DTO A;  3ZS8 C;  3W7U A;  4TV9 B;  4GKK B;  1WNS A;  2UXN A;  3RN4 A;  1EFR G;  1Z5W A;  3ZJZ A;  3LSU A;  3SPH A;  3TCU A;  3WG7 C;  4G27 B;  4X88 A;  1M56 C;  2DW4 A;  5KAI Z;  4KXR A;  4UCO A;  2EIL C;  5KHJ A;  2JRI A;  2X6C A;  5LA6 B;  3ABL C;  3CX5 F;  3ZRS A;  1E1R G;  4PV1 B;  1K97 A;  4EB6 A;  4HNA B;  3ZX6 A;  2XAQ A;  2P67 A;  1SRY A;  4H44 B;  3VQV A;  1Y67 A;  3SPC A;  1QR9 A;  3HB3 B;  2OCC C;  1UPG A;  4R6Z A;  4DRX A;  4U3J B;  2IW5 A;  5IJ9 A;  2UUC O;  3JAT B;  2EJ7 A;  1I94 O;  2WA4 A;  4JI1 B;  4O2A A;  1HW7 A;  2F1M A;  4BW9 A;  1SET A;  2QSA A;  2QA4 V;  1HNW B;  4DYL A;  4W4L A;  4JTD B;  4QGP A;  3N2G A;  1M93 A;  4NXM B;  2Y48 A;  4JYY A;  1SER A;  2CH7 B;  1Q6I A;  5L3D A;  2IU0 A;  4LF4 B;  1IBM B;  3RYC B;  3UQ8 A;  3OUS A;  4CS4 A;  3R66 A;  4U3F H;  1NU1 H;  2CTR A;  3P30 A;  1VF6 A;  1M9N A;  3ZED A;  3ZMZ A;  2UXX A;  2UUA O;  1K4C C;  1AI6 A;  2RMK B;  2W0X A;  3IJ4 A;  4X89 A;  4DR1 B;  5BR8 B;  3HKC A;  1S5H C;  1N34 B;  1TVK B;  1Q6H A;  1Y4M A;  1KKD A;  4UCR A;  2ZNI A;  4MTX A;  3P32 A;  5EYP A;  1KMI Z;  4CC6 A;  2FTK A;  1CP9 A;  4DV0 O;  5B3S C;  1B06 A;  3JAM N;  3FX7 A;  5IWA O;  1K3E A;  4JYA B;  5LHH A;  2VQE B;  5JJJ B;  1OCC B;  3HKB A;  2E74 B;  3CCS V;  1NVP B;  1TUB B;  3CCJ V;  3JAW A;  4UCS A;  4LF6 B;  3AEI A;  5EBW C;  4CH3 A;  2YDE A;  3HKE A;  3E83 A;  1FPO A;  1PL4 A;  3CSX A;  4AHC A;  3O65 A;  5C8Y B;  3SGI A;  2QR4 A;  2QM8 A;  1JVM A;  3A0B Z;  1XEQ A;  3K3W A;  4LF7 O;  2CGO A;  4K0K O;  2Y4T A;  1J95 A;  2YC0 A;  4E2L A;  5L3E A;  4FLT A;  4PDM A;  1H2G A;  2Z3Y A;  4X64 B;  2FB5 A;  3DC5 A;  4LF4 O;  1BHB A;  1HDJ A;  4PDR A;  2H8P C;  4G2K A;  4JV5 B;  3AG4 B;  4JI3 B;  1OZ0 A;  5AG2 A;  5KLV H;  4UVA A;  4J7K A;  3CXH F;  1NR7 A;  3GWK C;  3MAQ A;  3B09 A;  5B1B B;  1S0V A;  5DM6 V;  3VBB A;  1FFX B;  3H1K H;  1Q43 A;  3OMA B;  2CTQ A;  3JAR A;  4LFB B;  1XMQ B;  4OX9 B;  1YJ9 V;  1XNR B;  3WB2 A;  3CCE V;  3SPJ A;  4X1Y B;  2FML A;  5B1O A;  2B9Z A;  2H3O A;  3JD2 A;  3A0H Z;  2AHZ A;  3SPI A;  2DWE C;  3WB1 A;  2VQE O;  2QWO B;  5H2F Z;  5LMU O;  4DR2 B;  1RPR A;  5LGT A;  1N32 B;  4LF9 O;  2LGW A;  4IYH A;  5A9G A;  4DR6 B;  2ZR2 A;  2HJF C;  1Y6X A;  2UXC B;  4CS2 A;  3U10 A;  1W59 A;  2FL4 A;  1Q82 W;  1AR5 A;  3IFX A;  4PA6 A;  2RN9 A;  3L9D A;  3P3P A;  1GM9 A;  4DW0 A;  2ZQM A;  3IAY A;  1OCC C;  2O57 A;  2F93 B;  1CEZ A;  3LDD A;  1DGS A;  4UUJ C;  1GM8 A;  1S76 D;  2HVJ C;  1VMG A;  4IIJ B;  1G6U A;  3H1L H;  4K8X A;  3W7X A;  1PD3 A;  5HFM A;  4I55 B;  1KUQ A;  2CK3 G;  2OCH A;  1K92 A;  4B08 A;  3A8T A;  4ZI7 A;  3T1C A;  2PI4 A;  2JEX A;  3UO3 A;  3K79 A;  3B40 A;  4J9Y B;  3ZN0 A;  3ZHS A;  2LP7 A;  4MVO A;  1UJW B;  5KMG B;  4OX9 O;  1XNR O;  4FFB B;  1CPY A;  3AG4 C;  1PV0 A;  3K0D A;  1JFF A;  1SQB H;  5KX5 B;  2WLI A;  5IDJ A;  5ITZ B;  1AB3 A;  5GTI Z;  3K57 A;  1QNM A;  4HBN A;  4U7O A;  1JX9 A;  1EZJ A;  4UB6 Z;  3ZRV A;  4DR6 O;  1BCC H;  3DGE A;  4N23 A;  3BFR A;  2YID A;  4JTC B;  1KQS U;  4TWK A;  1WB7 A;  2MW2 B;  3WU2 Z;  4YY3 B;  1AVM A;  3E8G A;  1HNX B;  1FKA O;  3NXS A;  4O4I A;  3QO7 A;  4ZIB A;  5JCO A;  1NKD A;  2MK3 A;  4QIW F;  1IXM A;  4GYC B;  3U11 A;  1X4T A;  4JPR A;  4L87 A;  2JK5 C;  4DR3 O;  4LF8 B;  2KG7 B;  5JVD A;  4XDJ A;  1LUW A;  1KD1 W;  1YIJ V;  2VS0 A;  1HWY A;  4DR5 B;  2GDS A;  2L35 A;  1YDX A;  1F4M A;  2UUB O;  2Q9L A;  2QM7 A;  1L8D A;  2QWR B;  3BY6 A;  4FLV A;  4NVP A;  2ZM6 O;  3E35 A;  2W0F C;  1B6Q A;  2KKW A;  4DR7 B;  4TUY A;  2D2C B;  4X8A A;  2VQF O;  1LUV A;  3T2M A;  3A0R A;  3SJA C;  2BTO A;  3FB8 C;  2IU3 A;  1VQ6 V;  1GRJ A;  2BTQ A;  3C3S A;  3G6E V;  1K8A W;  3JSL A;  1US6 A;  2B5U A;  1BQ0 A;  2Z0A A;  3H1J H;  2WA3 A;  1SC5 B;  5FL7 G;  2LO1 A;  4I0X B;  1GM7 A;  4DV7 B;  3E2E A;  4HYO A;  3E89 A;  4LWS A;  1Q81 W;  1RSO B;  1FXV A;  3VQX A;  4NTY A;  2R9A A;  2WWW A;  1VQK V;  4RQE A;  1J5E B;  2X6B A;  2HLD G;  5EC1 C;  5JWP A;  2G38 A;  1WP7 A;  4O4L A;  5H6Q A;  4UCT A;  4CH5 A;  2EZP A;  3SPG A;  4X1K B;  1Q3E A;  1FJG B;  2EIN B;  1XDC A;  3VOU A;  2AZ2 A;  5KHK A;  2YIC A;  3T1H O;  1Y74 A;  2E76 B;  3ABM B;  1WB8 A;  2YEV A;  4GX0 A;  1KYO F;  5LOV A;  3JAK A;  4B3T B;  4WBN A;  4YJ2 B;  4DV3 B;  3K04 A;  4K3A A;  2XAJ A;  2ITD C;  2GTA A;  3OGI B;  4O4H B;  4KHP O;  4WFB V;  4ABM A;  4IGG A;  2P5O A;  4DV2 O;  2QDO A;  3ZRW B;  3ZMU A;  4ICG A;  4WFG A;  4LFA B;  5CA1 B;  3H01 A;  2HHH B;  2Q8V A;  3TET A;  1XMO O;  1YVW A;  2ODM A;  3ASN B;  4ZKI A;  1Y76 B;  2PTM A;  3FAV B;  4IT5 A;  5CA3 A;  4NTX A;  5IT9 N;  2N04 A;  1SA0 A;  5CMU A;  3CXC U;  2JGU A;  1H2S B;  4N21 A;  3OEH G;  4PHZ A;  4F4L A;  4WFA V;  3OW2 U;  1WA8 B;  4O4J B;  2Q69 A;  2PI5 A;  2F4V O;  1VAR A;  4PA7 A;  3BCC H;  3S3X A;  4X20 B;  3BA8 A;  5FNV A;  2EX3 A;  3CEI A;  3CRC A;  1MA1 A;  1ZL8 B;  3K08 A;  3G71 V;  4LNU A;  4LF5 O;  5E1A C;  4EB6 B;  1J5E O;  1SZX A;  4JI7 B;  2Q67 A;  1L0L H;  2B1G A;  3QNE A;  4JZ2 A;  4X66 O;  1IBK O;  1XRE A;  3CMA V;  4FZ0 A;  4LFC O;  3HR0 A;  1I5X A;  4DV4 B;  4O2A B;  1Z2G A;  4B3T O;  1U97 A;  4LBE C;  1GMG A;  1GTO A;  2F95 B;  3N2G B;  4DV1 O;  3ZMV A;  3J7A U;  4XDK A;  1EN4 A;  3JCZ A;  2VRZ A;  3ZMS A;  4PDL A;  4ASU G;  5CBH A;  3K5O A;  1S5L Z;  1BMF G;  5J2U A;  1KP2 A;  2Q0A A;  2YXL A;  1DK1 A;  2EIN C;  2EIK B;  2DYR C;  4AIL C;  2KQX A;  3ABM C;  4DUZ B;  4LFA O;  4FM1 A;  2HHH O;  5GTH Z;  2RCV A;  4TSF G;  2AZ0 A;  5L3G A;  3ML0 A;  1MSW D;  4P30 A;  4RQF A;  4FIP C;  2JIZ G;  1JMK C;  2A06 H;  1EBO A;  4XDL A;  1NI8 A;  5HFL A;  3N2K B;  5EYP B;  3ICX A;  2YXY A;  4JAS A;  1F23 A;  1L1F A;  4CH6 A;  4QPJ A;  3KCY A;  3CRQ A;  4JI5 B;  1IZ3 A;  3SJC C;  2Q4P A;  4JI7 O;  5IJ0 A;  2HKO A;  1BHA A;  3PN1 A;  3SYP A;  4X65 O;  2R9R B;  2AXT Z;  1NTZ H;  2GHY A;  3NR7 A;  5KUM A;  4FM0 A;  5FPR A;  1VQP V;  3SDL A;  1IDS A;  2Y69 B;  1Q8I A;  2YS8 A;  1GN4 A;  4TQD A;  3FFQ A;  2EBO A;  1AP5 A;  5DEC A;  1XOU A;  2F43 G;  3AG1 B;  1QVG U;  4PJ0 Z;  3OUF A;  2WLM A;  1HNZ B;  1GN2 A;  3CC4 V;  2P4V A;  3T1Y B;  1SQV H;  5FPO A;  1Y66 A;  5C93 A;  2BSK A;  4YJ3 A;  1KBH A;  3BEH A;  1T5E A;  4H33 A;  4PDV A;  5DED A;  3QF7 A;  4UVC A;  2ZKO A;  2LQT A;  1Q86 W;  1M90 W;  4MVM A;  3APO A;  2P4K A;  3JAR B;  1V54 B;  5IE9 A;  5EK0 A;  2EJR A;  2LJ2 A;  4I9Q A;  1SES A;  2EIK C;  3CCL V;  3CB2 A;  3RVY A;  1XIL A;  1VF6 C;  4D7S A;  1BT8 A;  4WCE V;  4JF3 A;  4E4E A;  4JAV A;  5EC2 C;  4FLU A;  4GKK O;  1X59 A;  2EIM B;  1IUR A;  2GUZ B;  1AR4 A;  3MDS A;  3E22 B;  3J80 N;  2ZIN A;  1Q7Y W;  5IYZ B;  4O2B A;  4FLZ A;  1R6N A;  4IYI A;  1PPJ H;  3WB0 A;  1K7D A;  3BVO A;  4J10 A;  2QM4 A;  4JI0 B;  4LP8 A;  5CA0 B;  1YJW V;  4FVM A;  1W2B U;  3VQW A;  5CB4 B;  3B77 A;  2GTS A;  3X2Q B;  4KP4 A;  1XHZ A;  3IC7 A;  3KCX A;  3OM3 B;  1S3J A;  3CC7 V;  2K9P A;  1E79 G;  1MOF A;  3UT5 A;  1PP9 H;  3UKM A;  3B8N A;  3AK2 A;  4MSW C;  4HAM A;  4GCZ A;  4YXW G;  3L75 H;  4NYK A;  2HVK C;  1P49 A;  2UXB B;  4JI6 B;  1VQM V;  4JI1 O;  3AG7 A;  1HNZ O;  3BA9 A;  4GX5 A;  1HNW O;  2P90 A;  1SS3 A;  5CBG A;  1N4C A;  5LP6 B;  2BE3 A;  3CME V;  2Y69 C;  3A2F A;  5LGU A;  4NXM O;  4ZI7 B;  4MT8 A;  4DV6 B;  4NXN B;  3Q4H B;  3L74 H;  3W7W A;  1IBM O;  4JI2 B;  5IY5 B;  2EZO A;  3CRM A;  1KEC A;  2WLL B;  1YIT V;  2ADP A;  4LR3 A;  3C90 A;  1PKX A;  4HNA A;  1URF A;  1GKF A;  1BSM A;  4BIO A;  3AG1 C;  4WFF A;  5BXZ A;  2LFR A;  1K4D C;  1VF5 B;  3RYI B;  5BZB A;  1K33 A;  1M4U A;  2ZE8 A;  4FLW A;  4FLY A;  3CS5 A;  1K5S A;  4X62 B;  1BGY H;  3DXR B;  4DR1 O;  1F4N A;  2DE0 X;  4PD4 F;  5BR8 O;  1H2K A;  5H6R A;  2NR5 A;  4ZOL B;  1K73 W;  3DTU B;  1I7F A;  1PL0 A;  4A5U B;  2IH1 C;  3RWR D;  3KKY A;  1N34 O;  2QWN B;  2VWJ A;  4F6E A;  2PY5 A;  1V54 C;  3D36 A;  4MVR A;  2CH7 A;  3E86 A;  4EEQ A;  5EZY B;  4UV9 A;  5J2T A;  4JYA O;  1K34 A;  2BOB C;  3B4S A;  3CCR V;  3TXQ A;  3CP1 A;  3JYC A;  4LF6 O;  4MW3 A;  2R72 A;  2PF4 E;  5H5N A;  5JVD B;  2Q7E A;  2EIM C;  4PI2 A;  2UXD B;  1JA8 A;  4YIO A;  1NTK H;  1KP3 A;  3KG2 A;  4LCU C;  1TVK A;  1IBL B;  2ZXW B;  4J41 A;  2QJ1 A;  3G80 A;  1JJO A;  5B1N A;  2ITC C;  1RP3 B;  5CN0 A;  3X2Q C;  4X64 O;  4DV6 O;  1VQO V;  4JV5 O;  4NB5 A;  4JI3 O;  4FPP A;  2CDY A;  3LSQ A;  4NTW A;  5JH7 A;  1R73 A;  1I08 A;  4FJC C;  4IHJ A;  1GO3 F;  2BOC C;  2YIB D;  4BWA A;  1FXK B;  3J81 N;  1N36 B;  1GAX A;  5LMN B;  1VEW A;  5H9C A;  5LP6 C;  2PUS A;  5C8Y A;  3ZHV A;  4J7J A;  4DK0 A;  3ETG A;  4LFB O;  1XMQ O;  4F6R B;  2JEU A;  4O4L B;  3RBZ A;  3DC6 A;  3I5D A;  5IY5 C;  4JZG A;  4UCV A;  3SYQ A;  4CZZ A;  4AI8 A;  3H9V A;  4MTG A;  4UFZ A;  1HR0 B;  1IVS A;  4DXW A;  1WPB A;  1ZLZ A;  2ZE6 A;  1Y74 B;  2AHY A;  2QE7 G;  5B1B C;  2YEV B;  2YI9 A;  3K0G A;  3M7M X;  5LOV B;  4DR2 O;  3JAK B;  4WBN B;  2CE4 A;  4J11 A;  1N32 O;  2CTW A;  2IJK A;  4YHH B;  3ZHU A;  3O9O A;  4I50 B;  2K1E A;  3FB7 C;  5LBQ A;  4I7Z B;  1YEW A;  4GKJ B;  1RM1 B;  2UXC O;  2ZD9 A;  1XNQ B;  2UXD O;  5KHH A;  1O9G A;  1FFX A;  1AIL A;  2ZDI C;  1YZB A;  2YIB A;  5KHI A;  4OGQ B;  3OTO B;  1OCZ B;  4WF9 V;  4UB8 Z;  5LL6 Y;  1K9M W;  1NT2 B;  1JJ2 U;  3K9A A;  1PNM A;  2AGA A;  5BY1 A;  1SQQ H;  1SQP H;  1F7Y A;  5B1A B;  2QKA A;  3JCU Z;  4X9Q A;  4I4T B;  4WFE A;  3JD0 A;  2V7Q G;  2OIG A;  2QTO A;  4PEL A;  5FNV B;  2ZCE A;  2IM9 A;  3P3N A;  4Z1M G;  2FYU H;  2ZXW C;  1XI1 A;  1V55 B;  2Y4U A;  1N36 O;  4J7Z A;  4TV8 B;  3QG5 A;  5LMN O;  4LNU B;  1QR8 A;  2DJV A;  3CJH B;  2JGD B;  4QPK A;  1NS1 A;  4BW5 A;  2ATK C;  3OFN G;  1FYJ A;  1O9H A;  1AR1 B;  3QTC A;  4OXS A;  2OTJ V;  1FXK C;  4IIJ A;  2QWP B;  3SYO A;  1Q6U A;  3SYA A;  1YF2 A;  4L8J A;  3K59 A;  4I55 A;  4Q6G A;  3ZHR A;  5IYD O;  2XAG A;  5KHG A;  3OE7 G;  1I5Y A;  2HFE C;  2L6L A;  3JD1 A;  4B3M B;  3K06 A;  4YY3 O;  4GKJ O;  1SQF A;  1HNX O;  1WJZ A;  5D5Q A;  2CAZ C;  3L70 H;  3D8C A;  5JQG A;  5KMG A;  4FFB A;  3OTO O;  3LNN A;  1AI4 A;  4MTF A;  1N33 B;  3DSQ A;  3ABU A;  5CBF A;  3EFF K;  4LF8 O;  3B2E E;  4W4K A;  3UM7 A;  3E8H A;  4RO2 A;  4TOI A;  1P7G A;  3ETE A;  3RYF B;  4CS3 A;  4DV5 B;  4DR5 O;  3GWO A;  4TQF A;  1JPX A;  2ARH A;  4DK1 A;  2WLJ A;  1VQ4 V;  3RYH A;  3KZI Z;  1OCO B;  2F23 A;  2P6J A;  1OCZ C;  4DR7 O;  1QCE A;  3U0Z A;  4DR4 B;  4MTO A;  1PNK A;  3H1H H;  4HZ3 A;  4JI8 B;  4GUN A;  4ZHQ A;  1DF5 A;  2F66 C;  5LXT A;  1VQ0 A;  3TK1 A;  2A79 B;  2E75 B;  5EIB D;  1Z5V A;  5B1A C;  2A0L A;  1AJQ A;  1G1X B;  3LDC A;  4DV7 O;  3JAL A;  2DOS A;  2ZIO A;  2DQ0 A;  4DUY B;  3MD0 A;  1YTF D;  3ZCC A;  2D3O W;  1U96 A;  4UV8 A;  2H94 A;  3ZMT A;  1FD9 A;  1V55 C;  3AK1 A;  2WPD G;  4GT1 A;  2PYJ A;  4B3S B;  1QQC A;  4DRX B;  1FJG O;  2NN4 A;  3H1I H;  3OEE G;  1BS3 A;  2N74 A;  4Z1V A;  5IJ9 B;  4FZ1 A;  2P06 A;  4K35 A;  1ZSP A;  5KAF Z;  3IC9 A;  1E1Q G;  3CRR A;  2KB1 A;  4TT3 G;  3QO5 A;  2YXH A;  2JS5 A;  4DV3 O;  2N05 A;  2JVD A;  4I0X A;  1NH2 D;  4JYC A;  5E79 Z;  4ZBM A;  2OYQ A;  4KUM A;  2XAF A;  1YCI A;  5GW7 A;  3OTF A;  4DW1 A;  3S3W A;  1R3L C;  2WSS G;  3FKS G;  1AI7 A;  1H8E G;  3JD4 A;  3OD4 A;  3G67 A;  1XQ8 A;  1ZAU A;  1VF7 A;  2QKS A;  4PA3 A;  1R3I C;  3STZ C;  5BMV A;  1ARO P;  3B8M A;  5K1X A;  3BRC A;  4MVQ A;  1AI5 A;  4X1K A;  2E5L B;  4JGS A;  1CXZ B;  3HKD A;  3K58 A;  1ZX3 A;  1I94 B;  4OPH A;  3HPL C;  3HKC B;  1HP8 A;  3BAB A;  3K03 A;  1EM1 A;  1QLE B;  5GON A;  5LYJ A;  2C2A A;  4CH4 A;  4YJ2 A;  5J9P C;  1GN3 A;  2NLJ C;  4FK5 C;  1VIB A;  1KB9 F;  4KFM A;  4RAI A;  1NR1 A;  2XND G;  5LGN A;  4EKW A;  4JI4 B;  2QWQ B;  5B66 Z;  2E3C A;  1D2D A;  3FYI B;  1JQ0 A;  3HKB B;  1TGO A;  2RNB A;  4MVU A;  1D5A A;  3BHP A;  3CCQ V;  3RW0 A;  3ASN C;  3JAW B;  4DO2 A;  1BL8 A;  1MSD A;  5K1P A;  2UUA B;  5CA1 A;  1WLE A;  3FYE B;  4JAA A;  3HKE B;  5EBL C;  3MHS C;  1QHT A;  2DWD C;  2LFS A;  2GV9 A;  4WFH A;  1Y76 A;  1H2N A;  5D5P A;  3SJQ C;  1QVF U;  1WPX A;  1OJH A;  3PJS K;  4DV4 O;  3CCU V;  4P9O A;  5DN6 G;  3G6B A;  1WA8 A;  4O4J A;  3N27 A;  2DQ3 A;  1K5Q A;  1A32 A;  2Q73 A;  5B5E Z;  4LC1 A;  4DV0 B;  1DLB A;  1RPO A;  1MNG A;  4X20 A;  1S72 V;  5IWA B;  1ZL8 A;  2YUA A;  3JAS A;  3R65 A;  4H0L B;  4MS2 A;  3FD9 A;  3RGB A;  1ZUQ A;  2UU9 B;  5L3B A;  1Q90 D;  4CC5 A;  1GK9 A;  3QO8 A;  2LW1 A;  4J42 A;  2X6A A;  4DUZ O;  3TXS A;  2CGN A;  1WN7 A;  3C3T A;  2XUM A;  3SJB C;  3TGU H;  2ETN A;  2E5L O;  3L72 H;  4PA9 A;  4LF7 B;  2Z5U A;  4K0K B;  2JDI G;  1YI2 V;  4GLX A;  3RT3 C;  1VP7 A;  3ZRX A;  4PI0 A;  1KKC A;  4FLX A;  1QBZ A;  3OR6 C;  4X1I A;  2ZT9 B;  1OCR B;  2JJ1 G;  5J2T B;  4JI4 O;  3BAA A;  2JJ2 G;  2WLK A;  4I9W A;  4JI5 O;  1F51 A;  1L0N H;  1EZV H;  1R6K A;  1QU7 A;  2DYS B;  3STL C;  1KC8 W;  1JR9 A;  4B7K A;  1QLE C;  3SYC A;  1BZK A;  2DN9 A;  1V9P A;  3W7S A;  1UFI A;  1G4Y B;  3L71 H;  1NBM G;  1FFT B;  4FMT A;  1G8M A;  2ADQ B;  1QLN A;  4QE7 A;  1GH6 A;  3N2K A;  2ZE5 A;  2HP8 A;  4GX1 A;  1R6T A;  5LMU B;  3E8B A;  4NR1 A;  4TV9 A;  3APQ A;  4R7C A;  4LF9 B;  2UU9 O;  4LH6 A;  2EIJ B;  5JH7 B;  4IHJ B;  3WFV A;  3T1Y O;  5LHI A;  2BCC H;  3CC2 V;  3VQY A;  3UCS C;  5LA6 A;  1YXB A;  1GN6 A;  2Y0I A;  2RJZ A;  1JFF B;  2VWK A;  2QTS A;  1KU9 A;  2YIA A;  1N8R W;  2W6J G;  1TA8 A;  4QE9 A;  2R9I A;  3QVN A;  4QJF B;  2V4D A;  4UXN A;  4UCU A;  1N0N A;  2WLI B;  2ZNJ A;  4U3J A;  2DMX A;  3ABK B;  2YSU B;  4I5S A;  3JD3 A;  3JAT A;  3OR7 C;  2QGN A;  3LSS A;  3E8F A;  1ZWI C;  1OHH G;  1YJN V;  2HG5 C;  2XT9 A;  1NVP D;  3AK3 A;  1XBL A;  4RUF A;  3AG3 B;  3ASO B;  2A7W A; 
#chains in the Genus database with same CATH homology
 2EX3 A;  4U3J B;  5IJ9 A;  3CHX A;  3RYC A;  3JAT B;  4O4I B;  4LNU A;  4EB6 B;  4JI1 B;  4O2A A;  1HW7 A;  2F1M A;  4BW9 A;  4I4T B;  1HNW B;  4JI7 B;  3ETQ A;  4B3R B;  3N2G A;  1M93 A;  4NXM B;  5FNV B;  2ZCE A;  2IM9 A;  4LF4 B;  1XI1 A;  1IBM B;  3RYC B;  4TV8 B;  3QG5 A;  4LNU B;  3UQ8 A;  4DV4 B;  4O2A B;  4CS4 A;  2F95 B;  3N2G B;  3ZED A;  3E22 A;  5IYZ A;  1O9H A;  4TUY B;  3QTC A;  3K5O A;  5J2U A;  4DR1 B;  2Q0A A;  4IIJ A;  5BR8 B;  2YXL A;  2BTQ B;  3HKC A;  4L8J A;  5CA0 A;  3K59 A;  4I55 A;  1TUB A;  5CB4 A;  1N34 B;  1TVK B;  4Q6G A;  4AIL C;  4DUZ B;  4UCR A;  5KHG A;  2ZNI A;  4DR3 B;  4FM1 A;  5JJE B;  5EYP A;  1KMI Z;  4CC6 A;  4B3M B;  4K8Z A;  2OWO A;  4JYA B;  2VQE B;  5JJJ B;  1SQF A;  3HKB A;  5D5Q A;  2CAZ C;  1JMK C;  1TUB B;  3JAW A;  2UUB B;  2Q7G A;  5JQG A;  5KMG A;  4FFB A;  3LNN A;  2ZM6 B;  4UCS A;  4LF6 B;  1N33 B;  3DSQ A;  3N2K B;  5LP6 A;  4CH3 A;  5EYP B;  3K5L A;  1TAE A;  3ICX A;  3HKE A;  2ZIM A;  2VQF B;  3B2E E;  3JSN A;  3CSX A;  4AHC A;  4TOI A;  4CH6 A;  5C8Y B;  3SGI A;  3RYF B;  4CS3 A;  4JI5 B;  4DV5 B;  2PZS A;  3SJC C;  5JQG B;  4TQF A;  2YI8 A;  4DK1 A;  5IJ0 A;  4FLT A;  3RYH A;  3PN1 A;  3RYI A;  4X64 B;  3U0Z A;  4DR4 B;  4JI8 B;  4JV5 B;  4ZHQ A;  4FM0 A;  5FPR A;  4JI3 B;  2F66 C;  1Q5O A;  5LXT A;  1VQ0 A;  4ZOL A;  1Q8I A;  4X1Y A;  2HEP A;  3RYH B;  5EIB D;  3MAQ A;  1Z5V A;  4TQD A;  3THO A;  5JCO C;  3FFQ A;  3JAL A;  3T1H B;  5EZY A;  2ZIO A;  4ZHQ B;  4DUY B;  1FFX B;  1SA0 B;  1Q43 A;  3JAR A;  5LXT B;  4LFB B;  1XMQ B;  1HNZ B;  4OX9 B;  1XNR B;  2RQ6 A;  3WB2 A;  4LH7 A;  3T1Y B;  4X1Y B;  2PYJ A;  5FPO A;  3SR2 C;  1B04 A;  4EFE A;  4B3S B;  1QQC A;  3JAL B;  4DRX B;  4KHP B;  4YJ3 A;  1T5E A;  3QF7 A;  3WB1 A;  5IJ9 B;  4DR2 B;  4DV2 B;  3JAR B;  1N32 B;  4DR6 B;  4I9Q A;  2JS5 A;  2JVD A;  1XMO B;  3CB2 A;  2OYQ A;  2UXC B;  4CS2 A;  4D7S A;  2PYL A;  3U10 A;  1SKV A;  3OTF A;  4FLU A;  1SQG A;  4FM2 A;  1XQ8 A;  1ZAU A;  1VF7 A;  3IAY A;  1XHX A;  5BMV A;  2F4V B;  3E22 B;  2F93 B;  2ZIN A;  5IYZ B;  5K1X A;  4O2B A;  4FLZ A;  3BRC A;  4X1K A;  1DGS A;  2E5L B;  2R70 A;  5J2U B;  3WB0 A;  3HKD A;  3K58 A;  4LF5 B;  1I94 B;  4IIJ B;  1G6U A;  2QM4 A;  3HKC B;  4K8X A;  4JI0 B;  3BAB A;  5CA0 B;  5GON A;  4I55 B;  4FVM A;  5LYJ A;  3VQW A;  5CB4 B;  4CH4 A;  4YJ2 A;  4F6R A;  5BMV B;  1XHZ A;  4X66 B;  4B08 A;  3K5N A;  1IBK B;  3UT5 A;  4ZI7 A;  5KX5 A;  4LFC B;  4JI4 B;  3HKD B;  2E3C A;  5ITZ A;  3HKB B;  1TGO A;  1D5A A;  3BHP A;  1P49 A;  5GON B;  2UXB B;  4JI6 B;  5LYJ B;  3JAW B;  5KMG B;  4FFB B;  3BA9 A;  2PGG A;  4DV1 B;  4I50 A;  1JFF A;  5K1P A;  2UUA B;  5CA1 A;  5LP6 B;  3A2F A;  3HKE B;  1QHT A;  4ZI7 B;  5KX5 B;  2GV9 A;  4DV6 B;  4NXN B;  5D5P A;  5ITZ B;  3K57 A;  4JI2 B;  3BPZ A;  4LR3 A;  4HBN A;  4HNA A;  4O4J A;  5IJ0 B;  4DV0 B;  3RYI B;  4X20 A;  1M4U A;  4FLW A;  4YY3 B;  5IWA B;  4FLY A;  4X62 B;  1HNX B;  1S5J A;  3JAS A;  4O4I A;  3RGB A;  4ZIB A;  2UU9 B;  4ZOL B;  5JCO A;  4CC5 A;  1I7F A;  4I4T A;  4D7T A;  3RWR D;  4GYC B;  2VWJ A;  3RFR A;  3U11 A;  4AQY B;  1X4T A;  2PY5 A;  4LF8 B;  2Q7H A;  5JVD A;  1WN7 A;  4EEQ A;  3SJB C;  5EZY B;  5J2T A;  3JAS B;  2XHB A;  4TV8 A;  4DR5 B;  4LF7 B;  4K0K B;  4GLX A;  4KL1 A;  1L8D A;  4FLV A;  4NVP A;  4X65 B;  2R72 A;  4PI0 A;  4FLX A;  2KKW A;  4DR7 B;  4TUY A;  2Q7E A;  4X1I A;  5JVD B;  4PI2 A;  4YJ3 B;  2UXD B;  5J2T B;  1RSO A;  3SJA C;  2BTO A;  3BAA A;  5JJN B;  2BTQ A;  3JSL A;  1TVK A;  1IBL B;  2QJ1 A;  1JJO A;  5EIB C;  4DV7 B;  4X1I B;  1M5I A;  2UUC B;  3VQX A;  1V9P A;  2R9A A;  1VZY A;  3K5M A;  1J5E B;  5JH7 A;  4IHJ A;  4O4L A;  2YIB D;  4UCT A;  4BWA A;  4CH5 A;  4O2B B;  3N2K A;  4X1K B;  1Q3E A;  1FJG B;  2P22 C;  1N36 B;  4O4H A;  5KHK A;  5LMN B;  5LMU B;  5LP6 C;  2PUS A;  5C8Y A;  3RYF A;  4TV9 A;  5LOV A;  3JAK A;  4DK0 A;  4LF9 B;  4B3T B;  4WBN A;  4LH6 A;  4YJ2 B;  5JH7 B;  4F6R B;  4IHJ B;  4O4L B;  4DV3 B;  4UCV A;  4UFZ A;  1HR0 B;  3VQY A;  3UT5 B;  1WPB A;  4O4H B;  4EFB A;  5LA6 A;  2YI9 A;  3ZS8 C;  3M7M X;  4TV9 B;  5LOV B;  4GKK B;  1WNS A;  2P5O A;  3JAK B;  4WBN B;  1Z5W A;  2RJZ A;  4YHH B;  4I50 B;  1JFF B;  2VWK A;  5CA1 B;  4LFA B;  1KU9 A;  2HHH B;  2YIA A;  1TA8 A;  1YEW A;  2V4D A;  4UCO A;  4UCU A;  4GKJ B;  5KHJ A;  2ZNJ A;  4U3J A;  2PTM A;  1XNQ B;  5KHH A;  5LA6 B;  1O9G A;  1FFX A;  3JAT A;  1SA0 A;  2YIB A;  2JGU A;  1H2S B;  4PHZ A;  4EB6 A;  5KHI A;  4HNA B;  3OTO B;  4O4J B;  3VQV A;  1NT2 B;  4X20 B;  3BA8 A;  5FNV A;  4DRX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...