The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
21
|
sequence length |
98
|
structure length |
98
|
Chain Sequence |
GSSGSSGKAFLEDMKKYAETFLEPWFKAPNKGTFQIVYKSRNNSHVNREEVIRELAGIVCTLNSENKVDLTNPQYTVVVEIIKAVCCLSVVKSGPSSG
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Solution structure of the THUMP domain of THUMP domain-containing protein 1
rcsb |
molecule tags |
Rna binding protein
|
source organism |
Homo sapiens
|
molecule keywords |
THUMP domain-containing protein 1
|
total genus |
21
|
structure length |
98
|
sequence length |
98
|
ec nomenclature | |
pdb deposition date | 2006-03-30 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | THUMP fold | THUMP superfamily |
#chains in the Genus database with same CATH superfamily 2DIR A; 3G8Q A; 1VBK A; #chains in the Genus database with same CATH topology 4B17 A; 4AUK A; 4ATN A; 2DIR A; 1VBK A; 3G8Q A; #chains in the Genus database with same CATH homology 2DIR A; 3G8Q A; 1VBK A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...