2DIRA

Solution structure of the thump domain of thump domain-containing protein 1
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
98
structure length
98
Chain Sequence
GSSGSSGKAFLEDMKKYAETFLEPWFKAPNKGTFQIVYKSRNNSHVNREEVIRELAGIVCTLNSENKVDLTNPQYTVVVEIIKAVCCLSVVKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the THUMP domain of THUMP domain-containing protein 1
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords THUMP domain-containing protein 1
total genus 21
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2006-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.2300.10 Alpha Beta 2-Layer Sandwich THUMP fold THUMP superfamily 2dirA01
2DIRA 1VBKA 3G8QA
chains in the Genus database with same CATH superfamily
1VBKA 3G8QA 4B17A 4ATNA 4AUKA 2DIRA
chains in the Genus database with same CATH topology
2DIRA 1VBKA 3G8QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DIR A;  1VBK A;  3G8Q A; 
#chains in the Genus database with same CATH topology
 1VBK A;  3G8Q A;  4B17 A;  4ATN A;  4AUK A;  2DIR A; 
#chains in the Genus database with same CATH homology
 2DIR A;  1VBK A;  3G8Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...