4ATNA

Crystal structure of c2498 2'-o-ribose methyltransferase rlmm from escherichia coli
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
357
structure length
356
Chain Sequence
MNKVVLLCRPGFEKECAAEITDKAGQREIFGFARVKENAGYVIYECYQPDDGDKLIRELPFSSLIFARQWFVVGELLQHLPPEDRITPIVGMLQGVVEKGGELRVEVADTNESKELLKFCRKFTVPLRAALRDAGVLANYETPKRPVVHVFFIAPGCYTGYSYSNNNSPFYMGIPRLKFPADAPSRSTLKLEEAFHVFIPADEWDERLANGMWAVDLGACPGGWTYQLVKRNMWVYSVDNGPMAQSLMDTGQVTWLREDGFKFRPTRSNISWMVCDMVEKPAKVAALMAQWLVNGWCRETIFNLKLPMKKRYEEVSHNLAYIQAQLDEHGINAQIQARQLYHDREEVTVHVRRIWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Rlmm, the 2'O-Ribose Methyltransferase for C2498 of Escherichia Coli 23S Rrna.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords RIBOSOMAL RNA LARGE SUBUNIT METHYLTRANSFERASE M
total genus 117
structure length 356
sequence length 357
ec nomenclature ec 2.1.1.186: 23S rRNA (cytidine(2498)-2'-O)-methyltransferase.
pdb deposition date 2012-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01728 FtsJ FtsJ-like methyltransferase
A PF18125 RlmM_FDX RlmM ferredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2810 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4atnA01
3.30.2300.20 Alpha Beta 2-Layer Sandwich THUMP fold THUMP fold 4atnA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4atnA03
3S68A 3EPPA 2H1RA 1NBIA 2B3TA 3DXXA 1FJXA 2IFTA 5E1OA 1M6EX 2HMYB 3GRUA 4RVFA 2CMGA 1QAQA 1R8XA 3DTNA 4YMHA 3PTAA 3OU7A 4ATNA 1N2XA 1X1AA 4BLVA 4F85A 2P3OA 2GH1A 4PYNA 5DM1A 1L3IA 5EEHA 2HR1A 2R6ZA 2QRVB 3P71T 3SSOA 1KR5A 3TMAA 3WSTA 2C7OA 2FPOA 3FUUA 2JH9A 4U7PB 2B25A 4XCXA 4WVLA 3EVDA 1QYRA 2BH2A 4MIKA 1EIZA 2PT6A 1O9GA 1XJ5A 3R3HA 3EGIA 4HTFA 1VLMA 1I4WA 2F8LA 2AOXA 2IH2A 3PFHA 1EQAA 3FRIA 3NWEA 3KQWA 4M38A 3MTEA 1SUIA 3OU2A 1Q0TA 4R8RA 2IIPA 3CGGA 3R6TA 5K0CA 5LR6A 2IH5A 2GB4A 5G02A 3ELDA 3CJRA 5EKUA 2FCAA 2P7HA 3FPHA 3TPZA 1M0EA 3ER8A 4DCMA 2B9EA 1YZ3A 2AN5A 4FSXA 2ZBRA 4RTSA 1KHHA 3Q7EA 2O57A 3UJ8A 2ZSUA 3R0QA 1I9GA 4EMSA 5HILA 5P8WA 2DULA 2I62A 4ER7A 4UOEA 1VIDA 5DLYA 4YV2A 5FUBA 1QAOA 3P9CA 3R24A 4FT4A 3D2LA 4CWAA 4ER6A 4PIMA 1OR8A 5KYGA 2KW5A 5FWAA 5M5BA 4IWNA 1H1DA 2AOWA 5FHQA 4B17A 2BM9A 5ICCA 4C04A 4GOLD 5EIWA 2UZ4A 1L9KA 3PT9A 3G2MA 3HA3A 3SXJA 2I9KA 2PX5A 2QM3A 1FPQA 1G55A 2OPBA 3HA7A 2O05A 4GEKA 5FULA 3A7DA 1HMYA 1JG4A 2JJQA 3GCZA 3HA5A 1P1CA 3Q87B 5DM4A 4AZTA 2ZFUA 4E31A 3BT7A 3H2BA 4MHTA 3FPJA 2PSSA 4YV1A 3LX6A 1VP9A 3VSEA 1L3BA 5K03A 4DF3A 1INLA 2AVNA 2A14A 4YMGA 4LWPA 3B89A 2AOTA 3EMDA 3NW9A 3PVCA 4CTKA 2IBTA 5HFJA 1FP2A 1TPYA 4RTPA 2C7RA 2IPXA 2G70A 2FRXA 4DKJA 2YX1A 3AXSA 4YUYA 1EAMA 4CTJA 2P41A 3C3YA 3DLIA 1JQ3A 2EX4A 2GLUA 3AWIA 1KPGA 5CM2Z 5DX1A 3SSNA 3TLJA 1VPTA 4M7RA 4KIGA 1DUSA 1SQGA 3I53A 1RI3A 2FYTA 4O29A 5KQRA 3P2IA 3TM4A 3EVCA 1JG2A 2R3SA 4K6MA 3MCTA 5DX8A 5E8JA 5EMLA 3UWPA 5CCBA 2AN4A 3C6MA 3NVKI 2NP7A 1WXWA 2AOUB 1U2ZA 4QQNA 3HCFA 1XXLA 3OCJA 1NBHA 2OZVA 3I58A 4LWOA 3UJ7A 4PONA 1MJFA 1P1BA 3KQQA 2UYCA 2B78A 3VC1A 3B3GA 3P97A 3KQVA 4RTJA 3UBTA 2ZZKA 4OA5A 5HIMA 1F38A 3CKKA 3LPMA 3MERA 4DA4A 1YUBA 2ESRA 1JR4A 2ZVJA 2PY6A 4KDCA 4DMGA 3BWBA 2Z6QA 4E2YA 2YUIA 5EIFA 2ONZA 4HSGA 5GINE 3KHKA 2CMHA 2PX4A 4G56A 4RVGA 1D2GA 3KQOA 2AZTA 2IBSA 5DRYA 2O0LA 5D1NA 5DM2A 2NP6A 4WXHA 4ER3A 2IGTA 1KYZA 2H11A 2XVMA 4HG2A 4RX1A 5C0OE 2P3LA 2PXXA 4FGZA 3G88A 5FA5A 3FTFA 5FA8A 3GGDA 3HCEA 3G2OA 3PX3A 3MB5A 2ONYA 1Z3CA 4IV8A 4FP9A 2AOUA 2PJDA 5BW4A 4YUZA 2G1PA 3M6VA 3OE5A 2GAFA 3E8SA 3LSTA 5GM2A 3RW9A 2B2CA 3P8ZA 2QYOA 1AF7A 2AVDA 4R8SA 3FPGA 3GNLA 5K8VA 1O9HA 1XTPA 3E7PA 1RI4A 4XUCA 2YR0A 4RVHA 4X63A 3FTCA 3T7TA 2P8JA 4KDRA 3SSMA 2PWYA 5K0EA 5K0GA 2JH8A 3CVOA 1HNNA 2OKCA 1NW6A 4QDJA 4PGHA 3EGEA 4YUWA 2P7IA 3OU6A 5LQRA 4ZTBA 3KR0A 4DZRA 5HZMA 3OZRA 3P2KA 2P1DA 2PWPA 1JTFA 5CVJA 5GOZA 1KXZA 2CL5A 4PNEA 5DTQA 3KR1A 4BP1A 5LQNA 1EJ0A 4QTUB 3GRVA 3HCCA 3THRA 1T43A 4CKBA 3EVFA 4RTRA 4X60A 3O31A 3M6WA 1JQDA 5ERGB 2PBFA 4PCLA 4PCAA 5ICGA 2QY6A 3FRHA 3LDUA 4IKPA 1VQ1A 4A6EA 3CJTA 3OE4A 1QANA 3JWIA 1RI1A 4HGYA 4HTFB 1SKMA 2PX2A 2GS9A 1JSZA 3M4XA 1ZGJA 4LG1A 4C05A 1X1DA 3I9FA 1NW7A 2PVCA 4PYQA 2V74B 3FUWA 3KKZA 4AZVA 2O06A 1FBNA 2LD4A 4DM3A 3UZUA 3IHTA 1F3LA 5EG5A 4E2ZA 1QZZA 2VZ9A 2GPYA 3KQTA 3MAGA 4P7GA 1IM8A 1JSXA 1TW3A 1P39A 3KPYA 1I1NA 2UYHA 2NYUA 4RVDA 3KQPA 1KYWA 4R6WA 4ISCA 4XUEA 5DT2A 3KU1A 3ELUA 5T67A 4P7FA 3BGIA 3NDJA 5HOQA 1AQJA 5GWXA 1KPHA 3MTIA 1FP1D 2YVLA 3RIEA 1PJZA 2I6GA 4E33A 4ER5A 2P35A 5K0LA 5DTMA 4YUVA 1XDUA 3SVZA 1AV6A 5CVEA 2BR4A 2Q41A 1QAMA 2OO3A 4OQEA 4BLUA 1YZHA 5CVUA 3SMQA 4DCGA 3LHDA 4E32A 1ZGAA 1R00A 1R74A 2E5WA 5JUWA 5K09A 3KPUA 1O54A 2DPMA 2EJTA 3CC8A 1WG8A 3CBGA 2NXCA 3GRZA 1DL5A 1ZKDA 3LBYA 5LQJA 3NMUF 4QPNA 2HWKA 3KQYA 2OB2A 5ICEA 3IV6A 1ZHFA 2OBFA 3M70A 3B5IA 4AUKA 2EJUA 4RTKA 2JG3A 3HTXA 3UJCA 2ORED 5K0FA 3FUVA 1V39A 5CVVA 1NT2A 2N47A 5D1HA 2FK7A 3V8VA 3C0KA 5ICFA 3DH0A 3G8AA 3UJAA 2ZCJA 2ZIEA 1XDZA 5JR3A 5T6BA 5KS2A 4MTLA 4GOOD 3P2EA 1EJ6A 4KIFA 5DX0A 4RTOA 3FYDA 3KPJA 3FZGA 3RODA 3SX0A 3X0DA 4GBED 1D2CA 3DP7A 3HM2A 4KRGA 3FPEA 4P7JA 5E2BA 1DCTA 3LDFA 1NW5A 3O4FA 3UJ9A 2XYQA 4Z2YA 3NTVA 4NECA 2XVAA 1M6YA 3GRRA 5E9WA 3PB3A 2V7EA 5LQCA 2Y1WA 2VDUE 3BGVA 5LQUA 3C6KA 2YXEA 1RJEA 1NV8A 4RYLA 3MCZA 3DR5A 3ME5A 3MHTA 4BY9E 1TW2A 1XCLA 1PRYA 3G5TA 3LKZA 3DMFA 3EVEA 3PS9A 1YF3A 5CD1A 4FSDA 1YB2A 4EKIA 5HIJA 4OQDA 2ZWAA 1SVUA 1XCJA 1YFLA 5FQOA 5DXAA 3A4TA 1NE2A 3GRYA 1VE3A 3SM3A 3R9XB 1R6AA 3FPFA 3O7WA 4RV9A 2ZBQA 5T64A 1ORIA 2ZULA 3HCBA 5BP7A 3BKWA 4E70A 3M6XA 1IXKA 4R05A 4V0QA 5FWDA 2PX8A 3NDIA 2VDVE 2PXAA 3DMGA 5K0NA 3BWCA 3NWBA 1RJFA 2YQZA 3SR4A 4CKEA 1KPIA 2BZGA 4RTQA 5E9JA 1JG3A 3QOWA 4P7KA 5HIIA 3KR2A 4E2XA 4ER0A 3LL7A 4GOND 4M37A 2HV9A 4X1OA 2CWWA 2PLWA 3I5UA 1VP3A 2XYRA 3LBFA 2ZZNA 3LDGA 3ELWA 5K0JA 4HC4A 5GIOE 4GUAA 4KWCA 5LQKA 5FHRA 3DMHA 3MQ2A 4EK9A 2ZBPA 1NW3A 4IV0A 1XDSA 4LECA 4Y2HA 5EGSA 1BHJA 7MHTA 2HTEA 3IEIA 1WXXA 3HVHA 4KW7A 4MQ4A 3EGVA 4QTTB 3UA4A 3K0BA 4BLWA 5IH3A 4PWYA 4CXMA 5U4XA 2XBMA 2AOTB 2JHPA 4QDKA 2UYOA 3CJQA 5CIYA 3G8BA 5F2NA 1N7JA 2C7QA 1R8YA 4PIPA 4PYJA 5K01A 3HCAA 3LECA 2IDKA 1NW8A 2VP3A 4FZVA 3EEOA 2NNWB 5K05A 5DRTA 3HVIA 2AS0A 1BOOA 1UWVA 5EEGA 5EHIA 3VC2A 5CCXA 3HNRA 4OBXA 1D2HA 4KVZA 4AZWA 5IKMA 1R18A 3GIWA 3A27A 1RJGA 1Y8CA 4AX8A 1P91A 3FUXA 1G8SA 3BKXA 3PFGA 5FADA 4OX9Y 5CVDA 3EVAA 8MHTA 4EVIA 3EVBA 2ZTHA 1X1BA 3B3JA 3K6RA 3HVJA 3KPWA 1BC5A 3DXYA 3F4KA 2ZW9A 4GC5A 4MWZA 5EKXA 5HEKA 3A7EA 2K4MA 4YV0A 3HCDA 3UFBA 5CUQA 2VDWA 3CCFA 3IYLW 2PXCA 5B1SA 3ELYA 4H0NA 3M33A 2WA1A 4L7VA 2AN3A 3GO4A 4F84A 1WS6A 2ZWVA 3QOXA 3KQSA 5F2KA 2OYRA 1JTEA 4HRAA 3V97A 3ER9A 2BR3A 2CKDA 2NXJA 3HP7A 9MHTA 2Y1XA 2H00A 3AY0A 1SQFA 2YXDA 3MGGA 3AXTA 4PYMA 4C07A 4DQ0A 3FTEA 4U7TB 4XUDA 3QV2A 2ZZMA 4HGZA 1Q0SA 1UIRA 4RTLA 5EZSA 4X41A 3GU3A 3TOSA 2YTZA 2FHPA 2ZIFA 3GDHA 4M36A 2YXLA 4X61A 4HH4A 2G71A 2P3QA 3A25A 3LGAA 5GM1A 3TM5A 1NV9A 5DTRA 3UJ6A 1BKYA 4C4AA 4PYKA 5E1BA 3OFKA 3OZTA 3GJYA 2ZLBA 5E1MA 1WY7A 1KP9A 3GWZA 5FQNA 4PINA 3UJDA 10MHA 4C03A 2VS1A 1NKVA 2ADMA 5HIKA 2PT9A 3U81A 2BR5A 5F2OA 3KPVA 1SG9A 3NVMB 3A26A 1ZQ9A 5KQSA 2EG5A 5E8RA 4C06A 5EZQA 3KQMA 2EFJA 2PKWA 4FR0A 3PX2A 3G2QA 1MHTA 1L1EA 5DM0A 5EPEA 2PGXA 4BP3A 2UYQA 1SUSA 5DXJA 1N7IA 5K0BA 3ANXA 3EVGA 5DSTA 3I64A 5H02A 2AR0A 3L8DA 5BXYA 3G2PA 3FTDA 2FK8A 3DLCA 1RI5A 3EMBA 3OFJA 4GOMD 2Z6AA 4QVKA 2PV0A 3E05A 3P9NA 2OB1A 3P9KA 3THSA 2OY0A 5E9QA 4EKGA 4E2WA 1X19A 2HNKA 2QE6A 3JWGA 4FT2A 4R6XA 5EOVA 2ERCA 2IP2A 3BWMA 5KVAA 3LCVB 2BM8A 1G6Q1 2GA9A 4GC9A 4EQZA 2Z6UA 1WZNA 4PGGA 4GQBA 3SGLA 3TKAA 3JWJA 4QPPA 3T7SA 4JXJA 3TR6A 5EQJB 3FYCA 1B42A 5EVJA 5GP1A 4GF5A 1VL5A 3C3PA 4RTNA 4QQKA 3BWYA 3LCUA 1EG2A 3TKYA 2JHCA 3REOA 3UJBA 4E30A 3DXZA 3M6UA 5DPMA 3EVZA 1G60A 1RJDA 1YFJA 1G8AA 1ZG3A 2XYVA 4Y30A 4FS8A 4A6DA 3G7UA 5C9ZA 1ORHA 4PYOA 3AJDA 4OBWA 3DUWA 3T0IA 3TFWA 4QVGA 4PYIA 5FTWA 4POOA 5LSAA 3ERCA 3ID6C 3P9IA 5EMMA 5E1DA 5EMKA 2WK1A 1RI2A 3B7PA 5EMJA 3PLAE 4V0RA 5E2AA 1G38A 2O07A 3NJRA 5GIPE 4P58A 2JHAA 3G5LA 5FCDA 3T7RA 2IDJA 4C08A 3G89A 3BUSA 4RTMA 1UFKA 3EEYA 5DSXA 2QRVA 3E23A 4RWZA 3VYWA 4F86A 2ZIGA 3GXOA 3FUTA 1VBFA 3B3FA 3DOUA 2G72A 3UA3A 2NXNA 1AQIA 3BGDA 2OXTA 4OA8A 1KIAA 2C7PA 5EC8A 5LQAA 5DWQA 5C1IA 3OZSA 3ORHA 3LCCA 3OPNA 4PYLA 2NXEA 1X1CA 2AOVA 3DULA 1IY9A 1JQEA 3LKDA 3BZBA 5BW5A 5MHTA 2P40A 3BXOA 2WA2A 2G8NA 4AZSA 3JWHA 4CKCA 2I7CA 5EHGA 3HVKA 2IH4A 4RSRA 3TQSA 1L3CA 4YUXA 3TRKA 1XVAA 3KR9A 1JG1A 3HEMA
chains in the Genus database with same CATH superfamily
3EWIA 2EU8A 1FJXA 3HZEA 3HL0A 3VDNB 1R8XA 1VL6A 1MQ9A 3MFIA 3VR3D 3DV0A 3K8WA 4F3TA 4IXMA 5M2UA 5JMPA 3T3GA 3HFRA 3PITA 4GG1A 2LFVA 2IA6A 4CDMA 4U7CA 1O03A 3TQRA 3VF0B 3ER8A 4RIGA 3U6KA 4YQFA 3LT1A 2E1CA 4ED1A 3Q12A 4HI2A 3OQ1A 2JVOA 1RHQA 2RMLA 1UT5A 4O0IA 2WTNA 4CMAA 1YTUA 4RU1A 1PYDA 3SZOA 5C1BA 4K4VA 4J9LA 2PKQP 4GSLA 4B6JA 4ZC8A 2BACA 2GF9A 3OEYA 1PR0A 4CQLA 4WJBA 2GLUA 2Y71A 4L0QA 3GR6A 3W9SA 3KLMX 2H5IB 1M1NB 3EVCA 3DCIA 3X1JA 1X2BA 5JVDA 3TRHA 3G8SA 1QUPA 4PPGA 5HGXA 1GV1A 4Q43A 2W4IA 4OZ5A 2XS2A 3KOXA 3P5SA 3TNYA 3U4AA 1O87A 4IHKA 1R15A 3FROA 4CCHA 2G0NA 4O4HA 1QYVA 3BMXA 3QKRB 4EIWA 1ZH6A 1IBCA 3DRRB 4B3DA 1COWA 1DB3A 5GAHI 3FPGA 1F2UA 1BXZA 3JR7A 4R81A 2W24A 2V0CA 4ZOQI 2PWYA 4W5WA 2ZSAA 4Q9LA 3EAFA 1E4YA 3ORQA 3RTEA 3AESA 3C8HA 2SECE 3SF8A 2QSJA 2O54A 2X3UA 4JVSB 3UKDA 4PCLA 4A4DA 1LLDA 1NVUQ 2REQA 2DOKA 1BW9A 2EBFX 3HH8A 5JVGQ 3N2KB 2V74B 4PRKA 2OV8A 4AZVA 4ZHQF 3P2MA 3D1LA 1JSCA 4Q00A 3QLVA 2OBLA 2WD9A 2GN1A 3KJEA 3DN9A 4JITA 4CCSA 1X7XA 2QOEA 2VKTA 1MX1A 5FH9A 1EUYA 5AKGA 4H1WA 5J2MB 1MDBA 4BC0A 4ENTA 1WO8A 5KEIA 3TIVA 2E44A 4ETWA 4H4DA 2MHEA 4H4OA 1W44A 3RU7A 4IFTA 2R66A 1WIWA 1UJ4A 4DG1A 2XW6A 1SQ5A 1Q1ZA 4PN7A 2QMQA 1E5VA 3C97A 4B0OA 5LQUA 2XXJA 1R9GA 1TW2A 3EZXA 1F1BA 4RMIA 5PGMA 2XSZA 2N4CA 5DHRA 1Q83A 2V97A 4IOKA 3V2HA 3TARA 1GARA 1FT8A 1ULUA 3TX0A 4N5DA 2O48X 2DPLA 3TVKA 3W2WA 3MR5A 4JODA 2P27A 1XNQJ 4HT5A 1O0PA 2XS7A 2GI4A 1NHWA 2PSFA 1RI7A 4UD6A 4OV1A 2YWHA 4TN2A 1HK7A 5DCYA 3MN1A 5SY6A 1NXSA 4CEJB 4AXXA 4I55B 3F56A 5F35A 5JBIA 1Z2LA 1X5TA 3URKA 3KEQA 3D0KA 3TQCA 1C9NA 2YH2A 1AV7A 3MBKA 4TTJA 2RRNA 1V48A 3QU7A 3IQFA 1WD6A 5D0RA 3MWEA 5AR1A 1GRRA 8MHTA 4L4ZA 4AXJA 1MWZA 2X58A 4DEVA 3ZD7A 3B53X 2QTHA 1JTEA 2YKMB 3ZZPA 3V97A 3R0ZA 2MQLA 4YRSA 3AY0A 1YE5A 1MOPA 1JKXA 5FPSA 1RKXA 3RK4A 2VRWA 3BPSA 2WWRA 3VJLA 1IOZA 1Y48E 3IWXA 2WMYA 1JJBA 2JHEA 3VVUA 3DFKA 1ZQ9A 4RY2A 4ANDA 1GXTA 3W3ZB 4I0WA 5AYVA 1U1QA 5JBQA 3ON5A 1K92A 4MVCA 1XKQA 3BB4A 2B4YA 2QLNA 3HJGA 3IUMA 2YV2A 2IP2A 3FCSB 1KD1T 3M5DA 4DF4A 4Q01A 2VA9A 2JVRA 3W05A 1EG2A 1GUZA 2PA8D 1MB9A 1GFZA 3AETA 3U31A 2PH5A 5HF9A 1YFJA 1F51E 3OTQA 3AH6A 1KFJB 3O2NA 5K7SA 2OQ2A 1MEJA 1BGVA 4NU0A 1J5XA 1EDZA 4JZKA 3TFQA 1DMSA 4IVPA 2XTZA 4JX8A 4YEAA 5F9HA 1O77A 1QVRA 1VKHA 2XH8A 4WLNA 5EHGA 4Z1MD 4HHEA 1RQLA 1UKYA 2WVBA 1AXEA 5I7FA 2BKXA 5BURA 4FKXA 1DIOB 4BLVA 2FUCA 3ANLA 1WC3A 1X0XA 4WFNQ 3SSOA 1FCJA 7YASA 2CB0A 3VAAA 2EGUA 4M38A 2BEWB 1I5EA 5FNVA 5G40A 2RILA 4W6QA 3KT6A 4AF6A 4YEDA 4B09A 5ESDA 5HILA 3K0SA 4RM3A 1O5IA 2HG4A 1OWPA 3RUHA 4Y6SA 2VT7A 1YTYA 1G2IA 4GOLD 4Q7QA 2RD2A 3CKYA 2GFIA 2Q45A 1KBRA 4V38A 2X6TA 4RW9A 2JIDA 5DNVA 4MHTA 3HHNB 3DGFC 1HDIA 5K3OA 1L3BA 4AY3A 2B30A 3AF2A 2VPYB 4N5IX 3FRJA 2YFHA 4KGZA 4ECSA 2LRHA 2Q4OA 4HY3A 1Z15A 1FU8A 1X74A 3FYUB 2JI4A 5C2GA 4YBRA 1RYEA 1E64A 3B1ZA 1DJOA 2BW0A 4OIMA 4WINA 3UWPA 3X3UA 5T7LB 4QQNA 4CLWA 2AW3A 1RT9A 5AVYA 2GAOA 4ZOLF 2JFKA 3VR6A 3ISND 3CX3A 2G7MC 4YJHA 4BKPA 3V8QA 4ENVA 3MUFA 3KV3O 3SFZA 4IG0B 1NKBA 4IQ4A 1UJ6A 2XUIA 5IJ0A 2YRWA 1T5BA 2G06A 4U3JB 3TAMB 2Q8QA 5LB4A 1U94A 4QQ8A 5C5DA 1ZJ6A 4YASA 1B15A 1BMTA 5AM0A 2CIMA 4ZVUB 1Q2UA 2H0RA 1JJ4A 2V6BA 2XLKA 3GEHA 3K9LA 3EJWA 5CBPB 4YALA 2ODBA 3LH2S 4INPA 2WSEC 2V0NA 3C98A 2REBA 3WK8A 4P0QB 2WJVA 5ECYA 2L9NA 3VVBA 1CLFA 1M0SA 2WIGA 1RYYA 4ZZ0A 1RC0A 1JLBB 1N0UA 3MTIA 3RIEA 3K4PA 1KN6A 3DRPA 3FNBA 1U98A 1MH9A 4QEKA 3QOFA 5LFAA 3CS3A 1ESCA 1GYPA 1U47A 4LSZA 2N47A 3OZVA 4HZUA 4OXYA 3I62A 2GYWA 3K9CA 1UC4B 2FSPA 5C5EA 5HATA 2CQ4A 3MGAA 5D4OA 2OBMA 1O1YA 1WRBA 4OK6A 4U5QA 4ZVTA 2IHR1 3WL4A 3S40A 1BVUA 4EB3A 3CLTD 3PUJA 2LLZA 3AJRA 1JNZB 1Z73A 4R2LA 2ZT5A 4RKYA 3R9LA 4DPXA 3WIEA 4ARAA 4RVUA 1QO0D 4FFVA 5HJXA 4RV9A 3ZK8A 3ZIUA 3UDLA 3ZHSA 2DVMA 1CC1S 1OHHA 1Q7BA 2CJPA 2FFHA 1OFHA 4N47A 1W7WA 4JV2A 3LL7A 4EEZA 3T1YJ 3OVBA 3PNKA 2DPIA 3CLRD 4P73A 5CABA 2OFXA 4FXVA 4QBUA 1T2AA 2GXAA 4JYAB 1SD1A 2UYOA 2V65A 3VWSA 3U3XA 1VPEA 4QT0A 3WA7A 4F7VA 1GUDA 2NNWB 1E5LA 3L7OA 1NA5A 4URHA 4ZVSA 2ZUCA 521PA 1P1KA 1NNDA 4YV0A 1RJ9B 1BWSA 2JCVA 3HLTA 2R4UA 1VI5A 1C0TA 3GILA 1V8OA 1H69A 4FKZA 1PGNA 5EE0A 1P1TA 2XODA 3ZDCA 2IEDA 2ZOMA 3CVYA 1CEZA 3H97A 4WJLA 4LVCA 3K09C 5F0WA 4DV6F 3KVVA 3EIEA 4TUYF 2G5GX 3BGRB 4CEIB 2O4CA 1M2EA 3QVSA 5JCJA 1WC1A 2VF8A 4BJ6A 3WGTA 2HLDD 4OB7A 3NGSA 5K0BA 3K6KA 2FSUA 1STOA 3NS7A 5J2TA 5BSWA 4RGQA 1H6DA 1N52B 4MQLA 3PQFA 9LDBA 1QVFR 2WUGA 2DPXA 1ISMA 1KYQA 5I3UB 7FDRA 4LJMA 3P9QA 3C6ZA 2NZUG 4GF5A 4ZCIA 5B0AA 5TPZA 1N32J 5TJHA 4URZR 2QX4A 2VYNA 2XMPA 4KFTA 2I6UA 2VNSA 4QVGA 1DRVA 1GMWD 5D0EA 3UI3A 2JJ1A 3U1VA 2B83A 4F5ZA 1UMCA 1DHTA 3O8LA 3NG1A 4QUKA 2OFFA 4M83A 1HETA 2NXNA 4ZZ1A 1T5DX 2MZJA 5CLLA 1E2HA 3F6SA 2GRAA 4L76A 3VOAA 4IKEA 4X62B 2P5SA 5ULLA 3V34A 4KKXB 1T5HX 3DXXA 5D7NA 4NCJA 1T4GA 4DUGD 1CPYA 3JQ8B 1DBIA 1RKQA 5L46A 5A8RB 1U7LA 1UT6A 2D3ZA 4LXQA 1U1MA 1YRTA 2KG0A 1ENPA 2MY7A 5TSDA 4BX0A 1XZNA 2PA0A 1Y0BA 2ZIXB 1TT7A 4XPIA 1PFGA 1Y9ZA 1MVOA 1ZRNA 3LXMA 4C0LA 5KPDA 4JGBA 4YT8A 1T9CA 2Q6OA 4GEKA 1C4AA 2GJ2A 5KNBA 3ZZOA 1N8RT 2OV4A 2VJMB 3Q6MA 4WY5A 2OMOA 2I7DA 3HJTA 5A3QA 1EX7A 3WGOA 3SX2A 3OF3A 2IZ7A 4BO6A 3U3KA 5KVCA 4HWPA 4KWTA 1WXWA 2ZDPA 2CUKA 5JQGF 4CRJA 2HIMA 4NG5A 1HFWA 2FMUA 3B9QA 3LIIA 4D9MA 2AD5A 2H0AA 4BX3A 5IT5A 1BVHA 2W2NP 1TVKA 2CDQA 5HVNA 3CH7A 4G63A 2I0XA 4ENRA 3I92A 4ER3A 1YGPA 3HCEA 5B7GA 2ZRHA 3AAWB 1IJFB 3P5BP 1MOSA 2LDXA 2JBAB 1ECGA 1MGOA 2JBHA 3C15C 1PJ5A 1EVYA 2V5HG 1HQDA 4ZGGA 4Q48A 3KELA 4FFOA 4Y8VA 3G2IA 5HE9A 2HIYA 1DV2A 2IU4A 3EVWA 3GI1A 3FMBA 1R3UA 3A1TA 1W59A 4JI2J 3V8NA 4OQQA 4CLHA 2J6BA 1CSJA 4I2QB 3SBXA 3PP8A 2EFQA 2O2CA 2DCLA 4ESOA 9RUBA 2OFGX 4Z4HA 2WJ6A 3UAGA 2ARKA 4JJ6A 3ZXIA 4DLZA 2JFUA 4HWRA 1C4KA 3CCJS 1SD2A 3ITHB 4OG2A 1P7ZA 1MORA 2B4OA 3OO0A 5LOQA 3PQ6A 4USVA 2VH5R 4YN3A 1Y7HA 3L6RA 1ARZA 2A3NA 3I96A 4UJ3A 3WIUA 4JNCA 1YWXA 3VYTB 2PMWB 3R7WB 5KFCA 5B36A 1RC1A 3RUDA 1JQGA 1J2EA 1DXYA 1YOBA 1S1XB 5E9WA 1ZOSA 3FYHA 3ZJ5A 1QTNB 2B0GA 3E8OA 2CUNA 5FA6A 5D86A 1Z6XA 1XCLA 4OH7A 2W4MA 2VJDA 4UBOA 1E2NA 4C5CA 2DYAA 3KQKA 3E22A 3L6UA 1UAYA 3CUUA 5CD4H 1R66A 3R5AA 1MPTA 4Q4LA 3K5HA 1E8DA 2GHPA 1V3TA 4MS1B 4TYMA 5CH8A 4X3OA 2X0FA 4CIVA 1IM2A 1WCWA 2YCBA 2BJ3A 1U3GA 4MW9A 5CMLA 4PAAA 4FKYA 4ZHSA 1ZNZA 4MDEA 5JZBA 1Y5NB 4KPEC 4RKFA 3MHYA 2I67A 3ZU4A 1U8YA 4LK3A 3OETA 3BKXA 4BASA 1R5OA 3GQCA 1FNBA 1CQMA 3THYA 4BHQA 1LB1B 3NHWA 1V4BA 2Y1DA 2IVZA 3CDAA 4DR6J 3HP7A 4QOHA 4CMGA 1NX9A 4AY5A 2D13A 3N7TA 1DMRA 1PTJC 2FMFA 1UCFA 3UXMA 3DMRA 1I1GA 3R8FA 2VYND 3DE4X 3T5TA 4O4JA 2OP0A 1FL9A 3II6X 4Y9TA 4JBIA 5FX2A 3H6HA 2VDWB 4W8GA 4F97A 1U3CA 5K3AA 3L0ZA 3BYZA 2VOPA 4BCDA 3GSDA 1ZUNB 4NLPA 3AUYA 4CV3A 1P7YA 3PWKA 2VHYA 2BYCA 2WVGA 3BO2A 3AZQA 3NRJA 4L95C 1AMNA 4YNBA 4YJFB 5BVHB 2XA9A 5EPOA 1QZXA 2M2BA 1KAGA 1C4CA 4GQBA 3EDRA 1V7QA 3P9YA 4DPLA 2IYOA 2EZ4A 1BXRA 2CJYA 4L50A 4D0SA 5BN4A 4YTEA 4PANA 4M7OA 3TSWA 5ECGC 4LDRA 2JPDA 2YX7A 4Z2XA 1CVRA 2DNNA 4BVAA 3OD5A 1MNQA 4ZOLA 1KQOA 1KIAA 1F14A 1JVBA 1O7JA 4I56A 4NYJR 4E5VA 2KM8B 3BFPA 1UT8A 1S2GA 5LA6B 3M1AA 3NUQA 4PFJA 1RM4A 3T5HA 2V7XA 1FRJA 3R5KA 2ZRPA 2EQ5A 2CLFB 1D9AA 3T1HJ 3QXCA 3FFIA 1TYAE 2B7LA 5BYJA 5JCXA 3VOBA 1BU8A 3SCLE 1CXZA 5F8MA 2UAGA 1YVRA 3W1EA 3VGVA 1YH3A 5ICCA 1JLAB 3EIWA 4BNIA 3BGRA 1GILA 5LBIA 2DPYA 2GM3A 2P62A 1B70B 1K4KA 2NZXA 3EWAA 3RBDA 3MOJB 1PS0A 5IAKA 4ZHRA 5HBGA 4I4LA 2I76A 2IAJB 1Y3KA 1P80A 3DLIA 4DR3J 1XRMA 4MB0A 3BSYA 1VPTA 4MOWA 2ILVA 2QLFB 4O29A 4YIKA 2ZJBA 3A2LA 4QPXA 1DIAA 1GEGA 3U3ZA 5BRJA 1XXLA 1A8IA 3WLAA 3AI2A 1AZLA 1O4VA 1UDWA 3CKKA 2CPXA 2BI8A 3A6PC 4QUJA 4OGKA 2H0QA 4K3UA 4B1FA 4TS1A 3H4TA 3AUAA 3GA5A 3IQDB 4CT8A 1J0AA 4D97A 1NFRA 3W3AA 3MMJA 4CUZA 2Q4DA 3DE1X 2X7IA 1T8YA 1UWAA 3AVYA 1RHKA 3ROFA 4JI6F 4PCUA 2GFQA 2IC3B 5C1OA 1L6RA 3WGLA 4CM4B 1E3IA 3GR1A 1DBSA 3PD1A 4B34A 1RM5A 2J6IA 3AR7A 1TC2A 4F5YA 4J3FA 4UMVA 2CL5A 1YL6A 5JNUA 3D0HE 4W1PA 2IEZA 4FW9A 4OTZA 3SDSA 2IDLA 1N32F 5JS8A 3IPLA 4F3MA 1S3GA 3NCPA 1MNAA 1B74A 3B54A 3LNCA 4IFEA 5C80A 1P2SA 1QV7A 1W6RA 2ZJPQ 1ISRA 5A5FA 3B48A 1XRJA 4DC0A 1RADB 1S8NA 5FXMA 3UUWA 1UMCB 3L6DA 3GLGB 4ODIA 4ZEOA 4CCAA 2NXCA 3PD7A 4NYOA 1XLWA 3M1VA 2ZFHA 5DM6Q 3SF8B 1CULB 1QG4A 3EGDA 2XNHA 1P45A 3CN7A 1EKXA 3H5RA 4JCOA 1QC5B 5CFPA 3BGWA 2W4QA 3P0IA 3TIGA 4YB7A 5M29A 4ZLNA 1C30B 4O3FA 2VT6A 2IKQA 1KZGB 4JLDA 1PBUA 2DJ5A 1LTKA 1VL8A 3GJTB 2JAOA 3WBFA 3NLCA 1PSZA 3ZXYA 2A1IA 1NE2A 1ZRMA 3MGKA 1TZ2A 1BWQA 2QLTA 4TZ6A 3DNMA 2PFFB 2OENG 1KRPA 1L4HA 3MM9A 1ZA1B 4IXTA 1RZVA 1P1JA 3KZXA 4D4HA 4OJKA 1CUHA 1XLTC 5H1SV 1IWOA 2FHJD 3O75A 1AS0A 3D0GE 4CGZA 3E9RA 4TQAA 3HKEA 4PBRA 2DG2A 4NESA 3AV0B 4D0GA 1WF2A 3DFEA 2KI5A 4NEHB 1IBLF 1W19A 2FXIA 1B76A 1I7NA 4TLMB 4B3MB 1KRHA 2H16A 3W66A 1MIHA 5MN5A 2XS5A 3ZUPA 3Q3GE 1F48A 3BRSA 1RYDA 3SHFA 1RT6B 1OKKD 3AEYA 2ZUEA 3RHFA 4UU8A 4RHYA 1P0FA 3BCUA 4NYJQ 5TGZA 1U4OA 2H2FA 2AQIA 5AXNA 4DF8A 3QWHA 3ZXXA 1XZPA 2SKCA 3H5SA 4ICIA 2Q2VA 5AESA 3FBCA 3UM9A 3IDZA 1UKEA 4X1KA 3TH5A 1IZ8A 2DPHA 2HVHA 3EG9A 2HAIA 4L8YA 4ZPJA 2HIAA 3LPNA 3OOJA 4U7UK 3JALB 2NYRA 5ALQA 3J7Z5 3NAGA 4RPKA 4FTWA 5JBNA 1S0UA 3HZOA 3QA3E 3GH3A 4UU1A 2K7JA 2BP7A 2ILTA 5FIUA 4J1SA 4C4OA 1GO2A 4L3KA 1S76D 3QSGA 4NZ9A 3NJRA 4D5GA 4BIMA 2DMRA 4E0BA 3WKBA 2WB2A 5FOUA 3OLCX 3BBPA 1TVEA 4ZN1A 1H8HD 4K9LA 4C7VA 4ZS6A 1ZYQA 2V7BA 5AW4A 4PWUA 5EWLB 5FTNA 4W7IA 4LC0A 3Q8UA 4U8VA 1FNDA 1WF6A 1M8GA 1Y1PA 4G5RA 1EWKA 3AI3A 2XDQB 2IIPA 4OYMA 2Z9CA 1AM4D 1YBFA 3Q1KA 4HR2A 4EBFA 4BO3A 1L5LA 3LUJA 3N01A 3EQZA 4N7TA 2D5CA 4V0KA 3IKJA 1HC7A 3O8WA 1VCMA 1NSTA 5FUBA 1FRQA 3EWGA 3VX3A 3PBKA 4MEBA 3COZA 4MAKA 4MW0A 1JVNA 4Q02A 3H2BA 2B92A 4FZJA 4IG3B 3LBAA 4EG6A 3Q83A 1Z4JA 5EJEA 4PS1A 1H1LA 4YXWA 4Q4JA 1EZ1A 4M7RA 3W63A 1RI3A 4URFA 3HA2A 2AN4A 1JMVA 2YKPA 3GLFB 2VASA 5HK4A 3Q2KA 2OV6A 3W2EA 3C43A 2O0HA 4XTRA 1A9NB 2CMHA 2NUAA 4LQ9A 4C0HA 2WNIA 3ZY5A 4P53A 1EVLA 3FMIA 2JB9A 1DLOB 5I9IA 2ZE5A 5HJ5A 1VQ9S 1R0CB 4ITUA 2E1PA 2P90A 3V81B 3ROQA 1IHDA 3PCXA 1DY3A 3AOCA 4GX5A 1BEZA 1G20E 2PAAA 3QI7A 2EWWA 4CNQA 1AQLA 1L5MA 3UCGA 4ELTA 4L85A 5F23A 3CVKA 2CGEA 1QSSA 3ESQA 2YMQA 3LOPA 2O5RA 5ADHA 4EYKA 3DMTC 4DIEA 4F4HA 4F4FA 2PUJA 3N3BC 2MDTA 1UQUA 2QX9A 3L7PA 4Z7OB 1RYHA 2XDAA 4DG1B 4N5HX 4R40A 4MPTA 4LDPA 2Z8YA 3MR7A 5L40A 3T3DA 1ND5A 2Y6UA 1V6AA 4LZPA 2ZSEA 2W71A 1SJFA 1XZEA 3GMIA 1YAJA 1VC2A 2IVFA 4UUNA 3ZVNA 2GEFA 3C15B 4RTKA 2OBFA 5TE9A 2DNQA 4NCAA 1GN9A 4RBUA 5FT9A 4BCCA 1SUCA 3AI7A 3H0EA 4B8YA 3MT7A 2DP4E 3NNCA 1ESDA 3OEED 4P3XA 3P2EA 4TTAA 1S72S 3P0EA 4HYYA 4DRXA 2D4AA 2W0SA 2R7SA 1M6YA 2DFPA 5CDFE 4Y1EA 4IUDS 4GKJF 1HHTP 1PRYA 3IAS1 3TRJA 2GVZA 1MFZA 5TQ2B 1W0KA 4P4NA 3Q7TA 3TJ9A 3FJ2A 1PO6A 4KGMA 4HX5A 2XWBF 3IRVA 3O7WA 3QX3A 3WMEA 1V0JA 1OLSB 2VDVE 4MQFB 3WFJA 3RC8A 3VNQA 1VJ0A 4FF4A 1KZ7B 2H1VA 5GAHU 4B79A 1XLTA 4ZAXA 3OTHA 1ZRSA 2CPDA 3Q72A 2Z83A 2DGQA 3SJ7A 4DMZA 3PUYA 2V34A 2YV5A 1FDOA 2VHVA 1ZW6A 3GLSA 3VPHA 2OBXA 2BFBA 1G2PA 1KSGA 1T36B 4AZWA 3DCJA 4CDRA 3A27A 3BN4A 2QZZA 1I5OB 4Y67A 1UBRS 4BLSA 5C35A 3GZNA 4MDHA 3KQSA 2XVYA 4NE9C 4ED5A 1VK8A 3I23A 2BE9B 2E4AA 4IL5A 1Z4PX 1S9GB 2AD9A 1P9OA 3GIJA 4B7ZA 3TFOA 1RVDA 4EYSA 2E4UA 1DO0A 1KI2A 1FLDA 4JJEA 2G71A 3CISA 4PLGA 4OQPA 5L3SB 3MPVA 4M87A 4ZA1A 3EN0A 1WTCA 1QPZA 3OF2A 3OIDA 1NQXA 3C5EA 3TMKA 4C11B 2UYQA 4P32A 4DDTA 3U1NA 3HBLA 5DSTA 3TJ8A 2W6MA 2G88A 2M6RA 5FUQA 3GG9A 4DY4A 1PWXA 5KFHA 3HBJA 1V1MA 1J5OA 4ZQIA 3ZK9A 3TE6A 6PFKA 3BV8A 2BOAA 1FFHA 2BR0A 2I7XA 3JD1A 1UPCA 2CFTA 3R3VA 4FZ3A 4KPUA 3MMNA 4OK3A 1FTGA 2JJ8A 4PZYA 2ZJYA 3PUKA 1DEAA 4Q82A 3ZZ0A 3VQSA 1ENOA 3IO3A 4UPDA 4JIMA 4QOIA 3A3NB 1RI2A 4C08A 4BEJA 1N4LA 1K1EA 4PR6A 1QS0A 1RWNA 2YS6A 4FZ5A 3E18A 1E1MA 4ZMRA 2FE1A 3ZDEA 2ID7A 3LQQA 2R8RA 3E2PA 3MWDB 2YY7A 5AXKA 1ZR4A 1HWLA 2HMWA 1ZOLA 4UBKA 3W8FA 1C41A 4P9SA 4G36A 2IS4A 4LF5B 2X15A 1PIEA 1WUTA 4MK7A 3GDOA 3GARA 4RLEA 3D3EA 2MHCA 4E09A 1BLUA 3EGDB 3LBIA 1HDYA 2Z4RA 4IDFA 3FBEA 2ODQA 3MM4A 5HQJA 1VQNS 4R8RA 3CGGA 5IFKA 1JJAA 4K8OA 3H25A 4A0SA 1QIDA 2YKQA 1XMOJ 1L4FA 2CQBA 2OO4A 4ED7A 2A0YA 2I8EA 2X7XA 4Z4QA 2BKAA 1I8TA 4EPWA 1MB4A 1XN4A 5GADU 3KLNA 4IIYA 1SKWA 3ASYA 1TQ8A 3W5DA 4RLSA 3FPJA 2XD9A 1CUXA 4I1IA 4N0EA 2AP6A 4USMA 2HQ1A 3JRWA 1NVDA 1X7WA 4I2PB 3IO5A 3F67A 3EQ9A 2HA6A 1MCZA 2QUHA 1UMBA 3BEOA 3AP1A 1EX9A 4M9QA 2DXEA 2FW6A 3JARB 4YDDB 3TX8A 5GJCA 1GITA 1VLOA 1F3OA 5DW0A 4TT8A 4DRYA 3A9SA 3B6BA 2Y92A 1QTIA 1LXNA 3CCLS 1QVVA 4CKZA 3MHPA 3H0PA 4LVUA 5GPBA 2WYUA 1Q17A 4FBMA 1VHWA 4XB6B 2R42A 2J9EA 5A3VA 5BV1A 4U00A 3UMRA 3HKBB 3N0VA 1EM8B 3PY8A 1PG0A 2NUHA 1KMIY 3X2SA 1KNQA 2F48A 2FMHA 1ZVMA 3O8BA 4EO6A 1GPNA 4I6GA 2J9CA 2IHTA 3A6KA 2WDPA 1X8XA 3CJ3A 3I9V9 3M4YA 4YQWA 1GTMA 4QUAA 1CS0A 3CF6R 4N1AA 4M95A 2YXPX 3O8RA 4RYDA 5JSKA 1DC5A 2FTRA 3PNVA 3AH8A 1OH6A 4LUBA 1WI8A 4CHGA 4UREA 3ZHBA 4I9HA 1RGVA 1PQWA 2KJQA 2QLXA 3MAJA 2RH9B 2WRZA 1ZD1A 5GMDA 5BWOA 4L8GA 2UVPB 2GARA 1VDHA 4K05A 2YXNA 3FHCB 4GRAA 4Y2AA 4AD8A 3TEHB 1YUNA 4MPDA 5DFAA 2J5BA 5I3UA 1FFSB 3R77A 4W90B 1Z26A 4PZUA 1EH5A 1J1IA 3C16A 2M32A 1S79A 1D2CA 2YVKA 2XY5A 3QEMB 3U7FB 4CO5A 4HK4A 1EWQA 5CCMA 4IQGA 5CLQA 3LPYA 3L8ZA 3EVEA 4KO4S 2CVFA 3VYSB 4N56A 4QYSA 2QA4G 3A3KA 3B2QA 4BL5A 4QOJA 1T2DA 2PTHA 1O57A 4ZT6A 1R6AA 2YKNA 4JD5A 5BP7A 3BWDD 5TPZD 1IC6A 4DIMA 1Q8BA 1RQXA 1X94A 4A15A 1EGHA 2PLWA 5JQGA 3K9QO 3JAKB 3ET6A 3U61B 3IEIA 5CEEA 2P9YA 4Q44A 4MRPA 2XTMA 1YZGA 2OHGA 1GCAA 4UUOA 3WO0A 4DSZA 3E7DA 4XQ0A 5IKMA 1X13A 4AX8A 1IQUA 4AQ7A 1VG9B 4OM7A 4B48A 4LF7B 3UFBA 3LAWA 3OPKA 3W2VA 1PVOA 3K72B 1REVB 4Q93A 2H00A 3ROMA 3J7A1 4DMLA 5C3MA 3WB1A 4YY3F 1UXOA 1RWKA 4XRGA 1ZNXA 3KL4A 4Q39A 2LQJA 2EPIA 4FBTA 4GGOA 2C2MB 4IAOA 4W5OA 2PKYX 3UAVA 1BS1A 3TRGA 1Q3TA 2XY7A 1Z6TA 4KO0B 2VDLB 2YJ3A 3BYPA 1F60A 4OX9F 1KI6A 2X3FA 3E05A 1UXKA 4YFVA 1YLXA 3JD0A 4I6EA 2YYSA 2MTLA 5JDIA 2FETA 3KVYA 4Y2YA 2WF9A 3WHKA 4DXAA 4YV7A 4OHOA 3D1QA 2DISA 1IXYA 3PKYA 3TFWA 5FLEX 4PYIA 2QUZA 1L7BA 2OKQA 2MHNA 2MCFA 4HD8A 4DLSA 4DBLE 1WVGA 2N0SA 1CLUA 3TSCA 1B1AA 4ILLA 3C15A 3KOAA 5LQSA 2OXTA 2CUZA 4W82A 2BUAA 3F6YA 2DPJA 2RNEA 1SK8A 3IC1A 1R8AA 2D5AA 1U3TA 1NBIA 4X7MA 3L7NA 1HBNA 1UJNA 1XIQA 2UU9F 3EZYA 2IK8A 2BFMA 2AG1A 3KO8A 3EQ2A 5E7OB 4YN3B 3KX2A 3DV0B 5J2QB 1E98A 1VLMA 3ZE7A 2NPOA 4JQCA 2X9LA 4JI3F 1L3VA 3GUHA 2JFNA 3DZ8A 4I7FA 3FPHA 4BX2A 1DU4A 5CZXA 2CJWB 1YI0A 1M3SA 2ZSUA 4D25A 5I7WA 2KMLA 3MTAA 4CQLB 4HB0A 2J45A 3M8QB 4A73A 2ID9A 4DHVA 3OCUA 3ELBA 5ETPA 4Q8FA 4I1OA 2G63A 4I66A 1S5ZA 1UJCA 2IIQA 2VH2A 4HLQB 3C2QA 4GPIB 4LDAA 1A8QA 3I04A 4ZKAA 4G97A 1QBKC 3MRXA 1QYXA 2PJZA 1YB5A 4IYJA 1X7YA 2HWUA 4IIUA 1U3DA 2AOTA 2MYTA 1YQHA 3PE4A 4AU1A 4X4RA 3H19A 1WG1A 5A2GA 4K9PA 3NAZA 4RNOA 5DCLA 4PRZA 4KRXA 4B08A 5IT9Y 2XCRB 1S59A 2RGUA 2KLHA 3SDEB 5J63A 4M1SA 3LAKA 3KSRA 1FRVA 3B7GA 4DNOA 4B3OA 1LU9A 3KYCB 5DNCA 4RXTA 2J9YB 4HLDA 2OJ3A 1WMAA 2P6NA 2EX0A 1O6FA 1UFQA 3NEKA 5B55A 2ODWA 5E4TA 3M6VA 5CA5A 3SZ2A 2IEIA 1YRLA 3I31A 3G0CA 1N6IA 4CR7A 5K0GA 2X8WA 2HMAA 3WWZA 3P19A 2PWPA 2R8KA 2GD1O 3QNMA 4M88A 4F0MA 2O7QA 1OB5A 1ZMBA 5CNJA 1M8JA 1KAHA 3BOSA 3VR5H 4U39A 3KJFA 2ATVA 1T4DA 2FZKA 1Z5WA 3QUTA 3PNOA 4QBIA 3ZCUA 1FQJA 3FSGA 1M2GA 3VDXA 2A18A 3SMQA 3E9ZA 3MSXA 4Q05A 2K8GA 4IVNA 1GZ5A 4HKQA 5CFZA 3DTVA 1SVOA 4PEOA 1NG9A 2Q5LA 1I7PA 2PPVA 2I3ZA 3GD5A 4W9RA 5CLFA 2A94A 1SXQA 1OI7A 2FHSA 3FZGA 4GO1A 3I1JA 3EZOA 2HWHA 1NNI1 4OJMX 2NZCA 3Q85A 4Y1FA 4BKUA 5K51A 3V1NA 2AQ4A 3EZUA 3IG1B 4I14A 5KFPA 5C42A 1ZITA 3A6DA 4DFPA 1UP4A 3QG1A 1CULA 1OS5A 4OBEA 5HR5A 1WEZA 4UEOA 5FOTA 2GPTA 4EU0A 1OA0A 1AH2A 1XPRA 1OLXA 5ED4A 2VRCA 4O2BF 3GELA 4ALLA 5I4MA 4B7XA 2FZKB 1JL3A 2NTNA 1K1QA 3IIEA 4Z9BA 2CD9A 2YOFA 3CJQA 5EQFA 4NOMA 5IF9A 1J0EA 3VI3B 1U1GA 1N8KA 5FRDA 2C9DA 3WRYA 3MPYA 2A7XA 3AO0B 2J0SD 5CVDA 5C2JB 3AKYA 1UOEA 3A37A 5BO5A 3RROA 1P27B 3K2YA 2J9FA 3RJ9A 1M34A 5FBHA 5F2KA 4N8OA 4D9IA 1BXGA 4ZLLA 4C6HA 1KEWA 3SE7A 3JQKA 1YMVA 3E1SA 4Q7MB 5AJ3F 4PSAA 1HYEA 4MO9A 2CWKA 3W2WB 3TAUA 2NVUB 4AJ9A 3NBYC 2LW7A 2J32A 4YR0A 4TLRA 3QVWA 3O44A 1JMKC 2QT9A 3B1YA 2ZM6F 1HE3A 1SCDA 2VPXB 4AYWA 1RIIA 3NBMA 1U8SA 4JI1B 1QK3A 3DWEX 1S6YA 5TARA 1PK9A 3BRWD 5LD2C 2ZIWB 3EG5A 4JJAA 2XYHB 3G96A 1AQUA 2V7TA 1ICIA 3ZJTA 3QO9B 2AV6A 4I2QA 1NRKA 2CSXA 4HWOA 5A0YB 4BO9A 2WIJA 1LLQA 4BO1A 4R8MA 2RAVA 1LWCA 4HT3B 1JWLA 1LPMA 2MSSA 3QXHA 5ADVA 2G4CA 4M54A 2NV2B 4Y1RB 3I42A 13PKA 1HWIA 3UT5A 1O89A 1RA7A 2VUSA 5ALHA 3E8XA 4KNVA 2ONKA 1QE0A 3RDPA 1EA7A 3BGDA 2Z6VA 2I29A 4AJEA 4Z9AA 1USVA 1XNJA 4M49A 4CFZA 3C7AA 4MVWA 5E0KB 4Q9JA 5DGAA 2FDCA 2PRKA 1XJ0A 1T0HB 4L07A 2E89A 1KY5A 1OT3A 2ZRLA 2X77A 2EJVA 1KVTA 2HR1A 5AQEA 2OGSA 3GLHB 4XPEA 4U7PB 1BVRA 3W0LB 4Y2MA 5C8ZA 3BBBA 3CJ4A 2NSJA 2J3LA 2EKDA 3EDQB 4TKZA 3OC0A 1Z37A 4WOKA 3H59A 4ED4A 5B1IA 1F5SA 4OXKA 1EU1A 4YV2A 3E5MA 4H7EA 4MP8A 1XD2B 1YWGO 3FHLA 2VSXA 1DKNA 3M4JA 3NH9A 3RFTA 3K2BA 1P4SA 3O2QB 3OCCA 3LUGA 1UVLA 3BK7A 3GFYA 1KDYA 5G4KA 3X2FA 4FR5A 3SYKA 4LMZA 1LSUA 2QFIA 3JWEA 5KFKA 3F1LA 4WXPA 2IYYA 1XNQF 1B4DA 5CH3A 1S2IA 2IJFA 2C59A 3AEKB 3TN7A 3GEBA 3TE7A 2ZUSA 4BXOB 4C7MA 4PO3X 1M8PA 4DRZA 2Y27A 4YR9A 1W7AA 1E5XA 2IOFK 1UMKA 3VR4D 1E9RA 3MJSA 1S97A 2ZWIA 1PJ2A 4I7EA 5DDIP 2AKWB 2JD1A 1KI8A 3C6QA 2V8PA 4DX5A 5AKLA 1FFYA 3OICA 5KJCA 2IODA 5AK3A 3QJJA 2XADA 2F17A 3WK6A 4OYRA 4KDRA 2VBIA 2PAFA 2GO9A 3OFGA 4Y34A 2X3GA 1GRNA 3QUBA 2GV1A 3BGFA 1KXZA 5JD3A 3DTVD 2YNMA 2NO9A 3BXZA 3PI6A 5ALIA 2VDKB 2QYCA 2V2KA 2Q46A 3HXMA 4XDHA 3EMKA 5CB6A 1X0PA 2POCA 3RRKA 3N76A 4YJ2B 3ZBTA 1RYMA 1H1TA 4G1EB 1Q95A 3MUOA 3VR2D 4ECWA 1H73A 2Z09A 5JNRA 1OKKA 3TYXA 2J67A 4XYMA 1HG0A 1SXJA 4DV1F 4L02A 2O7SA 4ROSA 5DZSA 2YHSA 1D1SA 1LDNA 5HIAA 3S2IA 3IMCA 1JJFA 5KYTA 2GN4A 1TL4A 1L3TA 3KT3A 3DE6X 3RQIA 2VCHA 2YXEA 3HS3A 4DIKA 4FMDB 1WMFA 5KTYA 5HRUA 3TNVA 5HQTA 3IEKA 3V7NA 3O21A 4PUOB 4BNDA 4KXLA 1ZPWX 3LWNA 1XZFA 2V9KA 1ISIA 3NI2A 3TOCA 5CFLA 1X5PA 3DRSA 1LOUA 1KQNA 3LPCA 1ROFA 4BQFA 2YFQA 2GZAA 5EWFA 3MT8A 5K0JA 1EHWA 2ZBPA 2QN6B 4RULA 3UV3A 5I5EA 1WXXA 3I01A 3WLFA 2AOTB 2JHPA 2ZQ5A 1ISHA 1V1JA 2H65A 3JSMA 1H9BA 5GAGI 1E0KA 1BOOA 2FSIA 4FLMA 3PXBA 2A9OA 4CMHA 2LCQA 2C5GA 4R54A 2F1JA 2D9PA 1SH3A 1H2HA 3MWLA 5DN6D 2QX7A 3I2KA 5JU6A 2WJ3A 4TTTS 1S7GA 1PFWA 4E3ZA 3V6DB 2FVPA 3QF4A 1XF9A 5JFOA 4TL7A 2ZJ4A 3O5AA 3OR2B 1Z83A 1TZCA 1RYNA 3M8KA 1N5JA 4WFZA 4WZBB 1RHRA 2MQ8A 3BTSA 5EZQA 1NOKA 3FCUB 3MCOA 3H2SA 3FFTA 4R8UB 1TKXA 1TK3A 4PCQA 1XDGA 1WKCA 1AY0A 2B20A 4JQSA 1RWXB 4P38A 3FVTA 2YNMD 2XY4A 4DLPA 3QLVC 1ID1A 1WZNA 3W9IA 4C6AA 4XDCA 3GUCA 5AXAA 3SYTA 1OXTA 3GFTA 4TKMA 3MK31 4WYLA 3RLFA 4H6VA 2DTEA 5EMMA 4G5HA 3HP1A 2DF8A 3RPEA 3OPXA 3HSZA 2PMFA 3BG5A 1UAAA 1TKTB 3E27A 2YH1A 5B58C 2F00A 3O2JA 2VQEJ 5B6IA 1D2EA 4H59A 2IIVA 5KFFA 5A6SA 2HF8A 4JUBA 2HMIA 1VC0A 4X7PA 4PQGA 2QD3A 3A14A 2DU8A 3SZMA 1B0PA 4LJKA 4Q6WA 1JEAA 1P4AA 4HAWA 4JIGA 3KE8A 1RC8A 2ROGA 5FOSA 1XKTA 4WVFA 5LZ9A 2K2WA 1QYRA 4OX6A 2PT6A 2BJ1A 1CJKB 1YJXA 2KXFA 2HHHJ 2DB3A 2X1AA 3CJRA 5D87A 5J5VA 3JQGB 3VUFA 2BFDA 4BHTA 1Y3AA 1Q11A 3ECAA 2JGRA 3FVRA 1GL9B 2VL1A 2ZUBA 4PLTA 4G1CA 3AODA 1X7ZB 1LJUA 2OXIA 4WWHA 4EH1A 4C4WA 1PWHA 3CJ2A 3IT0A 4PXEA 4UFNA 1EE1A 3ISJA 4NLWA 4ZODA 2F3SA 5EUMA 5HXAA 4QBTA 5ITHA 1KRXA 3HYCA 4PF1A 5CX1A 4NEQA 4OB6A 1DUSA 4N82A 4WXMA 1GCOA 2FLVA 1GNTA 1V3ZA 2FZ4A 5A8RA 4Z9FA 1IATA 4DV2J 4ER8A 2B5VA 3EVNA 1OTXA 2PO5A 2WQ7A 6FD1A 3RFVA 3MURP 4HSGA 2WTBA 2F1RA 5DBIA 1OA1A 4A36A 4P4UA 1ORTA 3FKSA 4OQLA 2YPYA 4ND8A 1IJKA 2OTLS 2HQFA 4NASA 5AW9A 4BNKA 2AVDA 5KO2A 2Z8YM 3ZQ6A 1B16A 5ALYA 1T2NA 4ZJYA 3EZ2A 5ITZA 1R7RA 4KLRA 1G5HA 1PW5A 1PILA 4N41A 1VMBA 3VO9A 2W37A 5KU7A 1AGRA 3AKCA 4ENUA 2HQDA 4JQZA 5AICA 4KK3A 1ZFNA 4K4ZA 3W3AD 3SHWA 2D1TA 1GZHB 3D6MA 3DE5X 3FHJA 2VFVA 3K1AB 1UPMB 3T5AA 1TTTA 4D7AA 5EJ4A 5F21A 2H06A 1AB5A 1PR6A 4PYRA 3N8NA 1SC3B 2OLWA 1NYTA 2Z8ZA 4BVGA 5C18A 5MN4A 1PJLA 4EYGA 4CMIA 5L3SA 5F1KA 1KHVA 4PU0A 1L7PA 5DMHA 4RPGA 2XZDA 3SC2A 5ITWA 2IY5B 2WT8A 4I3HA 2O23A 2PVSA 3FKQA 2PR2A 4WN3A 3H13A 4U2CA 5HROB 2B9XA 2VDUE 2R7AA 3QAEA 1DJLA 1WHTA 1KXJA 5GONA 2V8GA 1NDCA 5CZVA 3CVXA 2B43A 4MS3B 4WZBE 2EFCB 1NFFA 4GKBA 2EEYA 2A78A 2QLBA 1GMUA 5K0TA 2I6QA 4CI0B 3J81U 2W8LA 1K66A 5ECDA 3C1AA 3PDNA 1VL1A 1MBZA 4Z9XA 3UV6A 1M54A 6YASA 2V6AA 4RDCA 1OT5A 3PHBE 4DPYA 4FCVA 1UETA 5KYWA 3H90A 2IC3A 3N5CA 1S0NA 4FZVA 2HLNA 2G80A 2NTEA 4BNLA 5IQ6A 3NHBA 2XWYA 1CRQA 4WKCA 1GRCA 3FI0A 4F3RA 5JAUA 1GKLA 4D4MA 1NSAA 3QWUA 3CE8A 4MWEA 4U63A 1Y5NA 5IC6A 1HE8B 2WTMA 3CZRA 4IJWA 1YIDA 2QENA 1JK9B 4KRWA 1XEWY 3QFSA 3D4LA 2ZWOA 3Q8VA 4RPJA 4A2PA 1JXVA 4EG4A 2J9FB 2PUTA 3K1ZA 2IPLA 2NO1A 5KJ6A 5LP1A 4CKWA 4BECA 4XDDA 4YVFA 2HJRA 1GD1O 4ZVVA 4UM9B 1Q0NA 1B1CA 4G37A 4IDEA 4NS4A 3AM1A 1AKUA 1W0KD 3VNVA 4ZVOA 3SQXA 2WKRA 3IXLA 3NBXX 3G9QA 1RYBA 3HUTA 2KKHA 4GQIA 4B7AA 4LFAF 2AC4A 4OKIA 1F7UA 1K8RA 1BIFA 3E0QA 4DN0A 5GVQA 3AKDA 5KT6A 2IU3A 1TUVA 3PDUA 4W63A 2IYSA 2XCAA 1BC6A 1JQEA 1FQOA 2P40A 3GGGA 2VKRA 1TL1B 2X9NA 1S1WB 3PE6A 4MDYA 2PZAA 3OUZA 3OEHA 2OPRB 2HQSA 3OXGA 2RJ3A 5LSOA 3ZPXA 4R0MA 5ADUS 2RC5A 1U8FO 1Z0UA 3M2PA 4XA8A 2WV7A 3KUUA 4PRFA 1IUJA 2RK6A 4KBYA 5FPKA 3NWEA 1SUIA 5BYAA 4BO4A 4GHWA 2WPNA 2I4NA 1MLDA 4X7RA 5H9EK 3FNFA 2C0PA 3CCBA 2DULA 1A71A 3EZ9A 3P6YC 1WHVA 1KVKA 4B74A 2HZCA 4NV3A 3LUAA 4YDSA 1OGJA 1P1CA 3SFGA 3S0JA 2QJWA 2REQB 2ZFUA 2C5LA 2I3DA 2KT5A 1AKWA 1DJPA 1J1UA 3V4SA 2QJOA 3B89A 1E5TA 3JRNA 4OU4A 3UOWA 3W9YA 4EGQA 3BCHA 2E6KA 1NDQA 5K9FA 2JLYA 2GX8A 5KFZA 2W2PA 3OQ6A 3H9BA 2KFZA 5GTDA 1AUOA 4IRCA 4Z49A 1E7MA 2QA4S 3AZOA 2D6FA 4WEOA 3ZHYA 4ENSA 4OA5A 3VPSA 1JLEA 2YN0A 3HV2A 4MCIA 2IWHA 2JI9A 2DNYA 4AJOA 3EPJA 3W7VA 1Z6AA 1X4AA 2H2GA 4QUBA 2OPPA 1BU5A 2Y6VA 5FA8A 5LXTA 5EE3A 4PWWA 1IHOA 4R98A 3H1EA 3B51X 3MEDA 1SL1A 2BUNA 1VQYA 2KQUA 1WD5A 2ZDQA 5LQRA 4NA2A 4YRMA 5JQGB 4LGCA 2CJAA 1C9DB 4JXXA 2DGTA 2I6XA 1XNGA 4DV6B 1BYUA 4CTAA 2L0XA 1NYQA 1UP7A 2JDJA 4BNGA 4DVGA 4L6CA 2H29A 3TI7A 3MILA 5JARA 3QEJA 2R2UA 3QKIA 2VOOA 1SOAA 4BNXA 4H3VA 3C7CB 2ZDGA 3OX1A 2NU9B 3Q86A 2FJXA 1RFGE 1GZ3A 4NBKA 2B7BA 4BMCA 1ITPA 1WI6A 3UW1A 1H8HA 4AUKA 2G1UA 1W9MA 1A4XA 4JJ4A 1SU4A 2OGTA 1FRLA 3QU9A 2NT4A 4PHCA 4E15A 1JLQB 4DG5A 4CMEC 1GOTA 2W6JD 2ZJFA 1NKTA 3R6GA 1NF3A 5AJXA 4B3TB 2OK7A 3DBOB 1T26A 1P1RA 3JASB 4F4ZA 3I34X 3D6FA 3KOZA 1YJUA 3A9UA 1MW7A 4A4JA 4A8FA 2RAQA 1RT5B 1GSAA 2DIVA 4BBYA 4KIUA 5AHKA 1YR8A 1VE3A 3HSSA 1UKAA 3JQAA 3JQ9A 4H7DA 2OZEA 3CEAA 4QJ4A 1WPXA 3JAMY 5BN4B 2DGSA 3KJGA 3LBHA 5A3SA 4ND8B 2C7GA 4YLGA 1QHFA 1QHHA 2FZVA 1G8HA 1IHUA 2DM6A 2A9KA 4NICA 3QUSA 4DIUA 3I5CA 3T7EA 1D9FA 3V3KA 1H66A 1GFWB 3GFXA 2J7KA 3OLXA 4GKKJ 1KJYA 5KFJA 4JB8B 1SIZA 3QMMA 4K6GA 3LQVA 4DV2F 2AFIA 4ARUA 3I0MA 5KYWB 1A8UA 2H5JB 2FZLA 1YCFA 2YHIB 3HCDA 5AVVA 1TIKA 1VCTA 3STHA 2NQ2C 3L9XA 5DN9A 2VPPA 5ERYA 4YRRA 1SQFA 4Q9IA 3WGGA 4C0SA 3LFUA 2HRQA 1P33A 2FZEA 2GAJA 3ZNUA 3KWLA 3UANA 5DTRA 1R0LA 1ZNYA 3I9V6 3G0IA 1G7SA 2ZJ0A 2QZJA 5JEDA 1V7PC 1EETB 5ADZA 1REGX 4IR7A 3ECSA 2WAYA 1ADYA 4UU7A 3SDZA 3DNCA 3PIOQ 2CLCX 4I2VA 2PBRA 3R5XA 1H65A 2OPSA 4QTZA 3WNVA 1JHYA 4OOFA 1NCLA 1I80A 5JJBA 2C4WA 4DQQA 1AK1A 1YS7A 3CULA 1MJGA 3AM3A 1RTHB 1UJ5A 1YHQS 4G1MB 1NRWA 3UQYS 3OESA 1XUOA 1JKIA 1IWAA 1TLTA 2P4HX 4B9EA 4CODB 2FI1A 2JAQA 3E2EA 4HDNA 3TNFA 4M3NA 3M6UA 1RWQA 4NYIQ 1N6QB 1QIEA 3ETNA 4V0RA 4K5SA 5CH7B 4DR5B 2GCGA 1XOIA 1VQOS 5I7EA 3R8XA 1Y33E 3BDEA 1Y6JA 4Q7EA 2V4JB 3IM9A 4P4SA 1PGPA 2Q6IA 3S5JA 4DL0C 1BCRB 5IAOA 3AHCA 4OHVA 1TM3E 5DW3A 3ABQB 5CJJA 4O2AF 3I0NA 2EF0A 2QAJA 5F1OA 1GCUA 1K5PA 2CLMB 5IHPA 3OU7A 3TVZA 2OCDA 1KHTA 2HA5A 4JI4J 1W1UA 2IZ1A 1ADJA 3T3HA 2HURA 4DI6A 3LLMA 3PEFA 2G6BA 3G7NA 3UK6A 1YL5A 3Q9NA 3FWZA 3R6TA 4L9AA 1C4OA 2PGNA 1ZM9A 1NM2A 1P81A 3AD8C 4IVQA 1GDHA 4B2PA 5BYKA 3UQSA 1Y9DA 3P9RA 4NLYA 2OSQA 5FPTA 1NN0A 3FWKA 4U8YA 2ZYIA 1FRMA 4PXCA 3ZXSA 4G65A 4FDLA 2FRDC 3B6JA 4FD2A 4LRYA 2OZLA 4RMHA 1ZM7A 1FA9A 4PPQA 5BR1A 2MIIA 1Z1ZA 3BA6A 4ZYUA 1XR5A 1A77A 1P0CA 3RVPA 4DLGA 5FR2A 3SJZA 3WLEA 2KHDA 3AWIA 2WTUA 4RESA 2X8JA 4P35A 3TR5A 4GVXA 3L1VA 1CR4A 4YRZA 4MUIA 4ZCKA 1HDGO 1K68A 5IFMA 5CM9C 1SVLA 3HJUA 1W4AA 2VTKA 3CGWA 3D8HA 2WVJA 4B3XA 1R8HA 2JRLA 3I6YA 5L1IA 4DV1B 1FRFS 3MWEB 4HFRA 1LSJA 3QLHB 3GCGA 3FGOA 2PUAA 2O8NA 2JAXA 1NK9A 4PQUA 1AF7A 2C2YA 4DLXA 5HS6A 3PXAA 2RKIA 1EVZA 3KKLA 4ZTBA 2WJPA 2E5IA 3HXTA 1PDVA 4R0VA 3HWWA 1OU4A 4MDFA 1KKLA 3D4IA 1V5WA 1ODLA 3OE4A 2IS6A 1GNPA 5FL7D 2WKPA 4DRXB 4LF8J 2HFOA 1WB4A 1IBKJ 4MITA 4CFYA 2Q0XA 1HWYA 4URVR 4NZ6A 4Q8EA 2GKOA 4UTZA 1UA1A 1U2GA 1KETA 3ZZ1A 3ILHA 1RIFA 3ZIDA 4RZIA 1U2TA 3OTDA 4LIRA 3DOMB 4ECAA 1ZHHA 3G2LA 2RI6A 2QTVB 4HZIA 4JC8A 4BKRA 3F6EX 5LA6F 4BMZA 1ISGA 3PLRA 4X00A 5K8IA 4ZEXA 2OTJS 2GHWA 3T5GA 5KNBD 1OXMA 3BXFA 4RK5A 3UXHA 2OYCA 1K98A 4AFNA 4NJOA 1XRLA 1FDAA 3QJ5A 3P9XA 3RS8A 1UZDA 2J5KA 2EBUA 3WL8A 2XE7A 1PL6A 2J48A 2M9KA 3TTTA 1VISA 4AY6A 3GLRA 1LDEA 1NN3A 1VQ8S 3BMCA 1CQZA 2YQZA 1PKEA 1DQPA 1EUCA 5TPWB 3MMAA 1U0HA 1PHRA 1KBOA 2Q79A 4FQ5A 5EGSA 5AUQA 2GAAA 3DG9A 4URWR 1RTTA 1TVRB 3SI7A 3HNRA 5BUQA 1WV0A 2XWJI 2J6CA 3Q6IA 3BQ9A 3W6PA 3DE7X 4JKYA 5KHAA 2NVWA 4EGCB 2V55B 3C7KA 4RIHA 2OEMA 3G68A 4PPNA 2PH7A 4N0PA 5IM0A 1EB8A 1M5OC 4P93A 3DEFA 4NMLA 2VPQA 4P3KA 3HKBA 3ZU2A 5C81A 2L18A 2JEZA 1T91A 2AWZA 3MLBA 3NVDA 4I1PA 3ADCA 5I7HA 3CWCA 5D6NA 3PDCA 2VC1A 4QXQA 2ZH4A 2AE1A 3L0CA 2WBLC 3ABSB 3DOOA 1ZUIA 1YI8A 2BRKA 5B1DA 2D1FA 3CCCA 5JIBA 1XMVA 3R5TA 1R6BX 2H1IA 4FPXA 2FGJA 4M6WA 1XX6A 3D1OA 4WZAA 1D09B 4QQKA 4NFSA 1DOZA 2COKA 2BFWA 2PRIA 2RH4A 2WU8A 3BF7A 4MEJA 3TZQA 4GYYA 1OV4A 1WACA 5EZYB 3OQVA 3USES 1I14A 5AKEA 4FFMA 5FCDA 5TVKA 5KREA 3ODGA 2F1IA 4YB5A 2QSYA 5EYPB 1OASA 3I2GA 4L8LA 3IGFA 1LY1A 1TEXA 3L79A 1D9DA 5KC9A 3QEBZ 2RGGA 1SPBP 4ZPWR 2VG5B 2AIRA 4QFBA 3VYRB 1JI0A 2CNNA 1ZU4A 4ZTZB 1SBNE 3MPWA 1I0ZA 3PC4A 3UGJA 3W7AA 3V00A 2YOHA 2V0GA 4REOA 1YL7A 1MQSA 5GMOA 2WIBA 2OBYA 1GADO 3KTAA 3JWPA 3UPDA 3PNMA 2ZROA 2N3OA 2EDAA 4KKOB 1XKLA 2WM8A 4N49A 4DCMA 3GVPA 2V8DA 2JI8A 3C8YA 3RRFA 4OMFG 3OZCA 1F9AA 4Y9SA 3OBBA 1B73A 2G82A 2A5LA 2R2AA 3WDMA 1T3TA 4AWXA 1YJNS 3DOIA 1RZRD 3U9TA 3HA5A 3F78A 3GSIA 1DFIA 3ASUA 3WR5A 1RVV1 4HQ0A 4UZBA 2OO7A 3VSEA 2MKYA 4C30A 4YRAA 4D92A 4EAAA 2IPXA 3FOAA 5MDHA 3QGIA 3Q7IA 3R27A 3GZNB 1SHUX 5IXYA 4LF4J 3MJFA 1DBPA 3T4XA 1QHNA 4CM2A 1ZAXA 1RLIA 1U0HC 4QE3A 4EUKA 1Q1GA 3BPSP 2VSYA 2VNKA 2CNWA 2J8SA 4MUNA 1XHEA 3K16A 1TJNA 4BDSA 5GADl 1F38A 3REQB 5KCZA 2DBRA 1TAGA 2JLGA 1ORVA 3MCUA 1U80A 1EZ4A 3TSZA 1V8FA 2Z98A 4I55A 3ND8A 2QX6A 5FL7A 1FFWB 1T03B 4PWDA 1OW3B 3S8SA 2GBPA 4DR1B 3HMQA 1UPPA 4IOMA 4HNGA 3FNRA 1JZTA 4AKIA 1SUDA 5K8MA 3KLEB 5CHEA 5DEOA 3AVUA 2AEMA 1JXMA 2CFOA 2DIUA 4KVAA 1E9CA 4A2CA 4LK2A 2WVFA 2AH5A 3FNQA 1HQKA 4MYCA 2MQQA 4OJYA 3WC4A 5MGBA 3EZNA 1UQTA 1UWBA 5EMNA 2IRUA 4EABA 2BJ7A 1U0JA 4CM0A 1E6CA 1WPQA 1TW3A 3FVWA 3EARA 1HQYE 1SC6A 3KP1A 2NZVG 4QQRA 3EH2A 1R4NA 1U0HB 3PDHA 3NLLA 2Y1KA 1R4AA 4M8LA 4OHKA 2QGZA 3QW2A 4P2BA 4UMEA 5B0GA 1FXRA 4OJGA 3COPA 4TL8A 5IDVA 4LF6B 4OAOA 1X7HA 3WGHA 1JB1A 5IMBA 1IR2A 2CQ1A 4X95A 3OIWA 3X0DA 4P7JA 2L41A 3VR5D 3NGXA 4Y3CA 3MC1A 2VFSA 2W9AA 5K99A 3AM4A 3DKIA 4HDMB 2JFFA 5IN5A 4KKVA 1XRQA 3ZCVA 4B3MJ 3DV2A 4U2GA 3QBJA 4EKIA 4DWWA 3IODA 5G0RA 1NMEA 4HS4A 3HXPA 2VBYA 1FVXA 1MG5A 4CLOB 3G6XA 4E70A 5C8XA 5KYVA 2H5EA 2DY1A 2HT6A 1B0TA 3ZTRA 4L9WA 3TZXA 2Y1RI 3HSJA 5E9JA 1VQMS 4H7JA 4X1OA 3BO3A 5DWDA 3V8RA 3H6KA 3N6MA 4RAQA 1W49A 4XGQA 3D6VA 4OGLA 4MPRA 3G0HA 1D0SA 4WTOB 3OOWA 4IS3A 1VB3A 3HN6A 1CNFA 5TEVA 4QIGA 1GXSB 4G0XA 3IV9A 2GCOB 1NT4A 4FDTA 4EUHA 3EXIA 3IHLA 3L0OA 4GZMA 1QZUA 5MN6A 3QOXA 1MOZA 3AUTA 3EIHA 1L4LA 5CCDA 1OXKB 3FGZA 5KU1A 5DSZA 4MAAA 5F1YA 2G13A 5FAXA 4O44A 3HFSA 2ZITA 1IONA 3H1TA 1DQZA 2GPSA 4NV0A 4JV0A 5L1JA 3AF4A 2PD3A 1SUBA 4AO7A 2Z0MA 4ZVEA 1PQYA 5IM0B 5IUNC 4OLFA 1YJ5A 4DTCA 1E9VA 4KMSA 2VDPB 4CJXA 3OL6A 4HVAA 3MWJA 2CNNB 3I0RB 1D0EA 1AQYA 1N7IA 1IK4A 4UZEA 1SB8A 3L8DA 4OK5A 3OE7A 2QIFA 3WE7A 3HKEB 3N7UA 3ZC4A 5AXMA 3CBQA 1DAHA 2YHAA 3B85A 1N3BA 5AM1A 1REQA 2GBFA 4MRNA 2PYDA 3D7NA 3ETCA 1DQ8A 4KQEA 2JLUA 5J4YA 3BXEA 5A2QU 3V7FA 5JSQA 3FKBA 1RJDA 1SVMA 2F3RA 1HNWJ 5CJPA 1Y63A 3NTLA 1WUIS 2GJAA 4Z7CA 3B7PA 2WOMB 3MDFA 2WEKA 5G41A 1QE5A 5DCUA 4K2JA 1TZKA 5CA0A 3WJ1A 5IBCA 2QUIA 1IZYA 4UHKA 4JP5A 2B4KA 2AYYA 3OJ0A 4CDNA 3TOZA 1LFDB 4PVDA 1H93A 1IVZA 1KR2A 3LF0A 5GV8A 4EDHA 2X7JA 4NE2A 4F2PA 2IS2A 1ETHA 1X38A 3MM7B 3U49A 2E1MC 2QRVB 4ZWNA 1E6YB 1EIZA 5JNVA 1ZBQA 3P3DA 2ADBA 4DL7A 3R20A 4IGEA 2XGMA 2AMVA 4DMRA 4OJNA 1VSBA 2B1JA 1X8JA 2IWRA 1PX0A 1OOEA 1VSUA 2HLPA 3U2QA 1WKVA 3JQ6A 2B69A 4Y6PA 2ACMA 5A1TA 3KKFA 2FSSA 1YQTA 4LVNP 2NZWA 3R75A 1HMYA 2RCYA 2P9FA 3QIPB 5FFMA 3JV7A 3MMSA 3Q3IA 4ZPDA 3OLZA 3AFIA 4MV0A 1TZJA 2CXPA 1J97A 4DKJA 1D5WA 4KY3A 1XB2A 3W2VB 4I9NA 3SSNA 4O3OA 2OMKA 2R7MA 1RCFA 4DE5A 2DSTA 3UMFA 1KI3A 1UIMA 3GVCA 2MMGA 3DAYA 1OYDA 4B3IA 3JD4A 1A9ZA 4AQYJ 1VYAA 3NPAA 1NQWA 3G82B 3TAXA 4YJGA 3SEOA 1X9SA 2RARA 1I1OA 3I2FA 5F3TA 4HDKA 1OLXB 4IUYA 5A04A 2P0EA 3INRA 3DWFA 4E22A 4CYMA 4HAXA 4OZNA 1WCXA 3M34A 1KJQA 4CMIB 2ZUAA 1S3IA 3QRRA 2IHKA 3O31A 3GCXA 1O0CA 4QXRA 1H5UA 2VP0A 2PUDA 3HGTA 1L1FA 3IVMA 2XMKA 1X39A 1YBMA 2ZH9A 3GFQA 4MWCA 2XUOA 2BQUA 1QRAA 3W2FA 2HBRB 1BXKA 1WQ1R 3E3MA 5JXSA 1YG0A 1JHVA 4HBGA 3T38A 3UB3A 1AV6A 3EX7B 1OH5A 3MM9B 3C46A 3ICVA 5BR7A 2X40A 2AK2A 3LC2O 2WSSA 4RHEA 5REQA 4YWJA 1NVBA 1NUAA 1VJQA 5AHRA 3EC7A 3N2ZB 4DILA 4ZP1A 3QJLA 2F1KA 2EFVA 1F0NA 2K1RB 2HUNA 2DCMA 4ASUD 3IT3A 2YNGA 4Q24A 4HAOA 2D3UA 1L5VA 4X65B 3VKVA 1SR8A 4N0MA 4OATA 2QE5A 3CNHA 4TWIA 4Z6KA 1T3LA 5ETTA 2OIHA 3O82A 3D0RA 2WJYA 5B0FA 4LF9B 2HA3A 2DWQA 5MFZA 2PGJA 5JAIA 3FCHA 4CH0S 2WE8A 4K7QA 1YK9A 1Y8QA 2PLFA 2FIUA 4NJEB 5DI3A 2IBMA 2JIPA 2AKYA 2WJ4A 3IE2A 2CLEB 1J8VA 4BKQA 4D46A 2J9GA 2ATEA 1CJCA 4XIFA 4TYNA 1Y3HA 1UWVA 5A5EA 3VHXA 1HNXB 1VHIA 1QKKA 2YJ4A 4RDIA 3UXYA 5CNIA 3LRTA 2CQDA 2M7SA 5JO9A 4NKRA 2VOJA 1W93A 2FOXA 1F0KA 3FPSA 2K4MA 5TF0A 4J0QA 2WHYA 3IYLW 1W4RA 3BAFA 3M33A 3TBFA 4NAHA 3H9CA 1UMJA 1SG0A 4Q7LA 4OL0A 1AJEA 3QIDA 3K70D 2C28A 1T9GR 1RKUA 5J1TB 3FQKA 2MYFA 4M36A 4F6CA 2KXHA 3DW3X 2F4VJ 2OL4A 4KQIA 4LV8B 4CNZA 5HFAA 4X8MA 1PEYA 4M21A 3ZE9A 1JDUA 1T2UA 1BVYF 3WLTA 2M5YA 3MAHA 1B2RA 1KQFB 1U0LA 4OHXA 3NS5A 2WNHA 4FF2A 1R8SA 4JLWA 1XTUA 1JEYB 3DS8A 1S49A 3IPAA 2D8AA 1WY5A 3J7AN 2LQ8A 4FHGA 2OAQ1 4A2WA 3KWFA 1TCBA 3CONA 2A1UA 3AVPA 2LVBA 5LQMA 2M1XA 2EGHA 2QEXS 2WYOA 2X8AA 2GD2A 5K6AA 4V19X 3IS3A 2C84A 5K6TA 4WU3A 4QU5A 5JSHA 5JNLA 3WX8A 2H9ZA 2AW0A 1DBWA 2B3TA 4YJGB 5DHTA 5A8WA 4GT1A 3E15A 4BO8A 4EMDA 4P54A 2VSQA 4DBLC 2VONA 3EPRA 3NC4A 3ASZA 2QU7A 2WHQA 1U9YA 1OIAA 1HRKA 2IMOA 2RHJA 5KUTA 2H4WB 5EKUA 3D5EA 3POTA 3LT4A 2GN9A 3OX4A 2KXNB 1E92A 4BGEA 4OYPA 1VLVA 3KJFB 4KITB 1BE8A 2DHAA 4TN1A 2BM9A 4DIOA 2Q9AA 3NJ8A 2BMWA 5H4GA 3HA3A 3V81A 1FKOA 4KB5A 3RBEA 1C9JA 4TKVB 5D4NA 1FWKA 4KO2S 1YBUA 4IDAA 1GDDA 4JEHA 1P1HA 2HNYA 1QUEA 1HQ2A 1GPLA 1OFVA 3OW2R 1ZH0A 2JFGA 1XEXA 4YDXA 4EPYA 3GB0A 4OV6A 4P7BA 1YA8A 4MW1A 4W1QA 2CNKB 2DZDA 2O2HA 3DGEC 3QPDA 3AW8A 3EXIB 3KJVB 4B2LA 2QP9X 1JG2A 1SKYE 3GCWP 4MKYA 4HAUA 4J29A 4PG4A 5EXPA 4GZ5A 1F3VA 2HZ7A 5BNTA 4AZ3B 1H2TZ 5CG2A 5JNWA 3V4RA 1P1BA 2A5GA 2AGPA 2FUNB 2XRFA 3I9MA 2VNJA 5FBRB 2F9FA 1H1LB 2CBGA 2PY6A 2CUYA 4Y9RA 2PWZA 4BDTA 3EMTA 1L5HB 5ETNA 2O3UA 5JHGB 4D26A 3I0SA 4RX1A 5C0OE 4FXOA 4OJQA 2QZSA 1JEJA 2C3MA 3H2VE 3RTGA 4EG0A 3RSSA 1DGQA 2HRDA 3EHDA 3O1HB 2YKNB 3AL0C 3HXKA 1H2VZ 3ETLA 4QTUB 4IDCA 1GA6A 1ZEMA 3ZI7A 1CZHA 1FJEB 3RJTA 4PCAA 5BV0A 3MJHA 4I6AA 1I5RA 4JVMA 1X7XB 1UOPA 5T8KC 1GQSA 3P96A 5F52A 1MHPA 3H9JA 5TQ2A 3ZW9A 3IBWA 3ICQB 1I51A 3GJQB 3QSIA 3UPFA 5JQWA 1QK5A 4RD3A 3FKJA 2Z30A 4E33A 2AL7A 2P9JA 1CJUA 2XXAA 3HACA 1R74A 3K8ZA 3RK0A 1DL5A 4C0JA 1QCZA 4HHHA 3F9CA 1AZSB 1T13A 2XCQA 2R6R1 3ZQ4A 1K73T 2RGEA 3E5RA 1DO2A 2RG7A 4M1WA 3AF3A 5CA1F 4GBGA 3OMWA 2KHCA 4ACAA 1JJ2R 2V4QA 1V2GA 2HADA 2PT5A 2WNSA 2OHXA 4FKBA 4NDZA 4IIGA 4OYXA 5FD1A 4LTMA 4QIVA 4MKBA 3C6KA 4YI3A 2X2FA 4RJIA 3LO5A 1ABEA 3DYIA 1H4SA 1DADA 4FSDA 2ZWAA 1XCJA 2NO7A 2W6ZA 4JS0A 3AU8A 1FHTA 4CUJA 1JB0C 1RR6A 4QJBA 3PNIA 1T05A 3DDWA 2JLRA 1T6ZA 4LBIA 4LF8F 1KMHB 2PZBA 3M81A 4C3UA 4MVJA 2BHNA 5HIIA 1DX6A 1UK6A 1YQUA 2WZQA 5IJWA 3HZGA 1VLZA 1BMFD 4V3BA 2DEUA 3IT2A 4J03A 3A4YA 3DZBA 2H4FA 1R43A 3N8DA 1QSGA 3FN4A 2R60A 4BTLA 3ENZA 5J40A 3Q8XB 2QNIA 3GQBB 4BWGA 4ZQHA 3W5IA 3FCCA 4B6GA 5LP6C 2ZS8A 4KVZA 3RNOA 3GIWA 2DRIA 1Z17A 2JFWA 1NNLA 3H9QA 1QG2A 3VDRA 5GZ1A 2QLJB 3MNFA 4DL2A 4RBNA 2ZEJA 2ZH3A 4FNAA 4O2BB 5DYGA 1TM2A 4ZOBA 5TMEA 2ZZMA 2CNOA 3JSXA 1ICEA 3O1LA 3OJFA 2Q9BA 3F6CA 1HV8A 2VNHA 4B35A 5A02A 3R3WA 3DEKA 5BMVB 4MTCA 1ZUHA 2H3EB 3AHGA 4TWAA 3W04A 2GN0A 1PL7A 3WOHA 1PDOA 2VZLA 5I8ZA 2C3PA 4F4XA 1H3NA 1L4KA 3ZTPA 2MGZA 2BD0A 3P9KA 2ID4A 3ZVRA 2A10A 5KSYA 5KFIA 1N9GA 3FYCA 2I8LA 3T7CA 4LF7J 1CEQA 4JYMA 2Z3VA 3RIHA 1Z6PA 3KSAC 5J1EB 4LF4B 1ZG3A 2MKCA 4X4NA 1I30A 1OJ7A 3A9WA 1QOZA 2FHOB 2PM8A 3GIMA 3NKLA 2J3EA 2NTYC 4RTMA 5ENZA 3WMRA 3ISTA 2A0WA 4OFBA 4FIDA 3SHVA 3HR4A 3DOUA 3SEZA 3S4YA 2KWIA 2DE0X 3SLRA 1IY9A 5ALGA 1VKZA 5K3EA 4KFBB 2I7CA 2MXYA 2HRYA 4LRTB 1K8QA