4ATNA

Crystal structure of c2498 2'-o-ribose methyltransferase rlmm from escherichia coli
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
357
structure length
356
Chain Sequence
MNKVVLLCRPGFEKECAAEITDKAGQREIFGFARVKENAGYVIYECYQPDDGDKLIRELPFSSLIFARQWFVVGELLQHLPPEDRITPIVGMLQGVVEKGGELRVEVADTNESKELLKFCRKFTVPLRAALRDAGVLANYETPKRPVVHVFFIAPGCYTGYSYSNNNSPFYMGIPRLKFPADAPSRSTLKLEEAFHVFIPADEWDERLANGMWAVDLGACPGGWTYQLVKRNMWVYSVDNGPMAQSLMDTGQVTWLREDGFKFRPTRSNISWMVCDMVEKPAKVAALMAQWLVNGWCRETIFNLKLPMKKRYEEVSHNLAYIQAQLDEHGINAQIQARQLYHDREEVTVHVRRIWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Rlmm, the 2'O-Ribose Methyltransferase for C2498 of Escherichia Coli 23S Rrna.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords RIBOSOMAL RNA LARGE SUBUNIT METHYLTRANSFERASE M
total genus 117
structure length 356
sequence length 357
ec nomenclature ec 2.1.1.186: 23S rRNA (cytidine(2498)-2'-O)-methyltransferase.
pdb deposition date 2012-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01728 FtsJ FtsJ-like methyltransferase
A PF18125 RlmM_FDX RlmM ferredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2810 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4atnA01
3.30.2300.20 Alpha Beta 2-Layer Sandwich THUMP fold THUMP fold 4atnA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4atnA03
5K0EA 4OBXA 1QANA 5LQRA 3MERA 4PGGA 3PLAE 3A26A 1PJZA 5EMKA 5GM1A 4PYOA 4PYNA 2UYCA 4X61A 5K03A 2P3QA 3G7UA 1NBIA 3BKXA 4EQZA 3GRUA 4HH4A 3T7SA 3THRA 5KYGA 1G6Q1 1XTPA 4AZTA 1JQ3A 4QQNA 1R8YA 3B5IA 3K0BA 2ZBPA 3BGIA 3C3PA 3M4XA 3T7RA 2JHPA 2VDVE 4RTRA 1EQAA 2AN3A 2YXDA 3CJRA 1DUSA 4V0QA 3R3HA 3SM3A 5T6BA 2PLWA 3A25A 3EMDA 2XVMA 3OU2A 2IDKA 5LQNA 2BH2A 2G72A 2LD4A 5FULA 3UBTA 5EOVA 2PGXA 1N7IA 3EVGA 5ICGA 1M6EX 2XYQA 1FJXA 1WZNA 4OX9Y 1JR4A 3HP7A 1G8SA 4G56A 4OQDA 5GWXA 4RYLA 3ANXA 3MTIA 3TKYA 4CKCA 1QAMA 3P9CA 5E1DA 3HCEA 1L3BA 3HA7A 3R0QA 1JQDA 2GAFA 5DTQA 5KQRA 3A4TA 2H11A 2FK8A 4RX1A 2GH1A 3P8ZA 1RI1A 3ELYA 5EGSA 1NW6A 3DUWA 3FPFA 3GCZA 1EG2A 3HCCA 4E2ZA 2P3OA 3MCTA 2PJDA 4P58A 5BW4A 4NECA 4CWAA 1KXZA 4FR0A 5F2OA 7MHTA 3EVFA 2DULA 5LQCA 4X1OA 4E32A 3KQTA 4WVLA 4DQ0A 3OE5A 2NXJA 2ZW9A 1Q0SA 2ORED 3CGGA 5E9WA 3TFWA 3HVJA 3E05A 2PWPA 5KQSA 3ER8A 4XUEA 3GXOA 5IH3A 2AVDA 1H1DA 2PKWA 1M6YA 3AWIA 4BLVA 4PYJA 5D1HA 1QZZA 1V39A 4C05A 2OO3A 4RVGA 2IBSA 4YUZA 5BP7A 5K0JA 2IH4A 4PYIA 3BWYA 5GM2A 2B9EA 3DMFA 2C7PA 1X1CA 1XCJA 3GRVA 1EJ6A 2O0LA 5CIYA 1RI3A 4GBED 1VPTA 1NE2A 5E8JA 3VSEA 4Y30A 2ZVJA 3EPPA 3RIEA 3KKZA 3S68A 3AJDA 3G8AA 2ERCA 5CD1A 4V0RA 2ZWVA 5ICCA 4BP3A 2HR1A 1NW5A 2YQZA 4DF3A 4M36A 5DXJA 3TRKA 5CCBA 2G8NA 3I53A 3P2IA 1AQJA 3VC2A 5KVAA 3G2QA 4C04A 3UA3A 4FT2A 2WA1A 4EVIA 3QOWA 5FWDA 2QYOA 3BUSA 3KQYA 4RVDA 3NVMB 2AS0A 2QRVB 2JH9A 1IXKA 5FUBA 1KYWA 3OFJA 5CVEA 5JR3A 5M5BA 2P7IA 2YUIA 3G89A 3UJAA 4POOA 3KU1A 5DPMA 2YXEA 4P7KA 4MWZA 5ERGB 3KPVA 3TKAA 3HVIA 3G5LA 1SKMA 1ZG3A 3SMQA 2VDWA 3I64A 3FTDA 5GOZA 5EPEA 5EMMA 2I9KA 4RTMA 2ZLBA 4RTSA 1NV9A 3VYWA 4BP1A 5DRYA 2ONYA 1TPYA 3I5UA 3R6TA 4GOOD 5EIFA 1G55A 3M70A 1P91A 3DXYA 4P7FA 4CTJA 3GRRA 3SX0A 8MHTA 2I7CA 4PYLA 1VQ1A 3PB3A 1JSXA 4AZWA 1FPQA 3KPUA 4YV1A 1YZHA 3FPGA 3C6MA 2Z6QA 3NW9A 1RJDA 4BY9E 5DX8A 3Q7EA 4LG1A 2OYRA 4ER3A 1F38A 1UIRA 3SGLA 5LQJA 2CWWA 2PX8A 5FHRA 3UJ7A 3OPNA 2PBFA 2IH2A 4KIFA 3MTEA 3TM5A 3JWJA 3IV6A 3OZRA 4HTFA 5GINE 2YXLA 3LPMA 1RI5A 1X1AA 2FK7A 3D2LA 4FS8A 4QTTB 5E1OA 2Z6AA 3P9KA 4C4AA 1ZGAA 3KPJA 3EGVA 1WXXA 4RTOA 1YF3A 5EQJB 3NMUF 3IHTA 3V8VA 4E33A 4GQBA 5DM0A 4IV0A 3UFBA 3THSA 4C07A 4PCAA 4LWOA 5CVUA 4F84A 1UFKA 2EJTA 3UZUA 3FRHA 4R6WA 4E31A 2UYOA 2VS1A 2HV9A 3KR0A 1G60A 1R6AA 1VP3A 5K0CA 4B17A 1X1BA 3EVAA 3OFKA 4GF5A 4O29A 5LSAA 3G2PA 3O7WA 3RW9A 5HIJA 5HOQA 3KR1A 1EAMA 1X19A 2E5WA 3MCZA 2OZVA 1NW3A 2O05A 3MGGA 3HCAA 4MIKA 4RSRA 3H2BA 3LCVB 5FQNA 3BXOA 2Y1XA 1AQIA 1UWVA 3ELDA 4RVHA 5EEGA 5KS2A 3MB5A 3U81A 4ER6A 2AOUA 4PGHA 3I9FA 2BZGA 5HFJA 1SUSA 3PFGA 3GRZA 4CKEA 2NP7A 4C08A 5LR6A 4AZSA 3FUVA 2ZIGA 3A7EA 5C1IA 4WXHA 2OB1A 5K0GA 4PONA 1RI2A 2FRXA 3B3GA 3EEYA 3RODA 2Q41A 3SVZA 1JG3A 1SQGA 5CM2Z 4X41A 3DXZA 2NXNA 2CMGA 3KQMA 3LBYA 1KPIA 5EZSA 2FHPA 5K0LA 4E30A 4EK9A 4KRGA 2OKCA 4BLUA 5ICEA 2OPBA 2PSSA 1NW7A 3QOXA 3X0DA 3PFHA 1XDUA 4DA4A 1ORHA 5GP1A 3CCFA 4C06A 2XBMA 1I4WA 1JSZA 3KR2A 2AVNA 1M0EA 3KHKA 4R8SA 5DM1A 3C3YA 3UA4A 1I9GA 1DL5A 1NBHA 3IYLW 5EVJA 5F2KA 1YFJA 3M6XA 5HIIA 3CVOA 4EKIA 3PS9A 5E8RA 3EMBA 3M33A 1D2GA 2BR4A 2IFTA 3AY0A 3BWBA 4KVZA 1NKVA 4A6EA 1XJ5A 3GWZA 1BOOA 1RI4A 4RTQA 3LHDA 4JXJA 3WSTA 4DKJA 1KPGA 1YUBA 1ZKDA 4QDKA 5EG5A 1ORIA 5LQAA 2JG3A 4MQ4A 5LQKA 2NXEA 5EMLA 3FZGA 5GIPE 4PYKA 3BT7A 3HM2A 1XXLA 2NYUA 2AOXA 1WXWA 3P2KA 4L7VA 4AX8A 4ER5A 4MTLA 3O31A 1ZGJA 2WA2A 3CJQA 2ZBRA 3FUTA 2P3LA 3LBFA 3TQSA 4GC5A 1F3LA 2AN5A 3PVCA 3IEIA 5FTWA 2O57A 2ZWAA 3GO4A 5K0FA 3CJTA 3GU3A 1YB2A 3JWIA 1P1CA 3M6UA 3V97A 1JQEA 3UJDA 1WS6A 1BHJA 1AV6A 2C7OA 3LCCA 1O9GA 3EGIA 2OY0A 3EVDA 4P7GA 2PT9A 4QTUB 4ISCA 5HZMA 2EJUA 3R24A 3TMAA 2N47A 4BLWA 3DMGA 4FSDA 4A6DA 2XVAA 3DXXA 3AXTA 1G38A 3BWCA 3LDGA 4IWNA 4R05A 2AOTA 4E2YA 2C7RA 5K0NA 2ZTHA 2IPXA 3ORHA 1KYZA 5E9JA 4HC4A 3GGDA 5H02A 5DX0A 5EHGA 4KDRA 1RJFA 3BGVA 4ER0A 3B7PA 1TW3A 4Z2YA 2YTZA 1L1EA 2P1DA 3A7DA 4QVGA 3CC8A 1FP1D 2O06A 2KW5A 5HEKA 4HSGA 4QPPA 4P7JA 1G8AA 3K6RA 2GLUA 3UJBA 1R8XA 2P7HA 1EJ0A 1IY9A 2B25A 4FGZA 2QRVA 5FHQA 5FA5A 3UJ9A 4EKGA 1L9KA 2EG5A 3HEMA 4HGYA 4H0NA 3ER9A 3GIWA 3HCBA 1JG2A 3DH0A 5EHIA 1VLMA 3FUWA 4ZTBA 3KR9A 1TW2A 2ZBQA 5CCXA 1PRYA 5GIOE 1YFLA 2G1PA 4PIPA 2BM9A 5C9ZA 4OBWA 3MQ2A 4M37A 4KW7A 2UYQA 4GOND 5FQOA 1VE3A 2AR0A 2GB4A 1BKYA 2PV0A 3EVBA 4XUCA 1KR5A 4E2XA 5T64A 5FCDA 9MHTA 1QAOA 1AF7A 4PNEA 1VBFA 3C0KA 1RJEA 2PXCA 5HILA 1R00A 3GJYA 5DM2A 2HMYB 4FSXA 5DSTA 4AZVA 4YV0A 3NWEA 2AOVA 3BWMA 2NP6A 3UJ8A 2P40A 4PYQA 4DMGA 4RTLA 2H1RA 2V74B 5EKUA 3LCUA 2K4MA 4GUAA 4GOMD 3P71T 2AZTA 1WG8A 3SXJA 2ZZNA 4GEKA 2PX2A 3HVKA 2R6ZA 3P9NA 2ADMA 5EKXA 2AOWA 5CVJA 4EMSA 3DLIA 5K09A 3P2EA 2ZSUA 3HCDA 2AN4A 5EC8A 4QDJA 3KQWA 1EIZA 5B1SA 4R8RA 5IKMA 1U2ZA 4KIGA 2IBTA 4QVKA 2G71A 2B78A 3OE4A 2IDJA 2PVCA 2EX4A 2ZIFA 4HG2A 3PX3A 1BC5A 1HNNA 3C6KA 5CUQA 5EEHA 1KP9A 3QV2A 3ERCA 3FTFA 2BR5A 2PX5A 3KPWA 4IV8A 1SVUA 2JJQA 2HWKA 2B2CA 4KDCA 2EFJA 4QPNA 3SSOA 3TM4A 5HIKA 3M6WA 4GC9A 3B3FA 4U7TB 4YUXA 5K8VA 2PXAA 1QAQA 4OA8A 2VP3A 2A14A 3LDFA 2H00A 1QYRA 2OB2A 5HIMA 2V7EA 3BKWA 2UYHA 4MHTA 5DM4A 3EVZA 4K6MA 2WK1A 2CKDA 2CMHA 2I62A 2OBFA 3NWBA 1R18A 3FPEA 5DRTA 5C0OE 3EEOA 3NDIA 1SQFA 2P41A 3FUUA 3FPJA 3P97A 2VZ9A 4F86A 2ZFUA 3OZTA 5BW5A 3DMHA 1JG1A 3NVKI 1NV8A 2R3SA 5EZQA 4LECA 3TLJA 1JG4A 5D1NA 2B3TA 5G02A 3TR6A 5DTMA 3LL7A 1WY7A 4OQEA 1VIDA 2HNKA 4ER7A 3SSNA 5P8WA 1KHHA 4GOLD 3UJ6A 5ICFA 2JHCA 2FPOA 1O54A 4PIMA 4CTKA 2OXTA 4F85A 4YUYA 4RTPA 3DP7A 2GA9A 3GDHA 5E1MA 1HMYA 2CL5A 4HRAA 4E70A 2UZ4A 4RWZA 1T43A 3OZSA 4DZRA 1OR8A 2Y1WA 1KPHA 4AUKA 1VP9A 1R74A 3AXSA 4OA5A 3LDUA 1INLA 3FYCA 1P39A 2ZZKA 4YMGA 5E9QA 1N2XA 3DLCA 5FADA 5BXYA 2GPYA 3ELWA 2PWYA 4YUWA 3G8BA 4QQKA 1MHTA 2HTEA 4Y2HA 3G5TA 3KQQA 1RJGA 2G70A 4LWPA 5CVVA 2PY6A 4M38A 2IH5A 3HNRA 1IM8A 1XCLA 2ESRA 4PINA 4PYMA 5E2BA 3TOSA 3G2OA 1I1NA 3PTAA 4UOEA 4YV2A 2PT6A 3DOUA 4IKPA 3G88A 1Q0TA 5U4XA 1XDSA 3E8SA 5DX1A 3BZBA 3FPHA 4FT4A 5LQUA 2ZZMA 3E7PA 2AOUB 2ZIEA 1L3CA 2ONZA 4RVFA 1ZHFA 4FZVA 2JH8A 3DTNA 3L8DA 3NJRA 1XVAA 3JWGA 4C03A 1D2HA 10MHA 1VL5A 2BM8A 3I58A 3T7TA 1P1BA 3CKKA 3OCJA 5T67A 4R6XA 1B42A 2P8JA 2PXXA 2Z6UA 5K0BA 3HVHA 2QM3A 3T0IA 3R9XB 3FYDA 4X60A 4XCXA 5CVDA 3ELUA 3HA3A 3NTVA 1Z3CA 3Q87B 3DR5A 4FP9A 4YUVA 2F8LA 4ATNA 3UJCA 1O9HA 4PCLA 5F2NA 3F4KA 3EGEA 1JTFA 3KQVA 3PT9A 5K01A 4YMHA 3LGAA 5E2AA 1DCTA 5MHTA 5FWAA 3LX6A 3MAGA 5E1BA 1NW8A 3REOA 3GRYA 3TPZA 1X1DA 2IGTA 3HA5A 4RTJA 4KWCA 2GS9A 1MJFA 3M6VA 4HTFB 3PX2A 5DSXA 4CXMA 3JWHA 4RTKA 5JUWA 2I6GA 2O07A 3CBGA 4PWYA 1SUIA 2FYTA 2XYRA 2YVLA 3B3JA 3FUXA 3G2MA 5EMJA 5DT2A 3SR4A 3SSMA 2BR3A 3O4FA 3GNLA 1YZ3A 5DTRA 3OU7A 2IP2A 4DCMA 2DPMA 2P35A 3LKZA 3BGDA 1NT2A 1KIAA 2JHAA 5DLYA 3A27A 1JTEA 2ZULA 4DM3A 3B89A 4RTNA 4U7PB 2ZCJA 2XYVA 3KPYA 3ID6C 3VC1A 4CKBA 3MHTA 3FRIA 2NXCA 3NDJA 4DCGA 3FTEA 5K05A 3P9IA 5DXAA 2QY6A 3KQSA 1ZQ9A 2YR0A 1L3IA 2FCAA 2VDUE 3KQPA 1SG9A 2QE6A 3FTCA 1XDZA 3LSTA 4M7RA 3HCFA 3KQOA 5FA8A 1FBNA 4X63A 3LKDA 1N7JA 2IIPA 3E23A 3DULA 4XUDA 5DWQA 3OU6A 3HTXA 3LECA 4RV9A 3EVEA 5EIWA 3ME5A 1FP2A 2NNWB 4HGZA 2YX1A 3EVCA 4E2WA 2AOTB 1D2CA 2C7QA 2PX4A 3UWPA 1Y8CA
chains in the Genus database with same CATH superfamily
3STUA 1SMKA 2H08A 4M9XA 3BDAA 2IEZA 4B7AA 3MMZA 4UBNA 2WJGA 4YT8A 3DOFA 2AUTA 1NG9A 3RUPA 1BDJA 2JW5A 3GJSA 4B31A 3TSWA 5ETQA 5BVHA 3AERB 1YKGA 3F9IA 2WW8A 1VLJA 4I36A 1HUQA 3HCCA 2N4CA 1N6QA 5K6RA 4X62J 2WV7A 1Q16B 4BJ1A 4KXMA 1T7PA 3LT5A 3H9EO 2ZVIA 1R7RA 2DVMA 3G9XA 2E85A 5JIBA 4WOCA 1GXUA 3H4BA 3AXMA 1FP4B 3KLGB 3T35A 1C9MA 1X1CA 3I39X 3D9BA 4UQPA 2QL5B 3VNRA 4S24A 5KTKA 2I2CA 4HNAA 1MIHA 4YHHJ 3KZMA 4CVNA 2H3EA 1F5AA 3BMQB 3IB6A 2AKAB 4F21A 1I80A 4EP1A 2W24A 5IC4B 4TN2A 2Q3BA 4WBFA 3RV4A 4LNUA 1CP2A 1HNIA 3V7FA 4D0GA 3IUQA 4ZO7A 2FQQB 4JI1F 2WNIA 1XMSA 3S28A 5LYYA 2B8WA 1KARA 3V2GA 3KYBA 1DKQA 4EENA 3QY9A 3CCES 3JR7A 1RIIA 1V8DA 1WXXA 5I9IA 1B6GA 3EB9A 3W3AH 3BXZA 1KVSA 1IJEB 2W2QP 3UZUA 1XNRB 4PWWA 1X1SA 3WK6A 3PDHA 4LF7J 4DIOA 3BMQA 3ZNOA 1XEWX 3AX6A 4W1SA 5IC6A 1I1QB 3AR8A 1NSKL 3GUVA 2QUZA 2MJNA 4LRXA 3BQNB 3EEYA 2NV6A 2CL7X 4C6SA 1K63A 5JH7B 2Q5HA 4Z4CA 1R7IA 3W64A 4EBFA 4ZN3A 1ORHA 2I2XB 3B8EA 2K5UA 2O2JA 4HB0A 4NJEB 3FBFA 2J6IA 1UP6A 1B43A 2WPDA 1RJ9B 2VUSA 1PTKA 4A6EA 3N39C 1RISA 5EX3A 4LV6A 2H0RA 4BFTA 3OTQA 5ALZA 3AKDA 3JQ7A 4PPGA 4C3UA 1I2DA 1O4WA 4GX5A 1UEJA 5NLLA 2OHOA 1JKFA 2JASA 1NNUA 2ZJZA 1B0ZA 4IOBA 3NOCA 2WNHA 4FDMA 2ZJ4A 5C46F 5KTYA 1WC3A 3GGDA 1GTL1 3OM8A 3BGVA 4RD4A 4F6LA 3A7DA 5B0CA 2BZ0A 3PFFA 5BN5A 4QNNA 4F04B 1RLOA 2JB9A 3L1UA 1XDDA 3WRXA 4WI1A 5B30A 5FR2A 2WVGA 1AYEA 3CWZA 1JIHA 1NFRA 1S02A 3PJEA 3UMJA 2EFQA 4JL5A 1ZUWA 3IRUA 2Q9UA 1N4AA 1N36B 1EXNA 5B4VA 3CA8A 3ZJTA 4GOMD 1K2VN 5LLSA 3NM6B 1WHTB 3ENQA 3L9WA 3LF1A 2JJQA 1MOPA 3Q24A 2IS2A 1IQRA 1FFBA 4G1MB 3J80A 1NE7A 1PJ6A 2VNAA 4L16A 5BWBA 4NASA 4OB7A 5G0RA 3EVZA 5C7IO 2WK1A 3RTAA 1F6TA 4KGVB 3PW2A 1FX4A 2CV2A 1MN6A 4E1BA 4E5NA 4R9SA 1ZGHA 5F3TA 1R4ZA 3K8YA 5ETKA 1I14A 1GQQA 1YRUA 3DMPA 3Q88A 1UZHA 4DNXA 5I9NA 2OORA 4RW9A 1FU7A 3OL6A 3N87A 4N9WA 2QMOA 4OO3A 4HRVA 3MSCA 3D3WA 3P6YC 8ABPA 3LZDA 4RUCA 5ESXA 4Z54A 2ZD1A 1NT4A 3G0GA 1ULTA 2ZZMA 2ISQA 3C74A 4QEDA 3GA0A 1M0TA 3AOBA 1TUVA 2IYAA 4NZPA 4XI9A 2ZVSA 5GAGU 3WLLA 4U63A 2BGKA 4UHKA 3TAHA 2CCJA 1NVBA 2FKAA 1YHNA 4QGFA 1G3IA 5KWSA 2DPJA 5A2QY 2C4WA 3L7UA 1R3UA 5DO2A 2F1RA 3K5WA 4DR3F 5B2EA 5AWFC 2VF2A 1H0KA 2RGWA 4QYZK 3U6KA 2ZUVA 3PQDA 3T9NA 3AJ2A 4BCAA 2PJUA 5K51A 2YWXA 3UWTA 1C1XA 3LHSA 3UCGA 3L7DA 3T3OA 5IJ0B 1FP4A 1IK4A 4LJ9A 4TYBA 1JFLA 5HQ3B 3TSCA 1PYDA 1NRWA 5JEDA 4KPEC 3HACA 1E9SA 1FJ7A 3D5QA 3WC4A 2ABYA 1SUCA 3HULA 4RENA 8AT1B 3LUJA 2AC4A 1PNQA 1NFFA 3K5MA 3UN3A 4B9LA 3R9IA 3UAWA 2YXDA 3VV3A 2R1VA 2QGNA 3EDCA 1CIVA 2FQYA 4CMEC 3L7OA 2G1UA 2P0EA 3ZTWA 1N7IA 1H3NA 4L7QA 3GYGA 4DMCA 1FL9A 3VPCA 4WFJA 1T0TV 5JDIA 4ECVA 1N6HA 2OUIA 4DMZA 5CNKA 1N32F 3DUWA 3R75A 1EG2A 1E1RA 3K4PA 1QM5A 3T94A 3KNGA 4MICA 2DHCA 5JFGA 3DFKA 1DC7A 5IH3A 5HKLA 1C2YA 4QFCA 3NNCA 4CM9A 4AG3A 4DLVA 4YDXA 1VM6A 1JJ4A 4BAUA 5KMGB 1L8AA 2EZ4A 3BMOA 1L1QA 3EUEA 1C0IA 2QD2A 3KK2B 2IELA 1AKVA 3PRVA 1JE0A 4K6CA 4FE3A 2ABWA 3IGVA 3MG9A 3ROMA 1O96A 5EPEA 4Y6RA 4M5IA 1CQIB 2TMDA 5HATA 1T1SA 1IZ0A 5AXNA 2QLWA 2MHCA 1EIYB 1SC1B 3TM5A 2JFDA 3N0XA 5F5NA 5A4DA 2RH9B 4BFUA 2EYQA 2QRJA 4YFVA 3V8VA 2HA5A 4E33A 5L8VA 2ANBA 2WWHA 2XZLA 1JR3A 1JT9A 5JYEA 1EFLA 4M98A 1N2OA 4GF5A 4EHAA 5A62A 2B83A 1B2LA 3PUVA 1SUSA 2G08A 2FDRA 4DV1B 3FFIB 4O2LA 4PLFA 2QZ4A 3INNA 2DKFA 3DCNA 4CDRA 3OD2A 1AB6A 4EMBA 2VSNA 4LBWA 4PN7A 4FNAA 1WI8A 4EO6A 3UKDA 1UT8A 5JSQA 4LZPA 1T5LA 4MV1A 5ALIA 3VR5H 3OM9A 1XJ5A 4P9SA 1USKA 3L0CA 4G63A 2GVNA 1LJLA 4H7EA 5ESDA 3HM2A 4DLXA 4UZFA 3NG8A 3INYA 5BR7A 2DR5A 1HI1A 4F5WA 1ZUHA 3O8BA 3IVGA 1JQBA 4FLEA 4PPQA 1V45E 2OECA 1L5YA 5DDOC 5E4YA 1PFKA 5E0KB 5JNLA 5C24A 4U7JA 1G3MA 1RAJA 3QKSB 2JNJA 4DOZA 2VQFB 2ZTHA 4JI3B 2PU5A 3IVMA 1CVIA 3DB2A 5ETOA 1L7OA 4C0LA 4OHXA 3E3XA 1YHZA 3C4JA 4RNOA 1LRJA 4L22A 1BTOA 2DR0A 2R8GA 4KNVA 4EKGA 4JOQA 4DGSA 4OHFA 4HDNB 3OD1A 1YULA 4Y2KA 1C29B 4F1WA 2W9BB 1O58A 2CFOA 1OSDA 2XMUA 3GVXA 3M8SA 1W44A 2D2FA 2FTRA 1JYEA 2I67A 4Y7CA 4IAOA 1F8XA 5HJEA 3S1AA 4G4SP 5FCDA 2XKKA 1PS8A 4YGYA 1EE1A 4C4XA 4CZCA 2VBIA 4U7FA 2XSZA 5IJXA 1AKYA 3HP1A 1NQ5A 3I9KA 2PO5A 2QVYX 2GUGA 4Q48A 2ZIFA 1P6QA 5IXJA 2IJNA 3VAZA 3ERCA 2ZIUB 2V94A 3C70A 1WL8A 4DS4A 2LEBA 3JXEA 3JSAA 4HYEA 3QEAZ 2OB2A 3PR4A 1NRKA 2AWZA 1RYNA 4PX5A 2OLWA 2F5GA 1SCQA 4B3MB 3QG1A 1QQTA 3CCRS 3WTCA 1NG1A 1YQTA 4FEEA 3DO6A 4OOFA 5CW1A 1U2TA 3OHBA 2OO4A 4YUYA 3GDHA 4QA9A 4MGEA 1UMDA 2VK8A 3TW4A 3NG1A 4LV5B 3C5CA 2W4QA 1QE1A 2VFSA 4KSEB 3FMPB 2FN9A 4BNHA 1K5DA 4ILRA 2QZJA 5B1DA 3C7KA 4BC0A 1K66A 2L3MA 2RDDA 2R7AA 9ATCB 1YVUA 2Q3MA 2IOFK 5C7PA 4U2EA 1PR5A 5DLDA 1PC4A 3NANA 1ZAWA 1W4RA 4W98A 1RE1A 3DFIA 1M1YE 5DW0A 5CVDA 4CM4B 3AOCA 4BWYA 5CLLA 2B43A 4X7RA 1QZXA 4P3OA 1NR7A 1NW8A 5DB4A 4ITVA 3VOSA 1VIMA 1EZZB 4YCNA 3N0VA 4JLMA 1RT2A 1XZFA 3QX9A 1D6SA 3ID6C 1JKXA 3QSGA 3OTOJ 3WS7A 1OX4A 1M34B 1HT1E 3MEDA 4HATA 2QRUA 4BCCA 1G7TA 3KQOA 5E6RB 5TB5A 2PE8A 5AVUA 2BH9A 4TQGA 3BN3A 4KPGA 4JI4F 2DQSA 4RC9A 1E1MA 1KI4A 1N25A 2VXOA 3LP0B 3TEJA 4N6NA 1GEHA 2IEYA 5BXQC 2J3JA 3PUJA 4OGFA 1HSOA 5KREA 2ZH7A 5CBKA 1TTHA 4DV4B 1P27B 3BJZA 5JDCA 2PQ6A 3DZJA 1L5MA 1M8GA 5BN4A 4OJNA 3OE5A 4ZPWR 2GMLA 1T9AA 3O8OB 3L07A 3OEHD 4QT0A 4KNYA 3VTFA 3DYBA 1ZC4A 1V96A 1V9CA 3V55A 2CWDA 1FNMA 3VSEA 3AHHA 3U4HA 5FLXU 3G8AA 4JV5J 1CUWA 4ZD6A 1BD6A 3AI3A 1ZOIA 4ZVFA 1KBQA 1CJBA 4C2BA 2XTJP 4QASA 2F1IA 5TJHA 3WA6A 4MYUA 3BM7A 2B4AA 2V8PA 1Y6FA 3LGNA 1Q8IA 4MCHA 3MS4A 5EJ4A 1AKQA 1VFJA 4NU5A 2IYPA 2OYRA 5K8JB 2JCGA 3O3CA 2C2DA 3HHLC 3BSCA 1X1AA 1WBJB 4P80A 3VTZA 2HQGA 4UVEA 1F6WA 2GETA 2ZUUA 2HSEB 3PO5A 5LZ8A 1UCNA 2C3PA 1XZDA 5DTIA 4PCAA 2WDZA 3ONVA 3G6ES 2ADFA 4MVJF 4YAUA 5ITVA 4YMSA 2QZZA 4B3RF 4TY8A 4RSRA 3HUEA 4CCWA 1AQIA 1UBJS 2M52A 4JVMA 1W4ZA 5HFJA 5AJWA 4WXHA 2XHEA 3PXBA 2JL1A 1RKXA 3U4MA 4IMRA 3ZD7A 4A5OA 1P3JA 3CVUA 3NVAA 3S6EA 1U47A 4JB3A 1EXVA 3JAKA 4HHEA 1NP6A 4KFBB 1VKHA 1OHHA 1Q0RA 4DLPA 2P9CA 4P3NA 2OSRA 1X2BA 1XU9A 4KCGA 1TJ5A 3I73A 5G0WA 5EMLA 3AC0A 3SK0A 1P5JA 3ZD8A 2V8DA 3D3NA 1DAPA 4PZCA 1W5SA 4LDRA 1AROP 1C3LA 3DBVO 1ACLA 1RIFA 5FEUA 1XRLA 2JC3A 1MP0A 2H5EA 1CF9A 3HMQA 1DBDA 2I6WA 1Q95A 3GCWA 4EY8A 4O3RA 4DFKA 5A1TA 3R77A 5T3UA 4F56A 2J9GA 4QR2A 2P7HA 4QQ8A 2OCBA 3HPQA 1NTRA 1QHIA 4CLLA 3DOHA 4EA6A 4R71A 5GZ6A 1UL3A 4KIAA 1C8KA 3OR2B 4X1KB 4Q0BB 3U1NA 5T64A 3AD7C 2WHEA 3PACA 2V9ZA 3E81A 1NUEA 1SKBA 3L3CA 4OGGA 4F4XA 3UYKA 4M0EA 3IMGA 2VHVA 4FYHA 3CRNA 4R8RA 1XZBA 4RU9A 3FOWA 2G7ZA 2ZWPA 3SC2B 4X84A 2XBPA 1KIFA 2C88A 2XUKA 2ZS8A 4P2MA 2PNFA 4BE7B 3OE7D 3MJSA 3PUHA 4ZQBA 2J8AA 2G9OA 4GBJA 1X0XA 3OZEA 4IH1A 3CUUA 5DRTA 2GZ2A 1NXPA 5DHQA 1HE8B 1HQYE 4IP0A 2IIQA 3AAWB 1VIDA 4EX7A 1RD4A 3L95X 4YRFA 1S1XA 2OD2A 1US8B 1EFVB 5CTJA 3DTVD 2IBMA 2UZ1B 2XKJE 3D8TA 5LIPA 4GX2A 3V8NA 4OZ1A 3VR4D 1Q8BA 1YASA 3RYFB 1KWGA 5EHQA 5EWFA 2LCWA 4Y2HA 2DHDA 2D3ZA 2XI2A 4EX6A 3FN4A 3IBFA 1JR3E 1ZDMA 1S7IA 5FBLB 1X9GA 1QKJA 3EG5A 1FEHA 4GAEA 4D26A 1A7UA 2H9ZA 1ZRNA 3HWWA 1YZ7A 5GMDA 1CJUA 3EG9B 3OJ0A 3OKFA 4L2IA 1E3QA 4N8OA 2NSBA 1OYVA 4UOQA 2I9PA 3KG1A 4RS4A 4LUBA 2HLHA 3EA5A 1TGVA 4NH0A 4AL5A 1JALA 3NBPB 1NKBA 3N8NA 2YX7A 4JC0A 4GGMX 2YVLA 4FFDA 4UHCA 1XR3A 3BGDA 1DT5A 4MYHA 5K3AA 1XF1A 5HVFA 3NJ4A 3FTCA 3ZE0B 2FRDC 2OMOA 2UUAF 1TM7E 1L7NA 5KOHA 5EIEA 3V4SA 2QTLA 3MOJB 3UMVA 1TKZB 2PKCA 3TUIC 3GYXB 3NCQA 1JMYA 2X86A 4XDYA 2A78A 4ES6A 4I56A 2X9VA 4N0MA 1RWMB 1GA6A 3SX4A 1IVYA 4E09A 2GWHA 4LDPA 4NZZA 4N5DA 4CIDA 4LYEA 1M34E 2QDXA 3OIDA 2I4RA 3W2VA 3HA7A 1OVGA 5DSZA 1MH1A 5AHKA 3T99A 2BKOA 2JCXA 3VZHA 5HDBB 3DLHA 1T8TA 2J0SA 2YDYA 4CV0A 1MO6A 3HVJA 3RW6A 2HHUA 1H22A 3L1IA 1Z0AA 4HLCA 2WWTA 3UVEA 1XCJA 4D92A 1U94A 2E1CA 4YLEA 4ME6A 4X1YA 3C7AA 4C5BA 4OX6A 2G9RA 4PABA 3MRXA 5JZVA 5RUBA 2HIMA 2BAGA 4RW7A 1LNSA 3IUMA 2X58A 1F8FA 1MXFA 4Q02A 5K0ZA 1WMEA 5BQPA 1YR3A 2FOIA 3FAZA 1JEQA 1XMOJ 1E1QD 1V5FA 1NV9A 3BBLA 1GKYA 4FQ7A 5MN6A 4NL5A 3THWA 3MR7A 3D0OA 2VRCD 2CZ4A 3OEWA 3U44A 3K17A 2X0NA 4KPUA 1JFFA 4I69A 1NQVA 1CY8A 4KIJA 1CWUA 3HP6A 5I8ZA 2Z6AA 4R8LA 3KPJA 4V02A 3OF5A 1ZD1A 1IMOA 3DTVB 4QGGA 3RO7A 3C3BA 4UHJA 1EP9A 2XE8A 3P19A 1X19A 3W2IA 5HVNA 1UWVA 3SFVA 3MB5A 2IVFB 2BZGA 5EUCA 1L8QA 3HR4A 4NTZA 4Y6LA 4IDKA 3OESA 3EPGA 1F60B 2DH7A 2QR5A 3QOXA 4DA4A 2F65A 1RI7A 2G4CA 2BRLA 5FJ4A 1NSYA 2AVNA 2D3O1 1ODCA 1SOWA 1AO0A 2R7OA 3KYLA 1PEAA 3K5IA 4HACA 5LQKA 3UOGA 3ZCVA 5CB6A 1LXCA 4AX8A 2OI2A 4C8YA 1LDNA 2VPIA 3PVCA 4BWJA 5CJJA 1NM2A 1U5CA 1VG9B 3SQDA 1GX6A 3IG1B 3KNAA 1BHJA 2P2CA 1LWFA 1KWKA 5EA2A 3GFBA 2JIZD 1MROA 3RT7A 3PDIB 3MM8A 1W1IA 4DLWA 3X1DA 3KXDA 1QTNB 3O6QA 3TX2A 2QRVA 1RC0A 5AUQA 1NUUA 3NGXA 4G0QA 1VRUA 1OZGA 3FTNA 3ABIA 3L4JA 4P7VA 1JI0A 4UMDA 1OSNA 2OGSA 1JJHA 1YGPA 1E7MA 1BDMA 5C25B 2J08A 4Q7QA 1U5AA 4UNRA 1V3TA 3DEAA 4IZOA 3FB1A 3ENZA 1DBIA 1Z08A 5A5EA 1CJUB 4ZK6A 1MB9A 3CIFA 5DYGA 1X7DA 4NLLA 2A1IA 5EESA 4WDQA 2LECA 3KPWA 3SQOP 2YYSA 4KDCA 4NP6A 2V7QD 1S2NA 5LQMA 3MBIA 2BJ8A 1R6TA 1RZRD 5E4FA 3CPWR 3R5HA 2I7DA 3EFHA 1TFYA 1JLQA 4OZ3A 2RJNA 4MKZA 3LL7A 1Z37A 4ZPJA 4TYPA 3LK6A 1RWBA 1S0UA 2V4MA 1E7WA 2GBIA 2F9DA 1HG1A 4EG5A 4DZRA 1TU3A 2ZPUA 5AKHA 4KHPF 4G5FA 1XBWA 3IPLA 4CL2A 1PX0A 3SXUB 2O50A 3IVAA 2V8OA 2B6AB 3ZDRA 1Q44A 2VYVA 4LRFA 4Y2AA 1KP2A 3LYUA 3W4JA 2ZJBA 2EWHA 3HBJA 3TE6A 1T9HA 1C9KA 1AURA 4QC2A 5ILOA 3WXBA 3CW8X 1BFDA 3L0IB 3WLQA 4YMHA 4HR2A 2DB3A 4MV8A 4CV1A 2VWQA 5JCZA 1X8JA 2EKYA 3FGOA 4XQGA 3K0JA 4BNXA 4L85A 5AOCA 4HWRA 3PEFA 1RLTA 4Q3CA 3MTDA 3EBOA 4EA9A 4QOSA 3ZHXA 4IJVA 4NLRA 3UHFA 4D3YA 3LO5A 4MIYA 2GLTA 1KBOA 2K2QB 1FBNA 3D31A 1JLAA 1DBWA 4FDUA 2IM1A 3W3SA 2Y1EA 4XGNA 1AKMA 3N5CA 3PBKA 4UEWA 3NGDA 4WZZA 5AVXA 4YDSA 2QW8A 1QHEA 4ZEVA 4UZCA 5JRDS 3ET4A 1U25A 2IQ5A 5F3ZA 4MXDA 2XMDA 1Z7EA 1FZTA 3HKWA 4UNNA 5AJUA 2V7QA 1KAGA 3DZDA 4CLRA 1P4AA 1R9GA 1SFRA 121PA 3LDHA 1CQXA 3ND9A 3IBTA 4FR0A 2AFRA 3H0PA 3UGJA 2CLDX 3T95A 1SCNE 4DLRA 2O3SA 3ZLUA 4B3OB 1DG9A 3DFFA 3FZBA 1QG6A 2BMDA 5KOHB 4EFLA 1RTDA 1ICIA 3WP0A 1L4LA 4X93A 4USMA 4LFCB 5B58C 3WBFA 2HFSA 4LF2A 4CM4A 3VPAA 3N59A 1H1LA 4UBIA 2QF7A 1Q3TA 2PGLA 5IBQA 3MYYA 3C6TB 3DVAB 2YFQA 1JXAA 3VAMA 5D3QA 1JEQB 2EJWA 4L5YA 5ALPA 4BVAA 1Z5VA 3W78A 3EG9A 1O2DA 4LRBA 1EK5A 1RT7B 1AF4A 4AJHA 2ZRFA 4REMA 1T1IA 1VQ1A 2QLLA 2Z6QA 1JJBA 5GAEU 3B9BA 1TO6A 4PHHA 1O8CA 1TD1A 3D1QA 4B80A 4FKBA 5KQMA 4JXXA 3G71S 3LM8A 2QTVB 3BK2A 1TLFA 4CL0A 1U3GA 1QB8A 4FBLA 4XWAA 1U1DA 3K2IA 3ZWXA 3KKOA 1RYSA 2A0WA 3KR0A 2POCA 5KYWB 2C1XA 4UKDA 1UC9A 4GKJB 5I42A 1AXGA 3VR1A 5I9SA 5K0TA 3MAQA 3QE4A 5IH7A 5EZSA 1A8IA 4NMLA 4UCFA 1L8LA 1RGVA 2WSSD 2R8JA 4PR3A 4LDZA 1J23A 2PD6A 1HT2E 3IVRA 4OQZA 2P9ZA 1P1FA 1IJKA 3V8MA 1OLXA 3EMBA 2GJ8A 1CR0A 3RH0A 2CHUA 1IWPB 3QX7A 3R8FA 3EEFA 1ORIA 3PGJA 2X42A 2H52A 2FD2A 4GECA 3WLEA 3LP2A 1T95A 5SYMA 2BM1A 3COVA 5H80A 4HADA 1GFZA 1NJFA 1P2VA 4TMYA 4JBNA 4DLUA 3OA0A 4CQJA 4NV3A 1IUPA 4OEHA 4HNRA 1MZPA 2HXGA 3MF4A 3ADPA 1IQZA 3ORHA 1T2EA 1PR9A 1L5HB 3GILA 1FS5A 1X86B 3BBPA 2Q5LA 1U3FA 3EQ9A 4HWGA 2FN8A 1MB4A 1YHQS 1UC5B 5IT5A 2H51A 3OTEA 3IM9A 4GL2A 1O77A 1V71A 2AG8A 5H4GA 1ZNZA 1VL8A 3E5NA 2VNJA 4OLHA 2EDCA 3KYDA 4HDKB 2R6ZA 1EGHA 3E18A 1OIXA 3GZJA 2RHTA 4F7WA 1HL6A 2OEJA 4DR6B 4EYIB 4TRMA 3M8WA 3C6KA 1E1NA 4UUXA 5HIKA 4L51A 1U3DA 1WSRA 3ETDA 5IM0B 3U56A 1F2UB 4ZCQA 4LOAA 3BPSP 3FPEA 3PHIA 4R8KA 3WL7A 2OYSA 3OMXA 3UF0A 1XQXA 3CEJA 1BXNA 4PQEA 1KERA 2PMKA 3CNHA 4NABA 4I19A 4UTOA 1HPZB 4XIYA 3Q8SB 5JISA 3M8KA 4HNVA 4MWEA 4RU1A 4CT9A 3LLUA 5CDYA 4QOTA 4BIIA 4R0NA 2YQ5A 2J76E 3SBEA 3BMCB 2X76A 2CK3D 5GAHU 4FONA 3NCPA 1R8AA 2RARA 1UETA 1FVFA 4NXMF 4HAYA 1G8JA 1WCIA 3RBEA 3TJZA 1P7VA 3G88A 1WSWA 5LQUA 4YQYA 3GFQA 4A7PA 1SQSA 3FEZA 3BJEA 3ZNUA 2Z6UA 3HVHA 3R9XB 1GYPA 1JDBB 3UW3A 3SQOA 2Q8PA 5DF1A 5E7MA 2QUKA 1D5WA 3WKEA 1HDRA 3TINA 3INRA 5DSXA 4MV5A 3CT4A 2IHKA 3HJRA 1J7JA 4DE5A 1EA7A 1BDHA 1Z4LA 2P0YA 1XYGA 1GNQA 4DN9A 3GGSA 3O8OA 4IBOA 1HYBA 5KOIA 3D54D 1JPUA 2MLYA 2CQHA 7FDRA 1C7RA 4U9IS 4NPHA 5GM1A 2NM0A 5DG8A 5CU7A 1QIGA 3FEYB 2QRNA 2VU5A 2CLMB 1AMNA 4YDDB 3WIBA 3D3QA 2XS7A 3MRTA 1XZHA 4JA2A 4V0QA 1T8EA 3MMAA 5DHRA 5CXQA 2LD4A 4CE6A 2AB0A 3M05A 2YFYA 3RYIB 1QONA 5KNCH 5JLAA 4W5WA 2BFOA 1T03B 2XLBA 5LA6F 3WICA 3PDNA 3MCTA 2OGZA 4JGBA 3AKZA 2XNKA 3FDFA 1REQB 3W5IA 2D9OA 1NUPA 2PWBA 1IUNA 1T5BA 4NEZA 5IDQA 3LSYA 2V7UA 4QQBA 1F3FA 1PHPA 2ZTMA 1N2HA 3RHZA 1JGTA 4YGXB 1VSVA 5AI8A 3OTHA 4A8QA 4HBZA 1J07A 2PDAA 4UU8A 2VF7A 4HDSA 2WWGA 3NNAA 1Q1AA 4ZOBA 1PNOA 4B83A 2JC1A 3RAPR 2VT7A 4A0FA 3CEMA 4V3BA 1M1ZA 1XIQA 4A03A 2UXCB 2YXEA 5BQXA 4JGIA 2A9KA 3H11B 1DRKA 4P0QB 3BORA 4CZ2A 2IUFA 3IEXA 1S1VB 2ZJAA 3WKAA 2X40A 3C6MA 1SKUB 1P4RA 2AN1A 4FDLA 2IXFA 2YXLA 4PAGA 4FS8A 2PMFA 1QJCA 3T4PA 3EZ9A 3DWFA 3JQDA 3DZCA 2CXSA 3ZQ6A 1RFGE 1VHTA 4RDHA 1T3TA 4M1SA 2HGNA 3SOZA 5KCMA 4TXMA 2Q8QA 3E1KA 3THYB 2OZVA 4QWDA 1CJKC 2J45A 3BN4A 1PJ3A 1SU4A 3H1GA 4XDZA 1PNVA 5FLYA 3RRKA 2R00C 2QYCA 3M5CA 3QT6A 3ZQ4A 4OMUA 1JKJA 7AT1B 1NOIA 4PQYA 2QSZA 5FUXA 4BZXA 1CIPA 1ZM4A 2GI4A 1KGSA 1RZVA 2IZ1A 3LP0A 3F2VA 5JMPA 5J1SB 3A04A 2QRHA 4AKEA 1K27A 4LRYA 1JS1X 4FHZA 1N56A 1ZKDA 2UUOA 3LRXA 2FLPA 4BKPA 1ISPA 1JLSA 1W49A 4LZZA 2B4VA 5KCZA 2NQ8A 3TOCA 3WADA 1G16A 3AF2A 5KFOA 2HRCA 4MMOA 3E51A 1GVNB 1KHWA 3F5SA 4YASA 1FDIA 4ZVPA 2G2YA 2II6A 4Q24A 4EYKA 2C8JA 1JVNA 2AJCA 4LGVA 3C6BA 3WLRA 4YBRA 4OYBA 3R24A 5BN5B 3TN7A 2GHVC 2VFRA 3AVOA 3TBFA 1B74A 2C4VA 4PZDA 1J5OA 3F6EX 1CUJA 2L2QA 5CLHA 3C6TA 5KG3A 3QWHA 4BX3A 5FHQA 3UJ9A 1P3DA 2PEZA 4O2BF 2O7SA 5GIOE 2EKLA 4M4SA 1HDXA 4D3HA 2DT5A 4XUCA 4P73A 1BCRB 2V8BA 4J9VA 2EI5A 3QSYA 4KQ1A 1GGNA 4R2HA 2DHSA 3UB4A 3WB2A 3QT8A 4XQ0A 1EWKA 4R5MA 3QF7A 2HIHA 5KKCA 1SI9A 4PWUA 3K1JA 1PG5B 4QTXA 4QPNA 4F4JA 1CUSA 2UU9F 1FRXA 3HKBA 3OKPA 1QAYA 4URYR 2CBXA 1ZYUA 4J7UA 3IGNA 2BQUA 4DG9A 3MUNA 1WEKA 3DMHA 1F20A 5AW9A 5DLGA 2R3SA 4RW9B 3TLJA 3MLAA 1UBFA 2VDHA 5BV2P 1SEVA 1AGNA 4CM5A 1S9EA 1X9MA 1CLUA 3RS4A 2R4TA 3RRNA 4I4IA 4RY0A 1JR6A 3RC7A 1KONA 2PMBA 4HVAA 3KLHA 4K4UA 4EO4A 2WF5A 3W63A 5AW6A 5CXUA 3RASA 3TZEA 3F3KA 2DEJA 4KQ2A 1VFPA 1IXYA 1LW0B 4KTQA 3QLHB 4LQLA 4P2BA 3DNMA 5HS4A 4QPJC 2NPFA 4BGEA 2OHFA 1MG0A 1W8DA 3HY6A 1VL5A 4XWOA 2B1IA 4ARCA 4U0KA 1KI7A 1AOXA 3MPOA 1O4VA 3JQPA 3Q3HA 2IM0A 4M87A 5E6UA 1Z63A 4PCUA 2CC2A 2HVIA 5M2QA 1E1QA 3CZMA 3CJSA 5KNBD 3QJJA 3DE2X 4MR9B 5C24B 4IO9Q 2KSQA 1DQ8A 4J75A 4RMGA 1FK8A 3QNUA 4FHGA 4S05A 4OHMA 1KQ3A 3H18A 2OO7A 4DUPA 2PA8D 3KQKA 4RH0A 2QY6A 3DNCA 5LXTF 3ORQA 3GDGA 3VR3D 2R1TA 3PQ3A 4X63A 3L1JA 1DO0A 1X74A 3JYQA 1YTYA 4RV9A 1TO1E 4MQFB 3QIDA 4DV0F 2VZLA 1GG5A 1LTQA 3LOPA 4FTWA 4G1PA 2H5IB 1MNAA 3GIRA 1DJPA 2JHPA 4TU7A 2D5AA 3K20A 2J5XA 3VR0A 2QNBA 3QWPA 4DIBA 2E7WA 2XSFA 1CTQA 2E7XA 3R5SA 2X13A 5FEMA 1PG2A 2BPOA 3Q5DA 4IJ5A 2W43A 4JI0B 4K9RA 3GEEA 4ZQGA 2HYDA 1Z6GA 2DTJA 4IG3B 2P6NA 1A8QA 1SKWA 4M63A 3OI7A 2DHQA 2WP0A 3MURP 3IP6A 4ML3A 4B3TB 1G9XA 3P5TL 3C3KA 3TNVA 2YBEA 1IEVA 3R5GA 1MVOA 3TRKA 3I53A 3L0OA 4RZSA 3EGOA 4ZOCA 1PEDA 3RJZA 4PICA 4U5QA 2AX0A 3TJMA 3Q7RA 2AFHB 3FBBA 4D43A 3ZCTA 2R4FA 1VL2A 5FV7A 4CEIB 2H1IA 3E82A 3SQXA 3QFHA 3GELA 5J3JA 4Q5VA 5LMCA 5G1NA 5IG2A 5AXMA 1HWUA 2ZHAA 2BP7B 2CXPA 2JGLA 3E7WA 5HROB 5HF6A 2ZANA 1YZHA 1KO5A 3H19A 3K9LA 4FCTA 4LGCA 1DJOA 1Y5IA 4IQGA 1VC6A 5CA0F 4OX9F 1ADFA 1Q15A 1L3TA 4NBLA 2JIPA 3HL0A 4JWKA 4J03A 5KS2A 3IBCB 1QMGA 3OG9A 3LOUA 2H7VA 1Y9OA 4DV5F 1K68A 3P26A 4M7PA 4IDPA 2YJZA 3G0HA 4QYRA 1XDUA 2E7ZA 2GXUA 2ACYA 1PZXA 1ZL0A 1Q0LA 4B6EA 3DAOA 3IB3A 3H0EA 3BFKA 4ES2A 3OPYA 4J0EA 4A3SA 1NMEB 1Z29A 3UT5A 3ASVA 4KP7A 1YUBA 4A8JC 1BCRA 5AJXA 3IESA 2NXEA 1GLGA 3BT7A 2ZVDA 4ZCSA 4FCVA 1YHYA 3FYUC 2GFQA 1JHYA 3GUHA 1Z4IA 4RDCA 5JZ9A 2J9CA 2H3HA 3ZYCA 4R7ZA 2WT9A 2XCTB 1I6KA 3FYHA 2L9WA 3MTKA 4W6ZA 5A2QU 1CJTC 2VBZA 2FFRA 2KHZA 1H9AA 4J94A 1R6BX 5HQ8A 4QLAA 1XQVA 1NASA 3OTBA 2G9VA 1N34F 4HL6A 1F1JA 1DBPA 4C3LA 4BLPA 4D99A 1Q20A 4TUYA 3H7IA 3UOWA 5DCYA 2FVRA 4ZEWA 5FA6A 2B5JB 1LBHA 2CZCA 4NLSA 4CUKA 1E6YB 3ILJA 4GSYA 4V0SA 2KTQA 4HLUC 5AKLA 3TB4A 1CXZA 3QUQA 2ENWA 4JKOA 3SEOA 5AI9A 2G25A 1I3CA 4AL7A 2AOWA 4KJXA 3OT1A 1XMXA 2IM2A 1KS9A 4BS2A 3WFJA 1SK9A 2E49A 3CUYA 3S5JA 4I9NA 3OSPA 4J76A 5JU6A 4ZPAA 1F14A 5D6OA 3RVJA 3UCZP 1BH2A 3N2NA 2IC3B 4MR7A 2ZH6A 1E9DA 1KJZA 1UK7A 2RH3A 3BPDA 4O4HB 3LLCA 2I7VA 2TMGA 4RUAA 1NVFA 2ZKIA 2G13A 5HKKD 3PRJA 5ICFA 1BDIA 4DLKA 3MI7X 1CQNA 4J9MA 2ZSEA 2W48A 5G3YA 1T43A 1UBOS 2Y1WA 1VMDA 3N8KA 4ZMRA 4ID3A 4YRIA 3IFEA 3GFXA 3AZPA 4PC3A 1NK8A 3OCUA 3HLYA 4I99A 2G9NA 5FWNA 2QY9A 3F96A 4EDFA 4MV7A 4DV1J 1RE0A 1GVHA 2I6XA 3PLRA 3Q8QB 2YIDA 4KR9A 4DAOA 4EECA 4RVFA 1Z15A 1U2RA 4CLTA 1NXIA 1LWNA 5A8KA 3GF4A 2BEKA 2GN6A 1B41A 3LWDA 4L08A 4U0JA 4FGWA 2XDQA 2ZWMA 3Q87B 3UBMA 2TYSB 2SCUB 3PPXA 3W8FA 5LDHA 3GUCA 3UJCA 2BVZA 4F3RA 3DYAB 3F4KA 3UNXA 1FDTA 3AW9A 3KEGA 5JNSA 4FHCA 3JYTA 3CRMA 1ABBA 3JQBA 1EA5A 3OOYA 3L82B 4S1OA 3K0CC 4LY0A 4Q4AA 2UVQA 5FL7D 3IHWA 3GJXC 2BI8A 2YN4A 1H6DA 1CZNA 3R7LA 1NMXA 4EJSA 5LJ3Y 1EAYA 5HFNA 2ROPA 1PWZA 4H16A 3ZTSA 1ZESA 3GBPA 1KJYA 1G3RA 3VHXA 3DRRA 1QYIA 4JSTA 1OIAA 1NATA 3ETJA 5AVWA 1WMSA 2ZE2A 3JSMB 1VYVA 4CKCA 1C30A 2DFVA 4MR9A 2HPZA 5DTQA 3X44A 4RX1A 4YP0A 4TVOA 5ILQA 3QPVA 4C97A 3JYLA 1SR8A 2H2DA 1LWEB 4PXDA 1FNDA 2A10A 1Q22A 1WU7A 2YZNA 3TZLA 5JSZA 4C4RA 1KRWA 4OI2A 3VHQA 2HMIB 2L18A 5H3LA 1KEZA 1D4OA 1A27A 2K2PA 4YFUA 1L5ZA 2FJBB 3KXIA 3W5YA 1XMQF 3W7VA 4RKWA 5JVHQ 1H8HA 2O8VA 4QDOA 1ZJWA 4KRFA 2YH2A 3G89A 3UJAA 1FIUA 2RGDA 1QHNA 4JIMA 4POOA 1JAXA 1K08A 4IG4A 2C3YA 3T3PB 3G5LA 4KBIA 2PPLA 3B54A 1U3CA 2XDYA 4USHA 5FJIA 4AZWA 2RC6A 6NULA 2NYAA 5IAAA 2QBYB 1FJCA 1X0PA 1U2FA 3RVNA 3M7VA 4DQSA 2GO8A 4TVKA 2MZSA 1D8ZA 3P9XA 3SIPA 1M2OA 4LSMA 4O2BB 4BV8A 1T6XA 2F9JA 1L7PA 2OO5A 4ZP9A 3Q7SA 2CT8A 5ER9A 3EJMA 1QGAA 4JB8B 4MCIA 2CPHA 2HXSA 3NHBA 4CF5A 4UUOA 4X62F 3KB1A 3U60B 1H2EA 2LLZA 4MPDA 3MEQA 3RBAA 3TW0A 4UXJA 1XEAA 1GCAA 3OT1B 4PSCA 1C4OA 5EDWA 1QC5A 2JK0A 3DL7A 1RBZA 2BGJA 3CZAA 4X3OA 5E2QA 1J49A 5LNK1 5DRKA 3GJQB 2NO4A 4UTZA 1QLNA 2CCGA 4BNTA 5EWGA 4U2FA 5E3CA 3GD7A 2I3BA 5DASA 4MUXA 4DX8H 5IM4F 2R1TB 4FX5A 3G8TA 3B4MA 1EINA 2KO1A 1T9VA 2CK3A 2Q2VA 5AVTA 1A71A 2O7RA 5JAOA 4W63A 3FVRA 3PNLA 4AN1A 3C16C 3ZU6A 5E9JA 1IYZA 1R6VA 4KDRA 2ZBIA 4KC0A 4P7JA 1KHVA 4P84A 4GDFA 1O5JA 3N8DA 1H85A 1RKJA 4PX3A 3CLRC 4J9KA 3KR9A 5CB4F 5EUMA 2IEGA 4IKAA 2VP2A 2YZ7A 1Y42X 3HZHA 1FNBA 2HSGA 4RJJA 4FN5A 3SYRA 1H3EA 2H1HA 3HM9A 1XLVA 1K7CA 1NDQA 1E61A 2XUAA 4ZJZA 1FFGA 1WG8A 2ASEA 3ND6A 5JDCC 2PSEA 3N2GA 1ABFA 5JNWA 2PUCA 5T8KA 1CEZA 5EC8A 3QI7A 4RZRA 1I33A 1HQUA 1EETB 1UFQA 3B53X 4WDRA 3TQOA 3TL2A 1M67A 5EWEA 1JG6A 2DM6A 1IWBB 3VPSA 3UR0A 4UU1A 3LDFA 1X4HA 5LD2C 3CH7A 2A1UA 3JVEA 1R18A 1Y6JA 3DLGA 4AQ7A 2BEFA 5F5LA 1P6UA 3OZTA 1VCTA 1AA6A 2WWIA 1XP8A 3ISVA 2HCTA 1SBIA 5JMNA 1SHZA 3GBSA 3HCWA 3KLHB 1GPH1 1SBQA 2W4PA 3I76A 5HJYA 4DUZJ 5JYDA 2F40A 3N2KB 3RK1A 1O6FA 4C0XA 2Y76A 2YNHA 2BUAA 1VZ3A 4JOBA 1RT2B 4UBJA 4UTXA 1QVWA 1R0CA 1UM9A 1IKVA 5P21A 2GD1O 3BZBA 2W71A 2I29A 1BAPA 2IHUA 2JH8A 2O66A 2ZJ8A 2CNNB 3HP4A 4W90B 3DKVA 1K88A 3CLKA 5F4BA 1DXQA 3P9SA 5I7RA 1PFQA 5A8WB 3HJGA 1U1IA 3E01B 4FKZA 3C3LA 4P2FA 1RU2A 2Y0BB 1GD1O 1PT9A 3R8CA 5AKYA 4URZR 4ZVSB 2XVZA 4PN3A 4DCPB 5DDQC 4GX0A 2WICA 1GNSA 1TECE 4EYHB 2QE6A 1N1EA 4KXUA 1FQKA 1DQZA 2E9RX 1SKYB 5IT0A 2XZDA 2RDIA 2COLA 2EIXA 3RG8A 5LYJA 1FNSA 5J4VA 4XTRA 2RGAA 1TQDA 1YDFA 3S7TA 2FVSA 4U6QA 2Q1LA 4X6LA 2ZBPA 4DRYA 2MSSA 4H7JA 1YR6A 1OI3A 5LFAA 4ERDA 1UM9B 1ODTC 1S3GA 1WZNA 2B5VA 3EF0A 2OFPA 2ZOMA 5AIAA 3HFRA 1SCUA 4OMFG 1MWYA 1ZA1A 1ZMXA 3WRYA 3WLPA 3L7JA 3NYWA 4P58A 4Y2JA 3R76A 3AV3A 2HDHA 5FBHA 5F3DA 2DBZA 2D5LA 2W00A 1GHTA 4F06A 2OO3A 2GPBA 3I9JA 2JA1A 3S1AB 1JNRB 1D8TA 2UUCF 1UXGA 4YP6A 1F6BA 4ZZ0A 4Y30A 5H3CA 4TKVA 3EYZA 1SKUA 2HRQA 4MKVA 3UCFA 4ZOLB 4QU5A 3G96A 2JLBA 4XD7A 4MRNA 1J0CA 1GTHA 2C07A 1NMQA 2IPLA 3IR5A 2DU8A 2C3UA 3K71B 4B3RB 4Z2AA 1FRVA 2X8AA 5GV8A 1HRKA 1BQ4A 3CO0P 3OT9A 2WIDA 4I68A 3MPVA 3HKDA 2YRFA 1KFBB 1U81A 5CYPA 1ZGAA 4H4OA 3I9OA 5IFLA 1XQIA 3CRQA 5L7WA 3TRGA 4E51A 2IU3A 1DPFA 3HKBB 1NM5C 4B17A 2FCRA 2M8DB 4PF1A 5BO5A 2Z8YA 2V9CA 2C1ZA 4KV7A 2MQQA 1SJFA 5HA5A 2XA2A 3E9DA 4F3NA 3X1ZA 3TGWA 4FK8A 2GA8A 3GLGE 1MO4A 5J2QB 2KU7A 2Z09A 2IAJB 2ZOGA 1YMQA 1WABA 3LHDA 1S1UB 5DN6A 2OQVA 3A9WA 4WIAA 5AE1A 1WB9A 2VHUA 5REQA 4LFAB 1Z26A 2D5CA 5B7NA 2NO5A 3L41A 4U3JA 2YOGA 3FCAA 4P7GA 1QXSA 4CTMA 1VMIA 3DZHA 5ARCA 1QV7A 3B7PA 3GG0A 5AHRA 1V3VA 3N1UA 3HI9A 1G0OA 1FFXA 3ZE6A 3BMOB 2X23A 4ZZ3A 3W0LB 1G0NA 1GXLA 4M1ZA 2Z9CA 4DA8A 2QSWA 1TQ6A 5GONA 1RTTA 2F1HA 2FRVA 2MYNA 4YV0A 2EYUA 4ZYXA 5AO9A 2R4QA 3HBNA 3MYRA 3VC7A 2MKJA 1JAHA 1HE5A 3OZWA 3QWBA 3IPCA 4I7FB 2ZSUA 4LXHA 3V4OA 3O1JC 4ENUA 2REOA 5LP6B 4YUAA 2E18A 5DNCA 4RCZA 3O1LA 2GBFA 4L8GA 4WJLA 4RKYA 4GC9A 5GJVC 3MAHA 1FFXB 4PQGA 4PZAA 3K94A 2JLGA 3KEMA 2WMYA 1ZH0A 3U9SA 3COZA 4H4MA 4ZS6A 3HJTA 5HMYA 4N5MA 1ZVVA 3CF2A 4YIKA 2GGPA 3U17A 2DFDA 1FUKA 2FXVA 4CLFA 1FD2A 2FPOA 2QRRA 3EULA 4ND2A 4WL0A 4KHRA 2BR0A 2BDTA 4M8NE 1X31C 4OA5A 4D4GA 2WUFA 2CMKA 2XY4A 4UHFA 2VV5A 2QN1A 2HF7A 2W2XA 4A2PA 1BD4A 4CFZA 3D8HA 4G23A 1F2HA 1ZRMA 2V1UA 4TKTA 1VS3A 3UENA 4RQAA 4F1KA 5TVGA 3NJRA 4QIGA 2E9SA 1PVDA 4JSYA 5B3JA 3SX2A 4ZVGA 2XZWA 2WHPA 2HLDA 2P6PA 1ABEA 3F8WA 4DLEA 2IEBA 3REOA 1GGKA 3HA5A 1YDGA 3MGKA 4RIEA 3VGJA 2FYTA 2XB9A 3LQVA 4J2OA 3VKFA 5B6JA 2JFYA 2VDIA 3MCSA 3D8SA 3OU7A 2L69A 4GW3A 2GIFA 3VC1A 5E2IA 4ENRA 3OFHA 3NBAA 5C53B 4C9DA 2GAIA 4Y9RA 2W11A 4WACA 4NCGA 4AF8A 4MROA 2AOTB 3KD2A 4IIFA 3ZH9B 3CURA 3NHAA 4S04A 4HWPA 2MT9A 2PUVA 3T7SA 1QSSA 3A8JA 4LHZA 2CMFA 5DH9A 1XVVA 3OO0A 4FVMA 3SIPB 5FULA 3IWNC 4MR7B 4DU8A 3TDMA 2NUTA 4MJXA 1NNLA 3GI1A 3ANXA 1FDNA 2ZBCA 4NJMA 1T9DA 1RRKA 1GILA 2JIMA 4EZIA 4D9HA 4KJIA 5G1OA 1VLVA 1JH9A 5CFOA 3G5UA 4FU0A 2PWPA 5DBIA 1Q0QA 4ZREA 1ATZA 4WZAB 3IBSA 2FHJA 3ZNJ1 4F3CA 1K0FA 3ACCA 4IXNA 4A8OA 1NZ8A 4M55A 1TJ4A 4ARAA 3F7MA 3OOHA 2O19A 2IC3A 2XPCA 3TA2A 4DEXA 4KMRA 1BMQB 4MWDA 3NUQA 3FOBA 3O8WA 2EC0A 4NFHA 5DEIA 4REQA 4RR5A 4L8VA 1MLAA 3CRZA 1YUMA 1XXHE 2K06A 4Z0TA 5IVKA 4YR7A 5I3UB 1C8LA 1USGA 4Z37A 7FD1A 3RYFA 3Q5GA 4F8EA 3GLIB 1RYBA 3UT6A 3DFZA 3SE0A 3L43A 3O3LA 3OPXA 2DOKA 3O3OB 4DCNA 3PPWA 1AZSA 4TN1A 1PW7A 3OLZA 4OIFA 1OIVA 2NVWA 3E5HA 3DEIA 4IIJB 5BPFA 3QKWA 3W79A 4I4TA 4HAIA 5L7TA 4HDQB 2RD2A 2DNPA 2WSSA 5ICEA 5IM4A 5KVVA 3SKYA 4K86A 4MLDA 5EFOA 2AYXA 4I2VA 2XE7A 1XMOF 3RPEA 4BQNA 5KINB 3ZJUA 5KFDA 5EAIA 3NEYA 1GWNA 4DR7B 3M33A 2H1OA 1KKLA 3D2AA 1YR2A 1GMVA 2WVBA 1GZUA 2JS7A 5EG5A 3JS5A 3GH1A 4YP7A 1N5LA 3R7FA 4DR6F 5AK4A 1DQ9A 1QBGA 1IEXA 3IT0A 3I8XA 1FXDA 1LWFB 3CH5A 1ZGJA 5LMUB 1S2GA 1LBEA 1L3VA 1T6YA 4ZCPA 4XWWA 1SCJA 3ITKA 2ZH3A 1R6XA 3EYWA 2AI1A 1DQRA 3GZ7A 1TL4A 1OXMA 2YS7A 5ES3A 4C0KA 4QBFA 1SUFA 1N0IA 1R4NA 3CLVA 1K75A 5DX0A 4AKHA 3F67A 1FKAF 1WXDA 1ZJ6A 1WA5A 4B4DA 1JEDA 4XIFA 4OLAA 1WTBA 3WMEA 1MW7A 4NNJA 5FLEX 1KJWA 2EEZA 3BJRA 3RIMA 3TAUA 4ZK2A 3ZNNA 1XTTA 2VQEB 1CB7A 4PY2A 3DAGA 2FQXA 3SQGB 2BV3A 1KVIA 5ITZA 2ES4A 2GCOB 3HSJA 4NRTA 4JLJA 3MEEA 4EI2A 3P71T 3W9UA 4F6RA 3HVAA 4I1RA 2XMAA 2QTGA 4BOYA 2JGRA 1UFOA 1V4BA 3M1LA 3M3HA 3HSDA 1NVVR 3C19A 2AW5A 1FYDA 3DOLA 2HSZA 4I3GA 4RM2A 4RPGA 1I7NA 2PX5A 3USES 3DC7A 4JBWA 4PXEA 3UO8B 4ZV7A 2XZTB 3UD4P 2Y92A 1GZDA 3LT0A 3RRZA 3V6HA 4BPBA 3GFHA 5COQA 4P52A 1D4ZA 1E1YA 1ZH2A 4U4AA 3O4VA 1O5TA 5NULA 1M8JA 5CAEA 3K9CA 3W5XA 1P4SA 4GKJF 2PX3A 1PJLA 2CHEA 4GT1A 2LXFA 2RT3A 2UUBF 5BWCA 2DHAA 5KNDD 1INLA 1MN9A 1RA6A 2P9YA 2ZB7A 1TO2E 1MHTA 3QZ8A 3FKSA 3U7IA 3AG5A 2KFYA 4MIAA 2UXCF 821PA 3HKCB 1T8YA 4YV2A 2OMKA 4LF9F 4O59O 3PNQA 1C1DA 2E4ZA 3R7WB 2XXAB 3KTOA 4TL7A 5EE5B 2IDEA 4AI6A 1RXVA 3T1AA 4HI1A 3CNQP 2WBRA 1FTGA 3H17A 5KOXA 2VQSA 2DUJA 2XYGB 2IYIA 5E1BA 4UM9D 1OWOA 5A2GA 4XM2A 3G7NA 1C7QA 3HDJA 2HW8A 5HUQA 1OBCA 2ZCJA 4HYKA 4U7PB 3RC8A 1HM5A 2YTCA 4YA6A 1E4YA 2P9JA 1FWLA 4HACB 4HVZA 3TL6A 1IKXA 1CR4A 3CG4A 1NBME 4G9GA 1RTJA 4E5VA 3Q2KA 3DKIA 2LDYA 4ALZA 1HT0A 5DZSA 4B9MA 3KTAA 3IP9A 3SXLA 2WSYB 3K8QA 1NOKA 2GK7A 1QRUA 2PGXA 2ZFHA 1NBAA 4Q9DA 5E5NA 1GA4A 2EERA 2QORA 3D3EA 2PL5A 4M0UA 4ED7A 2F8SA 5EINA 3R3XA 3BAZA 3PICA 4XA8A 5B1HA 2AFHE 2W9XA 5BT8A 3NGMA 3G2LA 4RY2A 2IPOA 1D8YA 4NZ9A 1B93A 2I4TA 3ZIUA 3IOEA 5HG0A 3KVRA 1K7YA 1R0BG 1U8WA 4GU5A 2I91A 2PYZA 3H2HA 1RB0A 4U2BA 3K59A 3RU3A 1EP1B 4NCBA 2GZ1A 5BYQA 3I5MA 4RLQA 2FC9A 5JBQA 2A9PA 3OL8A 1DC8A 2J09A 3S68A 1TK9A 1I6MA 1DIRA 3KAKA 4CLXA 1HBUB 2HG4A 2F3QA 2FJ0A 4WLVA 3SDSA 1FOEB 5C80A 5DCUA 2ONJA 1A95A 4OFXA 3VU0A 1RM0A 2EBEA 2VWGA 4I4LA 5M29A 2FPIA 3IJEB 2K6GA 4BP1A 4P10A 3PHBE 3FGVA 1K8RA 3UH1A 1WELA 2P6UA 2W2LD 5KPJA 4NHEA 2WLSA 5B7GA 2OIHA 2XLCA 2OCAA 3A1TA 2PZGA 1S96A 4RE6A 4I55B 3HBFA 4ZN1A 1BNCA 2DLDA 1Z6QA 2PC6A 3I2JA 3P9PA 2QE7A 4B43A 4J9NA 2C2ZA 4X94A 3FZQA 1YR1A 1ODKA 1P1KA 3OFKA 1RQ7A 4W9RA 4BNDA 2YPYA 3C1TA 3NT4A 1ZM7A 1JWBB 2QR2A 3JPWA 1GV0A 1L7MA 3H97A 1RAHB 4MX8A 5E4TA 3TVYA 2H1WA 1ND5A 2XBMA 1N5YB 4BNYA 1QIEA 4YRKA 4LHYA 3JYHA 4IRUB 3K5LA 3G2HA 4LQ3A 3JZFA 1CT9A 1FKPA 5TC4A 5EGNA 2V7GA 4UW2A 3WQHA 1M1HA 3AFMA 2NYUA 4NG4A 3MS2A 3P9QA 1IC6A 2MEWA 4HDNA 3FG9A 5L3VA 1PJCA 2BEJA 3GPCA 4LYYA 4V0ME 1E2LA 2FSSA 3MGCA 3CULA 4DMKA 1BDBA 2PUEA 4OL9A 1OCEA 4GPAA 2R5FA 3T1OA 1NNEA 3R9LA 3L49A 2NZYA 5CYJA 4LF8J 1PWXA 3BL8A 4RDXA 1U63A 1UDWA 1C4KA 4BLTA 4ZMSA 1Z68A 3S01A 5H7XA 4MW2A 3ZDEA 5CBPA 4P2XA 1FWPA 1FO1A 2SKDA 5KFIA 4BMSA 5HILA 4KKOA 1OLUB 3NWEA 3UJPA 4O44A 1VC5A 1WQ1R 4GEKA 1BCSB 4I5EA 4R2MA 3CDWA 4DPTA 2AN4A 2DFLA 1PG5A 4UFOA 4WP9A 1GNLA 2GN0A 3ROKA 4MMXB 3H8SA 2ZKLA 4AFNA 1EUCA 3D0QA 4OXQA 2YJ4A 2ACMA 2E89A 3GA5A 5E3RA 5KFTA 2UYHA 3R7NB 3TQEA 4P4TA 1KC3A 4G8CA 2FUG1 4B3SJ 1U7LA 1NV8A 1DBQA 4HS9A 3L0ZA 2HAIA 5IUJC 2ZJ7A 2V2KA 2CJKA 2GK4A 2W6QA 5I4KA 2XQJA 1IQTA 2F64A 2OZLA 1FNCA 4N4AA 1NP7A 2BDPA 4YC7A 2BMAA 3WGQA 4QYIA 1N2JA 2LTAA 2PMDA 2HGSA 2JLCA 1JLKA 3TOSA 3RVDA 2H07A 3UEOA 2Q6BA 3IR6B 5A4KA 1L3CA 3KJZA 5KFYA 3WX8A 1LDMA 4XYLA 3NBQA 3CLRD 2OFOA 4W99A 1NF2A 2AJBA 3UWMA 3UD3P 2W9AA 3W5DA 4F9FA 4DN0A 5DMXA 2WW4A 2DWQA 3ILSA 3M6VA 5K8MA 3BO3A 4H3SA 2IXGA 2JFGA 5DTRA 2IP2A 5AUNB 3I9MA 1W75A 2IHZA 4XGIA 2HQSA 1TMGE 7ABPA 1POXA 1XO1A 1PWHA 3COPA 3QW2A 3T5TA 1M1NB 2NACA 3HJFA 4EO8A 2ZIVB 2C7QA 3QXGA 1PJZA 1PUIA 2YASA 1Q81T 4K28A 3V48A 5SV2A 2DGOA 1TKTB 1F2GA 5FP0A 2CLSA 3RZAA 4RGYA 3CJ3A 5FLXY 1GSHA 2A6PA 3GEMA 3A25A 3GGJA 4TTVA 1YE8A 3SD7A 2B9YA 4YRJA 1DC4A 3ZZNA 4OHPA 1UOEA 3C15A 1G8PA 4X65J 4QVIA 2GK3A 2CQ0A 4CWAA 4EL5A 3FR8A 1DURA 1M66A 3SEAA 2QM0A 1Q0SA 2P6OA 3RSLA 4XUEA 4RPFA 3W4KA 4DDTA 2RHJA 1J5EB 3DBLB 3NTOA 1G291 1JNZB 4XJVA 2GCGA 3RUBL 4OK5A 5EYPA 1FF2A 2ECFA 2ZWIA 4YH1A 4D9FA 2HFZA 3NVMB 1M1UA 3IOBA 4WFAQ 3MB8A 3PUKA 2K7FA 4MKGA 1GKUB 5ETNA 5B2ZA 3OJFA 2ZD1B 2MJLA 2JJ2D 1YA8A 3QOYA 1EFRA 2UUBB 1GPUA 4MIOA 4WCEQ 3NS7A 1W5EA 3QE0A 4XSVA 4S0ZA 2EAUA 3PRHA 2Y0PA 4INPA 3CO9A 3KQNA 3WLMA 2U2FA 4FFBB 3GRFA 4NWBA 2M6LA 2PK3A 5EZYF 3RVLA 4ZVNA 2VG8A 1M5SA 1VA4A 2C29D 4IMJB 2C1EB 3R8YA 4WH0A 1SVIA 5EQFA 4EO9A 2CZGA 4IFVA 3U81A 2JLQA 4XR9A 2QPOA 4HUQA 5KAPA 1RI2A 4N01A 4ZN6A 3R3YA 1ADCA 3G1TA 3PU6A 1XRJA 4ZARA 4PSAA 3C14A 2LU2A 3NS6A 3AP1A 5DM60 3IYLW 5LD2B 1NYQA 2O2YA 1X8LA 3W62A 1H38A 1SRRA 3T1QA 2X41A 5EKDA 4ED8A 4ZCRA 1G6KA 4CV2A 3I45A 3SJZA 1O3YA 1NP3A 3LF2A 2IYWA 3UI3A 3MEDB 2Q9CA 2J0VA 2H63A 3Q85A 2CMDA 4YQFA 4MR8B 5DHSA 3FSGA 5JMTA 4U7GA 2PN6A 4OP3A 2DK2A 4J9LA 4GKJJ 1FYVA 2N47A 4IWNA 4RJKA 1EKSA 5K0NA 1O5OA 3M89A 2BQ3A 5JZOA 4LE2A 3DM2B 1PKXA 3EDOA 4FF4A 3NP7A 1B0VA 3HI4A 3Q0EA 3JSXA 4PIPA 2WUWE 3SE7A 1R5BA 3AJEA 3QFFA 2JJ2A 3FRZA 3JAKB 3S2EA 4DL7A 4AWBA 2WEKA 4FI3F 1UPMB 3RVBA 3DNFA 4QBTA 4LW8A 4N65A 3OX2A 5AKIA 3D6MB 1G4HA 2ET6A 1E2BA 3QV2A 4YAEA 2A5JA 1J99A 1CHNA 1UVIA 4QGSA 2IFXA 4ARUA 3DM2A 2VASA 4P31A 1GKIA 4KE5A 5K99A 2OAGA 2CMHA 5KFWA 4J9QA 4BMNA 4PAOA 3VYUB 3H8YA 2O2EA 4O0LA 1Y3IA 4J9PA 4A46A 2AJ0A 3ZXYA 2AEJA 4H6XA 4Y8VA 1X4AA 1MROB 4GXQA 5KG2A 3E1GA 4R98A 4DQPA 2ZR8A 1OBVA 5LA6A 3IE1A 4JY7A 4G4SO 2GPYA 2EFHB 4QU8A 1PR1A 4DR6J 1HEIA 1RPJA 2J46A 2RJ3A 2WI8A 2R8YA 5KYTA 2RHHA 3VSBA 2I3ZA 2VG7B 3ETNA 1VQMS 4FP9A 3HA3A 3NTVA 2IHNA 2CUTA 1JTFA 1NPKA 1DCTA 3S8SA 2HVDA 2JGNA 4BLOA 4R2LA 4HH3C 3W65A 2EJBA 3T4UA 3BHMA 1W25A 3SKXA 3RFUA 5K5EA 1LBTA 1BWVA 1G4AE 4AICA 4ZTUB 1K7XB 3UQSA 3LC2O 4ENPA 4BWGA 5DW3A 3H05A 2Z30B 3W9SA 4DIMA 4M0MA 3OT5A 4KWIA 4R68A 1U28C 1P80A 4Q82A 3QELB 4N7JA 1M7GA 5T6MA 3HTXA 1PFWA 4TQ9A 2ETXA 1Y1QA 1S1VA 1RDRA 5SY6A 1BGVA 1V2HE 4H1HA 3CF0A 5FTKA 5LMNB 4ROSA 2H4HA 2W6JD 3A14A 4MW9A 5B53A 3PQ6A 4V03A 1CULB 4B3GA 3UGQA 2KLHA 1G4CA 1CNMA 2H11A 3BXGA 2HC9A 3CC2S 1NW6A 2M3DA 2WBMA 4JI7B 1OI4A 3B48A 1WP4A 1J8FA 5EIXA 4BX0A 3B6JA 5A2QA 1S79A 2AMVA 2D2VA 2LMIA 4DR1F 1KYIA 2R86A 4NX2A 3U7QB 5F21A 5AHWA 4C89A 4IX1A 4GWKA 2UUWA 4TV9F 1E1CA 3ZE1B 3QXJA 4C8OA 2QAGA 4JQCA 4WLUA 4MB0A 1A9YA 3A4NA 2IBKA 2KBEA 3V8PA 2WFAA 2VR1A 3FFBA 1OFHA 3AQOA 1NXXA 1K8YB 3NWJA 5D0EA 3KLIA 2LA4A 5KYUB 2C2GA 1IULA 3SZRA 4CLZA 4LYGA 4Q0MA 4JJIA 3NP9A 1JBEA 3BSYA 4GM1A 5F8IA 4PYLA 2E4UA 2W5UA 3FMGA 3A4LA 3UK7A 4A73A 2CNLA 2K2WA 2BE9A 3NHPA 3M6FA 2IMWP 8GPBA 3QLUC 3RGIA 4DPUA 2BF4A 2I22A 5ELXA 3FCEA 2JOQA 3L4KA 1N34B 3MJFA 4CKXA 4NE9C 3BXOA 1ZN8A 2HF9A 1F60A 1OMSA 5ETVA 1U7UA 4QIEA 2LQJA 5JADA 5EQTA 3W2WB 4EEXA 2ZBUA 4A2QA 4YCDA 4F7VA 2LRHA 1JAYA 1IOZA 2ACWA 3NXKA 1JDBC 1XA0A 4HRXA 4QYIB 5HQJA 5FUYA 4NYMQ 1NN0A 4YB1P 1EXMA 3VBEA 2WA2A 3GP3A 3PGVA 5FUWA 4U7UK 4DRXB 2JFNA 4CH1A 2ZWAA 1X4DA 4LT6A 3OCZA 4EPWA 4IDKB 1WCV1 3TZXA 1UFWA 4K5RA 3EGIA 4MVJP 5DBOA 3WMWA 1G38A 5T4EA 3JQJA 4JBLA 4D3XA 1E7SA 1VBNA 1O94C 1NMEA 4HHJA 4ZU1X 3CC8A 3GWGA 1YZ6A 1SKQA 4BN5A 5DHFA 4ZGWA 5KSZA 1UPPA 4M21A 2B8NA 4D96A 1EX9A 2VTBB 2D3TA 3OFVA 1DFDA 3WIUA 3HG7A 2DC1A 2O8BA 1YJ8A 2OFHX 1VKOA 1KGDA 1U3TA 1T0JB 4AJ9A 4HDKA 1JX4A 2OZEA 3CZRA 4FZRA 4EB0A 1YITS 2XHWA 4E4YA 4QPXA 4O25A 3MJRA 2BT4A 1U49A 4G0UA 3FFIA 1JIKA 2JDIA 4LZWA 2C28A 3WLNA 4MVXA 3RHFA 2B7BB 4M5DA 3EX7B 1BC5A 3JQBC 2VP4A 1FXWA 3TW6A 1DDIA 1HLGA 2AF6A 5JI2E 2F2TA 1HETA 3GFGA 3AUJB 3GB0A 3PR5B 1HTBA 2GEJA 2W8ZA 4KN5A 4OYXA 2QGFB 3F2IA 4MW5A 1UVNA 1WWKA 2E87A 3OHMA 3ZDQA 3T8YA 1NHVA 5KOJB 1YDHA 3UC5A 4D8WA 3A12A 4CEIA 3DO5A 3HRKA 3DDUA 2DZDA 3M4ZA 4YP3A 3DT8A 3SYTA 1L4MA 5H5JA 5IWCA 2XTNA 4LZNA 3GLHA 5CT8A 3WWZA 4HYYA 5AQEA 4GR5A 3BEGB 2WVEA 3DRPB 1ISRA 2JI8A 1MH9A 4OQPA 3KO8A 4R0EA 3L7PA 5ADZA 5IWAF 1TF2A 3H6GA 3ZR4B 2F00A 2XUJA 4L0DA 3A1NA 1DJMA 5JY1A 3Q9NA 2ZZTA 2WJHA 2IUEA 3SN6A 2QGFA 5LOVF 2FZ4A 2B35A 1A88A 1B8PA 1WJGA 2WF7A 4DMUB 4H60A 4AYWA 5JQGB 2I2BA 1Z3CA 1ESCA 2P79A 4URUR 2IYRA 2JEZA 5CXSA 3SS9X 1T29A 3VPBA 2V3CC 4ABYA 1FTCA 4HWKA 3JASB 4RIIA 3FVWA 2CQBA 1YZ3A 5L38A 3Q8KA 1DG3A 1RWKB 1XI2A 2B4QA 1E94E 2MY7A 2D74A 3MWDA 4M9UA 3KQPA 2XWPA 4ASUD 3DULA 2JI6A 1ZD2P 2I6TA 2PX4A 3EAFA 3DDHA 2IIBA 5C5CA 4XX0B 1J9EA 4WBSA 1R8YA 4CDIA 2HBQB 3WO0A 2R7MA 2SXLA 4OGLA 4QULA 3RC9A 2F3PA 2X0JA 2O20A 5L3SB 4DR2B 2IHTA 4WWSA 3J81A 1IM6A 2DNQA 2IQIA 4HH0A 1JHZA 3Q8XB 1TA4A 2HLNA 2LGJA 2XSJB 1BGWA 3U39A 5BWLA 3H3FA 3FCVA 2C57A 1N52B 5HI7A 1NQXA 2WIJA 5JW6A 3G0IA 4CO2A 1W88B 4NBNA 1HLDA 1YJUA 4B3CA 2OGUA 1KFJB 2DYAA 4XDHA 4BX2A 1C2TA 1Z5OA 1VHIA 4C8LA 2HMSA 3MM9B 4LDQA 3DBRB 2FVYA 3EGWB 3QWAA 2I54A 4MUMA 2AEMA 4I4NA 2O52A 1REGX 2VRWA 4V0LA 3VYWA 4FGLA 2Q1XA 5D01A 5JROA 1NDKA 1YB7A 1EESA 1MO2A 4BVHA 2H1YA 4DPWA 1VMAA 1FP6A 4Q0BA 1NTOA 4LG1A 4UOHA 5H9FK 2AA3A 4HTFA 1LQ9A 1TKDA 1QF7A 3P9KA 4ES1A 3H5TA 1AA9A 1DQYA 5JCOA 1ODFA 3CY6A 2WU0A 4DUGA 3EVTA 2AFHA 2Z5GA 4PU0A 3KR1A 5KYUA 3ZCSA 3M2VA 3T7CA 2LKZA 4K5SA 4NHOA 2ODTX 2IOYA 3C6UA 1ZM9A 3EY4A 1ZNXA 1E9CA 1ZHHA 4M3NA 1JP7A 2MSWA 4C3KA 1XTVA 4P8RA 2J5KA 2QMXA 4DSNA 1Y1TA 4RF3A 5JJIA 3FOCA 1DQAA 4OZNA 4EPXA 5CZVA 5JAUA 5M2UA 2RGXA 1Q3KA 4FYJA 4NOJA 2QLJA 4DL3A 1ZI6A 421PA 3BF7A 3FZGA 3UCUP 1P75A 1EK2A 2IX9A 4A1OA 3I5CA 1HIYA 4IG3A 3ETHA 3VKGA 3AJ1A 4W8HA 4ECAA 2GHRA 4DUZF 4L8YA 1TKTA 1SA0A 3DEKA 1X0VA 1VBKA 5DEOA 1UMBA 4I08A 3HRHA 3THTA 5H02A 3KJVA 3W2TA 2RHLA 3HV0A 1NY5A 4EWTA 2V5UA 3PE4A 1Q4RA 4MRMA 4HPJB 2FLWA 4RZQA 3ZZYA 1DAEA 5D4PA 1GRNA 4XRRA 1FVXA 3ECAA 4EUFA 1RRFA 5C9ZA 5BSVA 3ZGYA 4G1EB 3U13A 3AKYA 1U0SA 2HNBA 5F4ZA 4MR8A 4P08A 1QH0A 2V74B 2ZYWX 3K15A 3KG0A 5LBTA 2LUOA 2ICAA 1WO8A 3PE3A 3R74A 5IJZA 3EZGA 4HG2A 5E6UB 1M6HA 3JAWA 1TTHB 1GPYA 4DF8A 2WD8A 2R9LA 1Z4QA 3DJFA 1AGYA 4NV0A 8ATCA 5EPOA 1VI6A 3A1SA 4V38A 1II0A 1IZ8A 4D5GA 1SHKA 2BEWB 1EKRA 2XCAA 4E8UA 2IP1A 4PNZA 1N6IA 3PFCA 5J2UF 4B87A 4MHOA 3V2UA 4E21A 1UKEA 1PGZA 3G82A 3KMSA 1EE2A 1GZ5A 5JCOC 1EB0A 3T9AA 2JHCA 5F9NA 4AIRA 1Z74A 1VG0B 4RTPA 1T3SA 1IBCB 3OUUA 5FXMA 3KWLA 1LDBA 1AKWA 1FUIA 1GR1A 3DLLQ 2QPLA 4DUYF 1QWOA 4WERA 1FFCA 4UEQA 5HE8A 3Q0TA 4BWVA 2LYVA 1C1HA 2RS8A 4OM7A 2BYCA 3X43A 2C2MB 1GCIA 2KT3A 1BVYF 3CC7S 3GJ8A 1CBKA 2ATLA 4H4KC 1NK5A 1HY3A 5FTJA 4DJBA 1A4IA 2XZDB 1YG0A 4HXEB 4MS3A 4R1PA 3UPFA 2Y05A 2R2UA 3UGTA 1NGSA 4R4JA 3RJ9A 4MUYA 2IHR1 5MHTA 2NO9A 4QL3A 3VZDA 2F48A 2HBRA 4A0SA 1DJ0A 2XMJA 2Y9HA 4N8NA 4MDHA 1UPFA 5H8WA 5IM5A 1RAGA 1GA1A 1KIAA 3BJIC 1GQRA 4KSBA 5CYOA 3OFGA 4PAMA 1N7HA 3JYNA 2PXHA 1KHTA 3VM6A 1SRQA 1YRBA 3ETGA 3O5AA 2OV2A