4ATNA

Crystal structure of c2498 2'-o-ribose methyltransferase rlmm from escherichia coli
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
357
structure length
356
Chain Sequence
MNKVVLLCRPGFEKECAAEITDKAGQREIFGFARVKENAGYVIYECYQPDDGDKLIRELPFSSLIFARQWFVVGELLQHLPPEDRITPIVGMLQGVVEKGGELRVEVADTNESKELLKFCRKFTVPLRAALRDAGVLANYETPKRPVVHVFFIAPGCYTGYSYSNNNSPFYMGIPRLKFPADAPSRSTLKLEEAFHVFIPADEWDERLANGMWAVDLGACPGGWTYQLVKRNMWVYSVDNGPMAQSLMDTGQVTWLREDGFKFRPTRSNISWMVCDMVEKPAKVAALMAQWLVNGWCRETIFNLKLPMKKRYEEVSHNLAYIQAQLDEHGINAQIQARQLYHDREEVTVHVRRIWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Rlmm, the 2'O-Ribose Methyltransferase for C2498 of Escherichia Coli 23S Rrna.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords RIBOSOMAL RNA LARGE SUBUNIT METHYLTRANSFERASE M
total genus 117
structure length 356
sequence length 357
ec nomenclature ec 2.1.1.186: 23S rRNA (cytidine(2498)-2'-O)-methyltransferase.
pdb deposition date 2012-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01728 FtsJ FtsJ-like methyltransferase
A PF18125 RlmM_FDX RlmM ferredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2810 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4atnA01
3.30.2300.20 Alpha Beta 2-Layer Sandwich THUMP fold THUMP fold 4atnA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4atnA03
1YZ3A 2FHPA 2AZTA 3EVFA 4OA5A 5DRYA 4QPNA 4GC9A 5FTWA 1PRYA 3UJAA 4GOND 5BXYA 3LDUA 1NBIA 3ELUA 2FYTA 1WZNA 2ZZMA 3KR1A 4CKEA 4QQKA 2OXTA 2ERCA 3DOUA 2GAFA 2YQZA 5D1HA 1NV8A 5F2KA 5LQCA 3DULA 3GO4A 5CCXA 5HIJA 1XXLA 2ADMA 5DXAA 3LDGA 1VLMA 3MCTA 3CBGA 2AOTB 4C06A 2H1RA 4QDJA 2YR0A 2YX1A 3GWZA 4FSXA 1WY7A 3A27A 5DPMA 3UJDA 3K0BA 1D2HA 3LCVB 3PT9A 1BKYA 3CVOA 1XVAA 3B7PA 1KR5A 3AXSA 3MAGA 1NKVA 2BM9A 4DZRA 2WA1A 2JH9A 4YUWA 3ORHA 3R9XB 3GRZA 3AJDA 3I58A 3VYWA 1ZG3A 3T7RA 3OZRA 2IH4A 1ZGAA 2E5WA 5CUQA 3PFGA 4PYQA 3BKXA 5EKXA 1L9KA 3C0KA 2YTZA 5ICCA 2BH2A 3P97A 3FUTA 3FRIA 3GIWA 2B2CA 4AUKA 3OPNA 3KR9A 4K6MA 3NMUF 4HRAA 4C05A 3P2KA 5EQJB 4RTKA 10MHA 2AR0A 4PYNA 4YV0A 1OR8A 1WXXA 5IH3A 5ICFA 1R00A 1VQ1A 2N47A 4XUDA 5EPEA 4PINA 2F8LA 2GB4A 3R24A 5FCDA 3TR6A 2BM8A 4OBWA 5MHTA 5T6BA 2ZTHA 2H11A 4ER3A 4E32A 1RJEA 4CTKA 2HTEA 1BC5A 3BWMA 3OZTA 3HNRA 5DSXA 3GU3A 1AQJA 4DKJA 1JTEA 2GPYA 2UYQA 3WSTA 4PYJA 3TPZA 3UA3A 3OE5A 3LCUA 5BW5A 2I62A 2VS1A 3SX0A 3KPVA 1G6Q1 3HA3A 4M7RA 5K0FA 2IP2A 1F38A 3OU6A 3UA4A 1QYRA 2PWYA 3T7TA 5CVDA 2ZZKA 5B1SA 2C7RA 2WK1A 5DSTA 4EVIA 4C04A 4E33A 3EVZA 4PCAA 5CVJA 3MHTA 3HVIA 1SQFA 5ICGA 2PXCA 4FZVA 2BR4A 1QAMA 1ORIA 4YUZA 1U2ZA 1X1CA 2IDKA 5C0OE 2YXEA 2NXJA 3TKAA 3OCJA 5IKMA 4XCXA 3P8ZA 4AZTA 2NP7A 1IXKA 3IYLW 3P9NA 2WA2A 1N7IA 1R74A 5FWAA 5HFJA 1WS6A 1UWVA 2PWPA 3U81A 2VDVE 5DX8A 5K0BA 2XBMA 5M5BA 3RODA 1JTFA 3TQSA 4PIPA 5FWDA 5LQUA 2EJUA 2I9KA 3NW9A 3I5UA 2NYUA 5EOVA 1FBNA 3M6UA 3GDHA 1VIDA 3HM2A 3TMAA 3HVJA 4E2ZA 3G5LA 4OX9Y 1ZKDA 3I9FA 5T64A 5E8JA 5GM1A 4RVGA 3P9KA 5DWQA 5EMMA 3REOA 3S68A 1L3CA 1JQ3A 1UIRA 4X60A 3BGVA 2OB2A 2OZVA 4KVZA 4V0RA 5FULA 3SXJA 3LBFA 4DM3A 2YUIA 3IV6A 1M0EA 1QAQA 2PX5A 3NTVA 5GP1A 5K0GA 3NWEA 1Z3CA 4R8RA 2C7PA 2ZBQA 4YV1A 5HOQA 3NDJA 2G72A 3A25A 3R3HA 2XYRA 1R8XA 1G55A 2P7IA 2CMHA 3P9CA 2ZIFA 4PCLA 2HV9A 4RTJA 3B3JA 1V39A 1RJDA 2VDUE 1X1AA 2ZSUA 1L3IA 3B3FA 5K01A 2ZLBA 4MIKA 2PY6A 4P7KA 4F85A 1RI3A 5KVAA 3PX3A 2P40A 3KR2A 2O05A 5E1MA 9MHTA 2PT9A 3ID6C 5C1IA 4RTLA 3NJRA 5DTQA 5LQAA 2PVCA 3GXOA 2ZBPA 3T0IA 1G60A 4P7JA 4AX8A 1EG2A 1AQIA 3LDFA 5EHIA 2DPMA 4PWYA 4DA4A 5EG5A 3A7DA 3GJYA 5P8WA 1JG2A 3KQWA 1KPGA 2P41A 4QVGA 4ER7A 3L8DA 4BY9E 2IGTA 2HMYB 3LECA 1FP2A 3A4TA 3FUXA 5K05A 5ICEA 5CD1A 4U7PB 2G1PA 1XDZA 4GBED 1KIAA 5EZQA 5H02A 3SSNA 2QY6A 4Z2YA 3SMQA 4MQ4A 2CWWA 4KIFA 2Y1WA 5HZMA 2P35A 3VSEA 2PJDA 2AOTA 3LHDA 5DTMA 4CTJA 4POOA 2IIPA 2BR5A 2ZWVA 5E2BA 3V97A 2G70A 5F2NA 4LECA 3G88A 4RTSA 3FUVA 4F86A 2EFJA 4BP3A 3CJRA 4YUVA 4P7GA 3G2QA 3CCFA 2OO3A 4AZSA 3D2LA 4LWOA 4PYLA 3HP7A 3FRHA 1DL5A 2BZGA 2PGXA 4YUYA 3BXOA 2C7QA 3G2MA 1L3BA 3PLAE 3EGEA 3GGDA 1G8SA 1ORHA 4G56A 3FUWA 5LSAA 1G38A 2AOUB 3TLJA 1SKMA 3FTEA 1XCLA 3KPUA 2VDWA 1HMYA 2LD4A 4O29A 1IY9A 5GIOE 4PYIA 5K0EA 3BWYA 3OFJA 4GF5A 4HG2A 1D2CA 1Q0TA 4DCMA 4CWAA 2O06A 4FT4A 5DM2A 1RJFA 3KQTA 2CMGA 4A6EA 3O31A 2R6ZA 1YZHA 5EMJA 3DMHA 4FR0A 2UYOA 4QVKA 4QPPA 2PX8A 1RI4A 2OY0A 4FS8A 3DLIA 5HILA 2IBTA 3NVKI 3F4KA 1IM8A 3KPJA 3EGVA 1DCTA 3KKZA 2EJTA 2P7HA 1XCJA 4OQEA 4V0QA 5FQOA 1YF3A 3MTEA 3HTXA 3G2OA 5GINE 2ZFUA 4E2YA 1NW3A 3VC2A 4GEKA 4P58A 4PYOA 2V74B 4RX1A 2ZBRA 2P1DA 3G89A 5E1DA 3X0DA 3KPWA 2I6GA 2XYVA 3THSA 1R6AA 3UBTA 2QE6A 4B17A 3NWBA 3I64A 4GUAA 5HIIA 2AS0A 4PONA 5T67A 2P8JA 2ZCJA 4YV2A 2C7OA 1WXWA 5KYGA 2IH2A 3TFWA 4RVFA 2BR3A 3P2EA 1H1DA 2PXAA 3KPYA 1VPTA 3LSTA 2PX4A 4ATNA 4IV8A 2QYOA 2ESRA 3AXTA 3IEIA 3DLCA 1JSZA 1I9GA 5DRTA 3SR4A 3HVKA 2I7CA 4KDRA 2UYCA 2QRVB 2V7EA 2OBFA 4CXMA 1KYZA 3JWGA 2HNKA 2YXDA 3P9IA 4UOEA 4IV0A 1AV6A 3HEMA 4E2XA 2G8NA 2JG3A 2O57A 1NE2A 1YUBA 1SUSA 1P1CA 3LKDA 3P71T 4KW7A 5EIFA 3UWPA 2IDJA 5K8VA 3UJBA 5JR3A 2PT6A 1KP9A 3C6KA 4KIGA 5CM2Z 3EVCA 5DM4A 4E31A 5GIPE 4EK9A 5KQSA 2PXXA 3FPHA 3UZUA 4BLVA 5DM1A 3BGIA 1RI2A 3BWBA 4CKBA 4OA8A 1N2XA 3MB5A 2OPBA 3M6WA 3RW9A 5KS2A 2O07A 3KQQA 3M4XA 3V8VA 3OU2A 4NECA 3FTFA 1NW5A 2NNWB 4R05A 3I53A 2QM3A 1B42A 3CC8A 2PSSA 4ISCA 4M36A 4XUEA 5E9WA 1SG9A 3DUWA 2YXLA 4DMGA 3R6TA 4AZVA 2AVDA 1JG4A 3G8AA 3BKWA 3LX6A 2OYRA 3EVGA 2AOXA 4M38A 4PYKA 4YUXA 4DCGA 4FP9A 5EC8A 4C07A 2ORED 2GS9A 2IH5A 1QAOA 1XDUA 4CKCA 1KHHA 3NDIA 2NXCA 3EPPA 3FUUA 3HCCA 3O7WA 2AOVA 5G02A 3EVBA 3OU7A 5KQRA 4RTNA 4RV9A 2ZVJA 3R0QA 1VL5A 2AN5A 1M6YA 4X61A 1FPQA 5GOZA 5U4XA 3HCDA 3Q7EA 3KQSA 1N7JA 4HC4A 5GM2A 3QV2A 3TRKA 4R6XA 5LQNA 1VBFA 2KW5A 4HGYA 4E30A 4RYLA 1D2GA 1O54A 3C6MA 5DLYA 5ERGB 3HCFA 2HR1A 1DUSA 2FRXA 5CVVA 3FZGA 4E70A 1MHTA 3G2PA 3P2IA 4RTPA 2B9EA 5FA8A 4X63A 3PFHA 1ZHFA 2AN3A 1EQAA 1SQGA 2B3TA 1Q0SA 4FGZA 4WXHA 3SVZA 2Z6AA 4GOMD 2B25A 3HCAA 3EEYA 3KR0A 3KU1A 3LGAA 4OQDA 4PYMA 2XVMA 4YMGA 1O9HA 3ER9A 3Q87B 5EEHA 2QRVA 4C4AA 2H00A 1R8YA 2OB1A 2OKCA 3NVMB 4FSDA 3FTDA 1G8AA 1UFKA 3E05A 1Y8CA 1NW7A 2JH8A 4E2WA 5JUWA 3DMGA 1P39A 3CGGA 3IHTA 2NP6A 3DMFA 5C9ZA 4R6WA 1VP9A 3E23A 3FPGA 4BLWA 2ZW9A 4X1OA 4BP1A 3A7EA 2NXEA 5F2OA 3TOSA 3E8SA 3DXYA 3KQVA 3HCEA 1F3LA 4IWNA 5CVEA 3LCCA 1KYWA 1JQEA 1NV9A 4M37A 3EMDA 5DTRA 3EEOA 3M33A 3UJ6A 3EVAA 3ELDA 1O9GA 3LPMA 1XTPA 4BLUA 1X1BA 3BGDA 3KQYA 3ELYA 3QOXA 3MCZA 3KQPA 5K0LA 2ZIGA 1BOOA 5FADA 4YMHA 2G71A 4EQZA 5DT2A 5FQNA 1FJXA 3ELWA 3RIEA 3CJQA 4GOLD 1SVUA 4ER5A 1RI5A 4QQNA 1NW8A 5K0NA 4HSGA 1M6EX 3HVHA 4RVHA 3ANXA 1KPIA 4KWCA 5FHRA 3UJ7A 4LG1A 2FCAA 5LQJA 2Z6UA 4OBXA 4A6DA 3HA5A 2AN4A 3CKKA 1L1EA 4AZWA 3PB3A 3DTNA 3FYDA 3QOWA 3UJCA 4RWZA 3E7PA 5E9JA 5HIKA 3C3YA 3DP7A 1I1NA 4PIMA 4R8SA 2XYQA 3M6VA 1X19A 3ME5A 3EVDA 4FT2A 1P91A 3OZSA 4Y30A 2UYHA 2AVNA 2PX2A 3FPJA 3FTCA 5CIYA 2CL5A 1VP3A 4ER6A 2K4MA 3HCBA 3LL7A 3UJ9A 2JHPA 3M70A 4MHTA 3EVEA 3KQMA 2VZ9A 4GC5A 3JWIA 2P3QA 4RTQA 4HH4A 1T43A 2IFTA 1RI1A 2PKWA 2PBFA 2ZULA 5K09A 3MQ2A 1WG8A 2DULA 2P3LA 3TM5A 1FP1D 4X41A 3SM3A 4C08A 4RSRA 3TM4A 1ZQ9A 4EKIA 1TPYA 3HA7A 5DM0A 3SGLA 3UFBA 2ONYA 3G8BA 1JG1A 1JR4A 5EGSA 5K03A 3PVCA 5EHGA 4EKGA 2GA9A 2O0LA 3C3PA 8MHTA 1MJFA 3PS9A 5K0JA 2HWKA 2IPXA 2AOWA 3PX2A 4ZTBA 2CKDA 5EVJA 5FUBA 2EG5A 1YFJA 2ZZNA 3AY0A 4EMSA 3JWHA 3K6RA 4U7TB 2GH1A 2FK8A 5DX1A 2FK7A 1EJ6A 1PJZA 3LKZA 4JXJA 4L7VA 4DQ0A 4KRGA 3MTIA 3FPEA 1EIZA 3OE4A 5BP7A 1EJ0A 1AF7A 5LR6A 4H0NA 1ZGJA 3EGIA 3GRYA 1HNNA 5EMKA 4DF3A 5LQRA 1P1BA 3DXXA 1QZZA 2JHAA 3MGGA 4QTUB 5D1NA 2UZ4A 3KQOA 7MHTA 1NT2A 5HIMA 5FHQA 2ZIEA 2B78A 1TW2A 4P7FA 5DXJA 3TKYA 3JWJA 1SUIA 3CJTA 3UJ8A 2AOUA 3H2BA 4RVDA 2Z6QA 1BHJA 4F84A 4HGZA 4KDCA 4HTFB 4GOOD 5DX0A 3ERCA 3B89A 3AWIA 5EMLA 1RJGA 5HEKA 2JHCA 3GRUA 4PGGA 4IKPA 3T7SA 1JQDA 1JSXA 3FYCA 5EIWA 3GNLA 2ZWAA 1I4WA 4QDKA 5BW4A 3OFKA 1QANA 3B3GA 3GRRA 4MTLA 3THRA 5CCBA 3PTAA 1YFLA 3EMBA 2P3OA 2VP3A 5CVUA 5EEGA 3KHKA 2PLWA 3A26A 5LQKA 2JJQA 3DH0A 3SSOA 1EAMA 4GQBA 1NBHA 1VE3A 5K0CA 4XUCA 3MERA 2XVAA 1KPHA 2Q41A 2R3SA 2Y1XA 1XJ5A 2FPOA 3DR5A 3BT7A 5E1BA 1R18A 2A14A 5E2AA 3B5IA 5FA5A 3SSMA 1INLA 4C03A 4RTRA 3GRVA 3BUSA 2YVLA 3M6XA 3O4FA 3BZBA 1YB2A 1TW3A 3ER8A 3FPFA 2IBSA 1XDSA 5E9QA 4RTOA 4RTMA 3DXZA 3VC1A 1KXZA 3GCZA 1JG3A 4LWPA 4MWZA 5E1OA 5EKUA 3BWCA 4WVLA 5EZSA 3G5TA 2EX4A 5GWXA 4HTFA 5E8RA 4PNEA 2ONZA 2GLUA 4Y2HA 3G7UA 3LBYA 4PGHA 2NXNA 2PV0A 4QTTB 1X1DA 1NW6A 4ER0A
chains in the Genus database with same CATH superfamily
3UNGC 1C7EA 2HIGA 1H8HA 1XDBA 2WILA 3AODA 1VJ5A 1CY1A 1HM5A 3INYA 3WMRA 1E2FA 4I55A 3L0YA 2V2KA 3SHOA 5TQJA 1MU0A 2XUGA 4MVJH 5AJHA 2W9CA 3IDAA 3L6EA 1DB3A 4FZRA 1U0HC 3HL4A 4NCNA 3JAKA 3LBAA 4GP6A 1CJUA 4YRKA 2GB4A 3TR6A 1X77A 1FSSA 3IR6B 3ITDA 3T61A 4HXFB 1W7WA 2X7HA 3HO6A 1DTWA 3E01A 5KSWB 2A2CA 4WNAB 1SUBA 3NHYA 3O92A 4GSLA 5IJAA 1NHKL 2DCUB 3BOSA 1KMHA 5JPIA 4EBEA 3HT3A 1E98A 2QUIA 3RT1A 1B7GO 4AZTA 4BFWA 1YB7A 1RAOA 3RBEA 5EIHA 1X80A 3TQHA 1RWBA 4AWBA 5BW8A 3G5LA 4X71A 4OGLA 2VWQA 1UBMS 1WL8A 2WWRA 3DLKA 5I3CA 1Z3CA 3ZX4A 1WJ9A 4JBHA 1JALA 4IDHA 2A2ZA 3CT6A 1EVLA 4H7FA 2FX3A 3IBYA 1OCEA 2FPXA 1XTUA 1Q91A 2PT9A 3DOLA 4QIFA 4QJ4A 1TU0A 4CG2A 1UEJA 1P9WA 1W36D 3EWGA 5AVQA 5CCMA 1BFDA 3DTVB 3BQ2A 2W6ZA 2Q6IA 1GPNA 2O14A 3RVDA 1FW6A 2AUMA 3QEJA 2XO7A 1N77A 2C4UA 1YJBA 2VKRA 4R25A 3JASB 1MABA 1NF3A 3H5IA 4F8JA 2X1BA 4Y2TA 5EL0A 1ECCA 4DSFA 1XC9A 3MNFA 4GKJF 2JDID 3UQSA 2FXIA 4U2CA 5A9SA 2R7QA 2RB5A 2ZAOA 3VO2A 4UHCA 3FOWA 4IIBA 4M9ZA 2LVBA 2UYOA 1D8ZA 3Q0AA 1RI4A 1XEWX 4HEA1 3S1SA 4TKVA 4ZZIA 1Z4UA 1Q81T 4HNHA 3ANMA 2FW6A 2O3QA 4DREA 2I2BA 1YBVA 4WXOA 2IY5B 1M6NA 4R8UB 4BUCA 3OEWA 4YUDA 1T6BY 3S29A 1IZYA 4JB3A 5LMNJ 2CXHA 2HSGA 2R8HA 1J0EA 3TNJA 1K8YB 2MEWA 2ZGVA 1UZMA 5K14B 3TB6A 3O2SB 4D0NA 1FYXA 1E3DA 5TS3A 3KD3A 4BV9A 1WR8A 1XU7A 5EJIA 1UP7A 4RHXA 2WYIA 3HU3A 4POAA 4TWBA 4XYLA 2OYRA 2UU9B 1ZW6A 4QYMA 4OYYA 2IU3A 1F3FA 1GNRA 3M2TA 3KYJB 1THMA 3EDYA 3F78A 2JKVA 3W8FA 3FZGA 3HXKA 1ZVJA 4Y2IA 4CM8B 4DBZA 5C8YB 4OQDA 4PYMA 2EL7A 2NV0A 3RU9A 2COEA 3GIMA 2QFJA 3B7WA 4BS2A 1YVEI 4FCTA 4R6WA 4IIVA 5AOCA 3MPUB 4QRHA 2AJCA 4RZHA 3X1XA 4HWRA 4X4TA 3L6OO 4P35A 1H6AA 1PP4A 2WDZA 3ZW7A 1KF0A 3OIDA 2E4AA 3U31A 1ADGA 1TAQA 2V03A 3HX9A 4C0KA 2JFKA 1DKRA 1P7YA 1M9NA 1TQHA 3M4NA 1S8AA 2GM4A 4ZP6A 1XZ8A 1NPPA 4QDXA 5BMOA 1MT3A 2CNLA 4JX9A 2ZP1A 1CZUA 3Q98A 4G8BA 2HW8A 2A4MA 3U5TA 1ARZA 4V1CA 1IZ0A 4HB4A 2BOPA 9ATCB 1RYMA 3A3YA 4Y2GA 4TY9A 2O6HA 4UEQA 2AFHB 3PV8A 2AU0A 3QU2A 4XQ9A 2QZ8A 3NM6B 4MRRA 1E1MA 2ZIWB 2HZCA 3K6RA 3PW0A 3QVVA 5AUPB 1PJZA 1A95A 1Y1RA 4KRGA 3B9QA 2I5JB 4EX7A 4XTRA 1MHPA 2VXCA 4B9LA 2I87A 1G4UR 5HVNA 2C4VA 2H7VA 1DAXA 4W5NA 3NXSA 4KU4A 5A3SA 2VCEA 1EDDA 5KFIA 1JQDA 1CUBA 4WKPA 3UH1A 5KWEA 4D79A 1EGQA 1NZJA 3PUZA 2NYVA 3A2LA 3BAZA 1E3WB 1HSOA 4E1AA 2QTZA 3R9XA 4IZOA 3T3GA 3ECCA 2ZIUB 4KDFA 3ZZRA 2R3SA 1SU8A 3THPA 2K06A 3PR4A 2E5JA 4KGZA 4ZT5A 3M2RA 4JASB 3TNFA 2X0RA 5BV2P 3DE0X 3P1JA 4EHKA 1F14A 2M3DA 4N65A 1N0WA 5IUJC 5BRNA 1FJGB 4F5YA 3MT0A 3OO1A 1GTRA 1DIHA 1F4PA 4BMYA 5LXTA 5U47A 4JVMA 3VGTA 1ID1A 2RB7A 2XHCA 2R96A 2IZ6A 1E1QD 3A27A 3IA2A 1IKWB 1I10A 1UDAA 1G5IA 1OH6A 2QRGA 1HNZF 1MROA 2U1AA 2ZTSA 2Z2ZA 1SIWB 3P2KA 1SHZA 2ZOGA 1FRJA 4FVMA 3THWA 5JO9A 1TM5E 2NUAB 4RQBA 1AQJA 5B3AA 2E9RX 3E61A 4QG3A 3VZSA 3GMDA 2QRHA 1NFFA 3AYZB 4MIYA 2V7QD 4BN4A 3PGA1 5F35A 4JI2J 3IC5A 4DQIA 1V8FA 4QELA 1P44A 4RX6A 3KK1B 2MHNA 4LR7A 3V9AA 3RRFA 2CDCA 1VL0A 3LT5A 4BMOB 3GDHA 2Y99A 3I37X 1ZKDA 1SXPA 3OQHA 1W36B 4B9VA 4O4HA 2P90A 3HFSA 3FK4A 5AR1A 4US1R 3ZPXA 2F17A 1GZ5A 5EP3A 2XC9A 1T9TA 1RHRA 4B7UA 1Y4DE 1MVNA 5AKKA 2AV6A 3FYSA 2F9MA 9MHTA 3ZCPA 4P9SA 2OAQ1 1Y4AE 1XP5A 3LDFA 4I64A 1QB8A 2P2NA 4OO3A 4ER7A 4EBCA 1IBRA 4MS4B 5BN4B 1J09A 4EJ0A 4P4TA 1ID8A 3WGOA 4L0QA 4LMBA 1SR8A 1C3XA 3DEYX 4MR7A 4YNBA 5HAOA 3UWDA 1I6LA 5AW7A 1RC0A 3RRJA 1TFRA 3T3EA 3N8HA 4FKYA 3AUJB 3W5ZA 5T7LA 3LTNC 3EMKA 4M2LA 1P3DA 4QYIA 4PC1A 1Q15A 1D6MA 2V7QA 4ZVOA 2ZJ5A 1S59A 1WG1A 4I2QB 4GF5A 1R8JA 1SBZA 3EUEA 4HAIA 4MVJI 1U28C 1N3LA 3EY9A 4NESA 5HJ2A 3A3PA 4RKWA 5HKKA 3QPDA 2GKGA 1TK8A 3DOEA 4PS1A 1S6OA 4RKUC 2Y9HA 3ET6B 4PQRA 1A69A 2XYVA 3NKYA 2AS0A 3QUAA 2WV9A 3U3XA 2VSXA 1DRJA 2FB9A 3IIKA 4PNHA 3P0FA 2O8BA 2KH9A 1FJCA 1QKIA 1ES9A 3A6KA 2OCDA 4DUTA 2QSFA 2O8CB 5HUQA 5KFGA 2GESA 3I4HX 1FU8A 5CM2Z 3QG5A 3I1IA 4Q7JB 1CEYA 1VL2A 1NVXQ 3HKWA 1OFVA 3ZVRA 4FPIA 2MKYA 4DUGD 1WSBA 3ABSB 3FCVA 1PJSA 4MQFB 1NIJA 2GJSA 1QF9A 2C1ZA 2REXB 2C28A 1FFBA 3FLAA 3TYTA 3IPLA 3RRNA 1D2EA 4JCCA 1NLKL 4EVRA 2XMQA 4JLNA 1VL5A 2CJQA 2HRUA 3IPXA 5FLXY 4AS2A 3MMBB 2BCGY 5C7LO 3G1TA 1QO0D 2V5UA 1GARA 3N39C 4MDEA 4PCVA 3I2GA 2PGIA 3GJ4A 3THVA 1DFDA 2JA2A 1HG1A 3EYZA 4GLLA 4KMOA 2Z8YM 4TY8A 3SV4A 1NHWA 4KK4A 3JVDA 1JLBA 2FG7C 5PNTA 3UI3A 4WE1A 2ZANA 2OSRA 4YMUA 5HF5A 1T0JB 3EVAA 3RJMA 2W01A 2B1QA 3T6KA 3MGBA 2ZXEA 2F90A 2JJ8A 2ZT7A 1HY3A 3IJEB 4IHKA 5FQNA 1Z5NA 2HT1A 2X8BA 4QW8A 4TLRA 3HKEA 4IZHA 4R0VA 5E9JA 4YOEA 1MJGM 1KOHA 1U25A 1TFWA 5TB5A 3MAHA 2PGLA 4R2WA 1VRUA 4ZVLA 4F6RB 1QP0A 2MKIA 3AI3A 1DEXA 1NNSA 3KTAA 3DOMA 2GJIA 1H7WA 3OAAD 1JLBB 4PPDA 3IO1A 2ODPA 4JVSB 4X1YA 4BJ3A 4R68A 3JQAA 3ND8A 4BWYA 3V7WA 2I9PA 7MHTA 3ZXSA 3K59A 2FPPA 1KJ9A 4TVSA 4HGZA 1H7XA 1U3TA 3W64A 1RQ2A 4OLBA 4ZRNA 1GSOA 2JEJA 3MTGA 2RF2A 4L85A 5GADl 4O2AB 4GRSA 1LTHR 3KBBA 4RU9A 1P1JA 4I46A 3WAKA 2A88A 2CKMA 1GGFA 1OWLA 3B5EA 4X7RA 1KK3A 3H4MA 2W24A 3WLRA 3GPDG 1X8JA 4AF8A 4JA0A 1X1DA 4PC2A 1ZK0A 2QD1A 4BVJA 2J3HA 2JWNA 5LA6A 2WUFA 2ZUGA 4PC6A 1G2IA 1C9JA 1YG0A 1UZLA 4ANFA 4YMVA 1V6CA 3TFOA 3TX6A 4X8MA 4DYVA 2JH9A 5JUMA 4R9VA 5C1PA 5JARA 3MELA 2E4ZA 4WK1A 2QLFA 5ALQA 2EEPA 4Q9IA 5KPJA 3PUKA 3W34A 4B73A 1E6KA 2X8JA 2G5PA 2NACA 4RA9A 5A8WB 4PXDA 4FWIB 2VC0A 1PUIA 2CF5A 1DXHA 2ZUBA 5T7LB 3LQ1A 1FFGA 4NX2A 3P5BP 4CKXA 2Q5OA 1S7CA 4BNHA 5LJ3Y 1UPFA 1F5NA 4LZPA 4JBWA 4TWZA 2P9CA 5K0BA 5J2TA 2GASA 4OYPA 1X86B 4Z86A 5IJ0A 3C14A 4TLAA 2FDXA 3PICA 1JQ3A 3I9V6 1I0ZA 2C5AA 1NK0A 1ODSA 3TK1A 5DH9A 3IELA 4B3TJ 4N5HX 4MW9A 2GEUA 2RK3A 3QOFA 3NEKA 3F4BA 4CEJA 4U2KA 2ZM5A 1IUOA 3AR6A 3B4DA 4QTXA 4Y0FA 1AZLA 4KOEC 4MV9A 4RTSA 1TU0B 1JPUA 1QXSA 4UFPA 1RACB 4V2IA 4BFZA 4G56A 3VR4D 4PYRA 4ARZA 1TKDA 4OJ3A 2GUWA 4EUFA 5CYMA 2H0AA 4CMJA 1DQRA 4BDPA 2BDUA 3IPAA 4BNYA 4TXJA 5AXNA 1XMQF 2WJPA 1UT8A 2W8BA 3GA0A 1Z34A 2ZRCA 3H0CA 2FSSA 2WT8A 2D3O1 3G2OA 3QBDA 4ZREA 4FYVB 2GPBA 3H8YA 3LBIA 4DOZA 3T7JA 1G8PA 4L9SA 4ZXFA 5G4DA 4RPCA 3AP3A 4REQA 2GAAA 2QRNA 1XQ6A 5I5EA 2DH9A 3HZOA 3CVYA 2M9KA 2HHAA 4RXMA 4BB5A 1TKZB 1XN9A 5ALLA 3GLQA 3OJOA 1WP9A 3SEZA 2E1RA 4KW7A 2EGUA 1A8HA 4CV2A 1RCOB 1J2EA 5LZ2A 5GIPE 2YWEA 3FI9A 3SDZA 1GPYA 2PKQO 2Y0BB 4KB7A 4CCWA 5FI1B 5JCJA 4BXOA 3WZ2A 1HNXJ 2LEBA 1DWQA 3ODGA 5CXTA 3QX9A 3R7WB 3BKWA 5E3AA 5EC8A 2ATEA 2DR3A 3LRXA 4CIYA 2EBHX 5EIOA 1U0FA 3LZCA 1T5OA 4DLYA 4BO7A 3LH2S 3C74A 1N7JA 1Y9JA 1WOSA 4OX9F 4WF9Q 3TD6A 4GYKA 2M88A 4AJLA 1FDBA 1CEXA 2YMLA 3C5CA 1NDQA 3N86A 3L6DA 4GECA 1BMQA 1TI7A 3FPAA 2NTVA 3DOJA 3IMKA 5IM4A 3KIPA 4KIUA 3OZGA 2QTFA 4BNLA 3PO4A 2HEKA 1A5BB 3KM0A 1YZNA 4H1HA 1PYDA 1VHJA 5H9FK 3C6QA 4ENUA 2GQ2A 4N7TA 4UMFA 2TMYA 2FJVA 3WGQA 2YXPX 4V1CB 2YHUA 1BW9A 2YZNA 4RHEA 3EOAI 2FWMX 5J9FA 2J87A 2DQSA 2MJLA 1PLJA 3IESA 4R16A 2E1CA 1YCFA 1F2UA 2BP7A 4XWYA 1NDKA 3KYIB 3K0JA 4HH4A 4KQWA 3BL5A 4DJJA 4FOPA 4HR7A 4XX0A 2HA5A 4Q9DA 3MM8B 1DKNA 4NRUA 3T4PA 3LP1A 3R5TA 5DYGA 4I1VA 3DPUA 1PYTA 4TTVA 1JXOA 4ZJOA 1D8TA 4HVZA 1MIOA 2XZPA 3ZVLA 2EP5A 4TS9A 4LVNP 4YEAA 1BXGB 5LR6A 2C2ZA 4IYRA 4IM7A 3BO4A 1PK9A 1SKUB 1E6YB 4BO3A 1AKUA 5DV9A 1F3VA 4MPRA 3N0XA 2MSSA 2ZWAA 5B2EA 3MCAA 3ML1A 3OHBA 2DFDA 3W2FA 4WU2A 3TD2A 3MWEA 4IL5A 3C7KA 2WBMA 4FYKA 5DW0A 3FSYA 3R5XA 3O95A 5E9QA 1RU1A 1EJBA 1STOA 4ZIRB 1U80A 4OI1A 3FYTA 3G5UA 2EJVA 4A48A 2O8EA 4HAUA 3TRGA 2FYXA 5A5FA 2QK4A 3W6NA 1RTHB 4REMA 2BEKA 1WZNA 4IOJA 1RBZA 4MV6A 4CZCA 1LJLA 3V4FA 2GN6A 3LDGA 5U1PA 3K9LA 3IR5B 4MJKA 3AEQA 2RH8A 4RUAA 4V3BA 2AG0A 4ON9A 2R6GA 1PR2A 5SV2A 3QPVA 1S9EB 3PRHA 1VFPA 4Q12A 3GFVA 3MGCA 2FF5A 4WK4B 4W8OA 1YQ9A 4V0SA 2UU9F 1WXXA 4TLLB 2BLNA 2HZAA 4OXRA 4FBMA 4EEXA 3EGOA 4Z8XA 3DVAA 1CFJA 1FVQA 1JTEA 4QD3A 1UBNA 1ZIDA 2ILYA 3SI8A 1NVGA 3FVTA 2NU8A 1U2ZA 3OCJA 5CFLA 3CZMA 1R74A 3GJTA 3DBOB 1E8MA 2KS6A 1ZMRA 3LT0A 1ZBDA 5GGXA 4G81A 3BJZA 2C0CA 1VQ4S 4X60A 3BGVA 4J8PA 1U3DA 1Z0JA 4R8RA 1T35A 4YAKA 1DP4A 4HT3B 4UBOA 2XS7A 5A4JA 2B98A 1Y4UA 1P4SA 3PRDA 1U8UA 3CD0A 1CQWA 3KQNA 3RWOA 5EZYB 3NGMA 4D9FA 5EJ8A 3QEAZ 4QYXA 1UQUA 4EF6A 1KOLA 2OECA 1VECA 2WYOA 1V3ZA 2VPQA 2TECE 3AF3A 4C3ZA 1XTQA 2PPLA 2F9LA 1RLDA 3U39A 3BVPA 3V2HA 3CDEA 3NBYC 5C1BA 4JT4A 1S0VA 3U1NA 5D51S 3UMCA 3G2MA 4HPXB 2ZU0C 3GLTA 2Z2JA 3RBDA 2GZDA 2FZGA 3TQIA 2ECPA 1IXZA 2NO6A 3OO0A 5AW5A 2VSNA 3RG8A 1A96A 5FBLB 3L8HA 4KL8S 4RX1A 2GCGA 2HK7A 4GUAA 2DK2A 3EK2A 1K0FA 4TKZA 3RLIA 4BO6A 4F12A 4TV8B 1PJBA 3NDRA 2GUGA 3MLBA 5K4HA 1XNRF 2AJ4A 1KP9A 1SXJC 3P8BB 3SLGA 1W4ZA 2M9MA 4HBGA 4KTQA 4NI5A 2ZUTA 1LV8A 3HHKA 2EEZA 2R8EA 4YP9A 4PEOA 1M66A 1U4NA 4J6FA 2QUJA 3EXG1 3FHJA 1F5AA 2HN9A 4JJAA 4L5YA 1W0JD 1JLQA 3EUWA 1E99A 2DNPA 3P94A 2XNQA 4KFBB 1UF9A 1YS9A 2PUCA 3HUTA 2Z3ZA 3SC3A 4LRDA 4PHHA 1MDFA 1MV5A 5IKXA 3F9CA 2SNIE 1MH1A 4R7ZA 4PLPA 4O3QA 4X1OA 2PZLA 2PLNA 1OZHA 4F26A 4LHXA 1VPVA 4DZZA 4CCYA 2GJ2A 1FLVA 3DXSX 5JAOA 4JYAJ 3WKEA 1VBYA 1FMJA 1A8UA 4DS5A 3BF7A 2RGDA 4ZHRA 4AKHA 3VSCA 4RK5A 5LQJA 2YRFA 1N7HA 3UPTA 2ZIVB 2UVUA 3QFHA 2AL7A 5JROA 3ZIDA 1GGJA 1FU4A 1RT2A 2JKYA 3D1JA 1R3DA 4X20B 5TJHA 4RD4A 1D5CA 1RZVA 4CLOB 3GN2A 3LLCA 4DIMA 2PRKA 5CFRA 4JEHA 3D0OA 2GNAA 2PUDA 2J0SA 1QD1A 1GKKA 3AI2A 1CJVA 1K73T 4L8FA 4YQYA 3H5OA 4GDMA 4TMZA 5KC8A 1RXSA 2ZBDA 3QEMB 1KQGB 1JWBB 3B4MA 3DLJA 5HVHA 3MUOA 4ZI2A 5CBPA 5F64A 1R0LA 3P4YA 5D3MB 1ZETA 3NOXA 1VFJA 1CTQA 1LOUA 1UVKA 3VZCA 2PYIA 5HQJA 1SBYA 3NWRA 1Y48E 1Z7WA 4R41A 4PHCA 3TA1A 3S0JA 4OOEA 2W6QA 1OBVA 4Y9UA 1U99A 1CLFA 4L6CA 4FB4A 1I94J 2KQUA 5AVKA 1SJ3P 3NETA 1GZ4A 4GLOA 3SSRA 1ULZA 4MK7A 1RYHA 4LJ9A 5JI2E 4MW2A 4EMTA 4OX8A 3UCUP 3ULKA 1PDOA 3RIYA 1YLXA 2VP9A 3QX7A 3QVSA 4Q9LA 1LFDB 2E5WA 4DG1B 3WK5A 1GZDA 3KLOA 3W6PA 3IXLA 4Y8VA 1VB3A 1MN6A 1D7OA 4QT4A 3QBTA 4ECYA 3O83A 5DTIA 1K47A 2W2OP 1ZUHA 1N78A 5T14A 4B79A 2Q0SA 4RNCA 2VPXA 2NZUG 5ALIA 3IAS1 4KT0C 1K5GA 5JSYA 3WADA 4C04A 1WETA 2V45A 2A4KA 1YDLA 2UUBJ 3A1DA 3PQ7A 2DNRA 4E12A 1AT1B 4ZD6A 1KTVA 1W4BA 1O6XA 3BHNA 1P3Y1 3DWGA 3LVRE 5E8JA 1EEXB 4WY5A 1L5UA 3UGJA 1W9MA 1DC6A 3DKVA 3QQPA 3QZ8A 4UM5A 4XDDA 2GJKA 3ED5A 1G55A 2P7IA 3D1QA 1FDDA 3I55S 4J0QA 3U16A 3HMQA 3VPGA 4XGKA 3GXOA 3TW8B 2NZ8A 2WABA 3P0EA 5AM1A 4FE4A 1WXQA 4ZC8A 4AX8A 2DB3A 2DPMA 5ECWA 3AHIA 1V37A 4HL9A 4MVJG 2G1PA 2WZCA 2GZHA 2GBGA 1W26A 4BO4A 4KAJA 5IDQA 3QU5A 1ECFA 4FMDF 4HUQB 2Y93A 4Z4GA 4TMKA 4TLCA 2A2DA 1OWOA 2Z4TA 5EXDA 1F2UB 4D02A 3JYTA 5L45A 4KX5A 3COJA 4INOA 4AQDA 1Y33E 3TTXA 5GMDA 2H9ZA 4KHPJ 3PYGA 2XTJP 1V7ZA 4A6EA 2R6CA 4K9QA 3DKKA 1SUQA 5AM5A 4HK4A 4M46A 2DHHA 2BZ1A 2ZJ7A 2QV7A 3Q40A 1VCMA 4D8UA 4BGDA 5EE0A 1S1TA 1E7RA 3KXPA 1EUQA 1F6TA 1TLTA 1HDXA 3NC1C 4FN4A 2J3EA 4ALZA 1MB9A 2HQRA 3DFZA 2PT7A 1KKUA 1W19A 1P8GA 2Y6VA 2O2DA 5KVVA 4YK7A 4N49A 3TSOA 4D8WA 3OHAA 3EIEA 2O57A 5MN6A 1O95C 3JQGB 2C8KA 2RNEA 1NI4A 4DDFA 4BVEA 2QU8A 3RAGA 3UXYA 4LV5B 4UTGA 1CUYA 4BFCA 5B1IA 3PNOA 4X65B 4JLKA 3R7BB 4IIJA 1S5ZA 3EPPA 1UKCA 2CLIB 1HA3A 3RB8A 4PWZA 1WC5A 2O20A 3OTEA 2MYPA 4WZZA 1I4LD 1SC9A 2QB5A 4HX9A 5AKEA 1XHLA 1O9HA 4M55A 5LWHA 3FSRA 2O5DA 3NHBA 2Z1MA 4L8GA 4IJ6A 4NYIR 1TTPB 2YVUA 2X15A 3LT1A 3HB1A 3ROKA 2JZOA 2QMZA 2ZDQA 3EMDA 2XE7A 3DYIA 3TQRA 1R64A 2C03A 3J81U 3W4KA 3PC6A 3BE6A 2UUBF 1AKYA 5IXJA 4DV4J 3FD8A 1HQEA 3ZHOA 2R7UA 1Z7YA 1NU6A 2WF6A 2IU4A 2VPWB 4Y9DA 3QY9A 3AHCA 3HCBA 4X64F 1POXA 4GBJA 4JL5A 4LF5J 1H2VZ 4Z3DA 3L82B 1YTUA 3KLGA 1GV0A 4FHGA 4AL5A 4KCGA 3KOMA 3UAWA 2RU3A 1TO6A 4EGJA 2KHZA 2ZKTA 5E5NA 1E59A 2YWBA 3I6ZA 4EMSA 1VKHA 1Q1GA 2WCXA 1QV6A 5IJ9A 1L4GA 3FBEA 3RVPA 1P61B 1FVFA 3SQNA 4CDIA 3ZCSA 3JYHA 3VC3A 3RH0A 2RSQA 2HOQA 4ZAWA 1IJFA 5EWJA 4C8LA 4GOOD 1E4EA 2C2HA 5M3BA 4CTMA 1HLDA 4QQRA 4K9RA 2C3UA 1GU0A 1T0BA 1Z5WA 2VZEA 3UCEA 5K9FA 2PU5A 4GBMA 3K0SA 1ONOA 4NABA 1EAMA 1VLZA 4Y1RA 4ECAA 1ULTA 2L19A 3C3CA 3O4FA 3W7VA 1WSWA 3PNLA 5E1OA 4AUNA 3WIEA 5KIAA 1AZSA 4JYCA 4ZZ3A 4J1SA 4DLSA 5DRYA 2NZCA 2HFNA 3T3MB 3LDUA 5JCZA 4G65A 4ALJA 1UDXA 4D3FA 2RUGA 3CRZA 2RQKA 1DDGA 1G5PA 3JQEA 1DINA 1F1BA 1ISRA 4KXUA 2CZ4A 3KK1A 3GK3A 1QX4A 2AJ2A 2J3MA 4MAAA 3CH6A 3WLAA 4YRPA 5KOJA 3BULA 5J4KA 2P6OA 1GFSA 2GGPB 3GLFB 3D1OA 4C98A 3FTQA 4V39A 2Y3IA 2D2IA 1T9GS 2QAGA 3V8QA 1X38A 2F00A 3NBMA 4GL4A 3T7TA 1EFRD 1T5TA 3I8XA 2GCEA 2SKDA 1WZUA 2O0KA 4LZLA 1H3NA 2YNHA 1SKYB 2P2YA 2C54A 3K5NA 2AI2A 1Q19A 5HFJA 4YDXA 3COVA 2ZPTX 2BE2A 3W3SA 1KJ8A 1NNLA 1WHTA 2OC9A 3TO8A 4H35A 1G2PA 4OXIA 4E5MA 2BJ1A 1EFPA 3BN3A 1SC4A 4K9NA 3TLCA 2H48B 2GKOA 5GP1A 1JJBA 2CJWA 5BY2A 6AT1A 3G2IA 1UR5A 2KB2A 3NTOA 1U0JA 2BUAA 3P9CA 4F2DA 2H3HA 2VQEF 1Z0ZA 3R5JA 4ZDNA 5JRDS 3RB4A 4J7CA 1PL6A 3U7EB 2JL9A 2QN8A 1VE6A 4LRQA 5AXCA 4EYOA 3N87A 3T7AA 4XIGS 5HRCA 3DWFA 1VGRA 1C8KA 4TXNA 5C8XA 2F4VJ 2Q2VA 5CB8A 3AOGA 4H7EA 1NOIA 3FUVA 3TAMB 5LLDA 5A0TA 3ZK9A 3GUUA 1AMOA 4RM3A 3EF0A 3T9NA 1XCLA 1QH8A 2ASLA 1A71A 3KQTA 5FUWA 2DPLA 2ZH9A 3AIMA 4AXJA 1T2EA 2Q3HA 1VHLA 2JVJA 8AT1B 1HTTA 2BFNA 1OX6A 4UBNA 2NUHA 2AFHA 3E70C 2PBZA 3I64A 2OSVA 4YCJA 3W1VA 4RW4B 5IUNC 2QYOA 5JSZA 1F3OA 2HFUA 1YRHA 2FKNA 5K8CA 5F5NA 4IQGA 2G1UA 5IXYA 1WSRA 1JLFA 2I8LA 3QMVA 3J81Y 1GGVA 3P71T 5FV7A 4LY6A 5E3IA 1H4TA 2IHBA 3IB3A 3RRBA 1LV5A 2J9DA 2ZOFA 4P2XA 1ZKMA 3T5BA 4NJEA 5D3GA 2IH5A 2I0XA 2IXTA 2J3JA 3INRA 4JB2A 5BUZA 3D67A 1L9XA 3W4JA 4Y6IA 2V3VA 4DLVA 5A8KB 2AJBA 2JNWA 1E5QA 2Y1EA 3NIDB 5E7QA 4MRNA 3ASYA 1LI7A 4ZFNA 3FKJA 4O02B 2PZMA 1OGIA 4B3IA 2H00A 1L4NA 4ZEOA 5DSZA 5A76A 4HWKA 2ZW9A 1P2DA 1JEEA 2RC5A 5CD9A 2ZUDA 1PDWA 3OF2A 4LSNA 3C97A 1XZLA 1A9SA 2PRYA 3JAMU 2Z6VA 3PQCA 1NLUA 5EJ7A 1RAJA 1OC4A 1ZL2A 4Z7YA 2QQ0A 2WNIA 3B6BA 3ANXA 1SKUA 4HEHA 4AZWA 4M5LA 1V45E 3JD3A 4QYWA 1GPH1 4OH1A 4B2IA 3EPJA 1P7ZA 5AK4A 1GV1A 5IAEA 1Z7GA 1OWNA 5I51A 2QXTA 3CUYA 3LP1B 5LSRA 4Z7NB 4BC1A 1S1VA 3HA7A 3PFKA 1LPBB 1FMCA 2X1VA 1WUJS 1UH5A 1KXJA 4A8HA 4B3DA 1G8MA 4C3MA 4F4JA 3STWA 1FJGF 2H2AA 1TK5A 2R8YA 2HI0A 4F02A 3TPFA 4CQMD 2JIPA 3OXFA 5HI7A 3HK2A 8LDHA 3H8JA 3KQOA 3FWKA 2WTAA 4EY6A 2VV5A 2QV0A 3OZCA 5JDIC 2QUZA 2FZVA 4LZNA 2BQUA 3L8FA 5C8ZA 3TQFA 1HTWA 2QORA 4JLJA 1IBMF 3FCEA 2OO5A 4ZN3A 3MWYW 3BZWA 1OPXA 1SJFA 4B46A 4I1TA 3HVRA 3HDGA 4F4HA 1CC8A 1KPHA 4NZ0A 4ML3A 5FPQA 2RHHA 2DC1A 5AYVA 4OAOA 3O4RA 3FG9A 3INTA 3UMGA 2BN4A 2WJWA 4ETZA 1BHNA 2AGOA 1T8YA 3PX6A 2EZ4A 4RZRA 1NMYA 3UOGA 2CBXA 4ZQGA 4DT1B 1S9GB 3WS7A 2PGCA 4E5PA 4NZ6A 5A5EA 4BJ6A 3LSYA 4L0CA 5EX0A 2O48X 3O4JA 4NG5A 4HXGA 2QJRA 3AC0A 2SKCA 3PFGA 1PKXA 1KMHB 3T1YB 5SZKB 3RHTA 1GUFA 4OQZA 4YV0A 3W9SA 1JSLA 1P2VA 5FO1A 1V1RB 1IDN1 1E2LA 2H7XA 3IR6A 2BKNA 2UP1A 2X58A 4NASA 4FYJA 1YVUA 2WK4A 4JI1J 3DLEA 1TELA 1C9NA 4JU8A 3K5HA 3LW7A 2GFQA 3T1NA 2WVFA 4A91A 4E3ZA 1ESMA 3TKAA 3O2QB 1MA3A 3PIDA 1MNEA 2X3DA 1JTFA 3RYCA 2ETXA 1UMDA 2HFZA 4URYR 1JJFA 3MCWA 1PG0A 4DLGA 1AYEA 1C81A 1LRJA 4IJMA 1Q92A 2OPPA 4D44A 3OFFA 3CC7S 5F8NA 1QGYA 4RD2A 4M98A 3EEFA 2VDUE 2ZK7A 1X1TA 1U8SA 5ENZA 1N2EA 1Q57A 1YRUA 1NBAA 5B5SA 5T3YA 2ZDOA 3BX1A 4X3OA 5AKHA 5DG8A 2Z4SA 1T94A 2H9IA 4YCLA 4KHPF 1DHRA 3LK6A 4GI3A 5LXYA 2CW5A 2HJRA 1ZWLA 1FP2A 4KBGA 1ZXLA 3N7TA 4L4UA 4NIMA 1L7QA 3Q0TA 5DNAA 3A8IA 4GOKA 4MH0R 4O2AF 2O3JA 1R9MA 1PI3A 3P5TL 3NLCA 1ZJ4A 4BE7B 5GAEU 1WF2A 2LCFA 1I3NA 3RUAA 3ZNNA 3H9GA 4L74A 4PSKA 5DNWA 3RI3A 4UU1A 1BE0A 1NT4A 3RV4A 2VPTA 2EIXA 2A3JA 1CJCA 4XX1A 4MNTA 3F7MA 2GPSA 2PC6A 1SFRA 1TKXA 3M89A 1T0HB 1D2AA 3S55A 2ZAYA 3MD9A 5AMXA 3GRAA 4NZYA 5KYGA 3S70A 3ELBA 2BEWA 3IEIA 2JLGA 5HBMB 4I8XA 2CVZA 1JMVA 4H7IA 2BSXA 1W36C 3QG1A 5K8VA 1ACLA 2C5HA 2H2FA 1RI2A 2IYVA 3AESB 3MR7A 4F45A 4M21A 1XTZA 3VYSB 3WK7A 2ANBA 3V32A 4BLTA 3N2EA 5KYNA 7FDRA 3GWCA 1O87A 2QGNA 3OPKA 4M0DA 3BREA 2B4PA 4HCJA 4OL0A 3MWJA 1YK9A 1G2OA 4G0WA 1MAVA 4N0MA 5IARA 1EP4B 2JI7A 1JDVA 2H1LA 2R7TA 4DDHA 2B25A 2XUPA 3R5GA 3CW9A 3EVTA 1TJ5A 5MN4A 3LY7A 4ZT3A 1MWYA 2YYSA 4C4YA 2IRXA 1PT9A 1RD4A 4MA5A 2WKRA 2HQ1A 3IFEA 1G9SA 4R31A 5JFOA 3ZNUA 1NOKA 3G87A 3KLIA 1YHYA 2B99A 3HJCA 2OP1A 1E2BA 2VPIA 1KLMA 1FJXA 3LWLA 4OJGA 2HRRA 5NLLA 1RQRA 4OBXA 3C3YA 4B6RA 4O4LF 3KLBA 4YT4A 4LXHA 2WG2A 5HK8A 4MV0A 1DIBA 4Y2SA 3W61A 4O3PA 4DOMA 1TF2A 4ER8A 1OBFO 4JEIA 2YWXA 2VOPA 2CXNA 3HUUA 2ID4A 3F1LA 4Q1VA 4D82A 1LBQA 4BTEA 2P2ZA 3NRBA 5I4KA 2QMYA 4B7CA 1QAXA 3KHLA 4GSKA 1DJLA 1RJGA 3NUQA 5HEKA 2XUHA 3RS3A 3K0FB 2P2CB 5HNKA 3FYCA 3IBTA 3RTGA 5KBYA 4R9UC 3DDKA 3SYZA 5COQA 4FXOA 5LMCA 4WLUA 1V9LA 4M86A 2H9AA 2QN6A 1O57A 4NPHA 3V6JA 2HQIA 4UARA 4NZMA 2YJ3A 1R0WA 1WB6A 2G9OA 3REQB 2AN1A 2O1PA 4W5RA 1KXZA 1NF8A 1V47A 4N56A 2W2QA 3ED1A 4MUAA 1T1IA 1UBFA 2OUKA 2UZ3A 3D6JA 3BMOB 5JHGB 3TR5A 4OA5A 2XCLA 2UV8A 5KSYA 3SXPA 3RB0A 2QIOA 2YZ7A 1FRLA 4PAGA 4GKKJ 1CG2A 6REQB 3SP1A 3LX5A 1AG9A 2FMIA 2LA6A 1DQNA 1NATA 4EF4A 3BXFA 4ENPA 1KI6A 3D3EA 3I5BA 2FLOA 1X8XA 1XKXA 1KE1A 1ULAA 5TMBA 3SX2A 2ASVA 5DXFA 1XZPA 3QTBA 1U0EA 4KGXA 4BN5A 1D09A 1CJTA 2NAPA 1T11A 5K2OA 5JZBA 2KN4A 4N4AA 5JZSA 2KVIA 4QGAA 4NYZA 3LUFA 4C4OA 1KFCB 5HN0A 2EQAA 3GJ6A 1I4EB 2MZQA 1YRAA 3Q2KA 2FUEA 2XPCA 1NOJA 1Y80A 2VG5A 1LDMA 1FFAA 2OMKA 1SRRA 3K8OE 2Z56A 5G4KB 2OE2A 2WQZA 1HWIA 4FHZA 1E4OA 4V0RA 1R31A 2EW2A 3QSYB 4D5GA 2JAQA 5IJZA 4R2XA 2HCTA 4TVBA 3CNLA 2L18A 1KEPA 2DFTA 1J99A 5K8PA 3NAHA 5C1IA 2VDPB 2Q2NA 1SVSA 1T8UA 1N34F 1JIXA 4DR3B 1JVBA 4EUKA 2JDIA 4MS4A 2XZWA 4G9EA 1J8MF 3QV1A 1S96A 4R7GA 4J49A 2DYAA 1RQLA 2EFJA 3ZGZA 4YUVA 1F5BA 4P7GA 4C3VA 2Y1LB 5BR4A 1ZOTA 2ZI6A 4DIEA 5ALSA 1QJHA 5IAGA 2AYZA 1JJVA 1IJBA 1PZHA 5K3BA 3WGJA 2OTLS 4IRUB 4MLPA 4GOJA 4RIGA 3AFIA 5GIOE 3BWYA 1UC8A 1J5EF 2WSLA 4YCBA 1VIMA 4GE0A 5E3CA 5KVQA 3MW8A 4QNNA 2ODBA 2CQ0A 2GIQA 3TTTA 4LNUB 1PZGA 2GYYA 4DR1J 2KBEA 4MJ7A 1S89A 3EAFA 2TRSB 3MVEA 1NXWA 2CMFA 2MWMA 4CIDA 4P0TA 3WGZA 3MDFA 4UDNA 5CLIA 1BX0A 4RETA 2AXNA 1Q3TA 5SYAA 1OBOA 4K86A 4LF2A 4XLZA 1YH3A 1CEZA 1AKVA 4U96A 3ADCA 2C5EA 5K4GA 2GN0A 1QHIA 5A4MS 1S02A 4TMVA 1KH3A 3H2YA 3UG6A 4YP0A 2ZH7A 1SH0A 4Q15A 3MSCA 3TEJA 2G36A 2G83A 3VZDA 1K6MA 4ZAZA 4X00A 3K3PA 2ZYSA 2VQFB 4L2IB 1GIAA 3O8NA 1XDUA 3BKUA 2PG3A 2R751 4K1XA 2I99A 1GUYA 4RYLA 4HXYA 4V1CI 2XXAB 4OV6B 4RCVA 1FRNA 4O44B 4CT0A 2B6NA 1RT1A 4CM9A 5EEHA 2GARA 4M5KA 3M81A 4OKSA 1KMCA 1Z5PA 3TCNA 4NV1A 4HWPA 4X0EA 4XTTA 4ZO9A 4U02A 2OXEA 5CX1A 4KE6A 3KO8A 2G82A 2WB2A 1NZDA 4NU5A 3S2EA 4YWJA 4V0NA 3QFRA 2DR5A 1YNSA 3ENVA 2DB1A 3OZEA 5TGZA 1FEEA 2WJ3A 3G6ES 2PE8A 4HDNB 1KHWA 1U5CA 1ZINA 3PGJA 1R0AA 2RD5C 4Q48A 1M2KA 4IUCS 2Z09A 5E95A 1J39A 4JI8F 5I48A 3ZKWA 1E2MA 5KHAA 3TZKA 4KDEA 3CMES 2VTKA 3SJUA 2A86A 1FDRA 1YS7A 4Q05A 3COWA 1SCQA 4TN5A 1QYIA 1U90A 5CYJA 3QVJA 2FZKB 1WKBA 2HHTA 4X1KB 1XZAA 4CLFA 4L50A 2NYIA 4H60A 1KNXA 2WPDA 4GP9A 2H5LA 2OAGA 4C2UA 5BV8A 3BD7A 2P0AA 5AWFC 1FRXA 1N33B 1N2JA 3KSMA 1UKZA 1CF9A 2VJPA 4HAVA 4MDFA 5B7QA 1TZ0A 3QQ5A 1A2QA 1V3SA 1Z17A 4UD6A 4DMMA 3B1JA 4QJIA 1E1KA 5ALNA 2JIZA 4OXXA 4E98A 2V8DA 5KOIA 4YROA 3R5HA 1TGVA 2WU4A 3EVFA 1ISHA 2NT4A 4HH3C 4G1MB 4GOND 2FPKA 3W60A 3WK6A 2IEBA 4AUMA 1O58A 1UPAA 1U65A 3DULA 1G3UA 3CB2A 4J6EA 1KAHA 2UVVA 1Z2OX 3ILYA 2R4FA 2Z9CA 3MM4A 5H16A 4IBOA 4IRMA 3ORQA 2ZKLA 5EHHA 1J0DA 2OOKA 1C8VB 4X9XA 1BGXT 1TVRB 1N36F 5CFNA 2H29A 1O08A 4A8QA 5ICFA 3OMXA 3LH5A 4IFBA 2ZVDA 3P2YA 1V3QE 1ZNWA 2EZTA 4DX6A 3SBMA 2GCFA 1PYOB 4KXMA 3HN6A 2VDLB 4PCAA 3M3PA 3UMYA 4M1ZA 1UFWA 1MPTA 1IXKA 3M8QB 1SUWA 1GTG1 4QOSA 1Y6FA 2GEVA 4PRYA 2OK8A 3S8EA 1RZ3A 3ETDA 3VR3A 2R9VA 1QVFR 3FRJA 1XPUA 5KNBH 3HSGA 4CI0B 2J0QD 3WL3A 1GRVA 4ETNA 2J9FB 3SZ2A 1NYTA 4IOAQ 5K01A 4PAMA 3HG7A 5CP8A 3HCWA 2WMDA 3ZXWA 4HI0E 2EFEB 3UWMA 2O7SA 1EGVB 2FN8A 4M8LA 3ICPA 4KE8A 1AH2A 4KGKA 2H4JA 2I1QA 5ICEA 3FNRA 4TV8F 3TIFA 1WB9A 2ZJFA 4PN7A 4JOCA 1U1MA 5JADA 4YUYA 2Q5QA 1JGTA 2TSYB 5SUHA 1IQUA 3D3WB 1NVEA 1VHIA 2MSKA 3GZ4A 1EM8A 1TCCA 1T2AA 3TX0A 2WJ4A 5FAXA 3FPBA 3OZAA 5FUYA 5CDUA 4HHEA 1P2SA 1GZUA 5KFAA 3MM7B 1RC1A 5FJ4A 3BKTA 1Z88A 1V11A 4NLUA 1E6LA 4YI5A 5H82A 1F6DA 4ES6A 1PZXA 4A47A 3VR2A 4Y6GB 3MZ0A 3DFUA 4MK4A 4G09A 1NYRA 4ATNA 1IVNA 5EWEA 4YA6A 4UOZA 1P9YA 3ZYZA 1PJ4A 1O0PA 3S8SA 1DWPA 5BSRA 1Q7YT 4XZ3A 4HDKA 1P1CA 1OH7A 3IT2A 2PMKA 2DTEA 2RHLA 3E3LA 4EATA 1MOZA 3UUFA 1W30A 3K0CA 3QELA 3IIIA 1HBNA 3BDIA 2LDIA 1B42A 4WCVA 1XAJA 3Q23A 1SG9A 4CH7A 3DU6A 4DR5B 4KGMA 1N32F 2DR7A 5I9SA 3K5PA 2FTKE 2OO5C 2CK3A 1GNLA 4JJEA 4EH1A 1U0NA 4F0KA 4BMSA 2VRCA 1Y3CE 3HWWA 4GZMA 1RWNA 5KG0A 2XDQA 2IMOA 3GLIA 3NNSA 1LS6A 2QPAA 1NN3A 2VA2A 1QSSA 3FBWA 4WFYA 1KY2A 3FW1A 3I42A 3JQJA 1B2RA 5ULLA 3ST7A 4EB3A 4CW7A 3JZMA 3C6TA 1Q8KA 2F43A 4JV5J 1FJEB 2PSDA 3SKXA 1C80A 4NCKA 3GFQA 2GA7A 4JBLA 1APSA 3M5DA 2BANB 3EWNA 2LA4A 7FD1A 4YR3A 2Q5HA 1OY8A 4H4CA 2EBUA 3LKVA 4K8RA 3DAFA 3OJUA 3DMYA 4H6WA 1LJ8A 3IEXA 1V6AA 4RVHA 2FCAA 3N5CA 4YS6A 3BJYA 3PUJA 3C1AA 1JE0A 3P5BA 2V96A 2Q4DA 1JDTA 5HWSA 1SH2A 3VNUA 2LLZA 1TPZA 3HHLC 3CH7A 4RC9A 3SLKA 4RMJA 4N1AA 1CJUC 3ADBA 1JFVA 3H97A 2V6FA 5DM0A 1ILWA 3PUHA 3H1PA 1OXVA 1HYHA 1XRJA 4XPCA 4GLBA 4B35A 2M98A 1EIZA 2VNHA 4B83A 5LM3A 4FJ0A 4E03A 4KVAA 1P1BA 1QZZA 4KN9S 2XTZA 4JBNA 1YJCA 4U9UA 3ZI7A 4C11A 4PV7A 3E2PA 5E7JA 2Z2YB 1CZHA 3N5FA 3OMLA 1XWFA 4IJWA 2W6JD 5TV2A 4NOHA 5HMWA 3OJEA 1U8AA 1FDVA 1SZJG 4IMJB 1IBLJ 3PEVA 3KAKA 2XCOA 4IRDA 3ZW9A 1T9AA 2EKPA 5G0VA 2G4LA 3ZS9A 4QM6A 1EVZA 2PQ0A 4WVLA 4USKA 1SA0A 5A4KA 4XFJA 3K92A 2JBAB 1VIAA 1TADA 3WL6A 4GC9A 2X5KO 2LCWA 2Q6BA 4E46A 5JSFA 4TSFA 2MMYA 4Z0NA 4WKBA 2HCBA 1QE1B 1W6UA 3LO3A 4J0IA 3ZE9A 1MX3A 2HBQA 2P5SA 3TQCA 1VIVA 2BFDA 3EAGA 3EHEA 1Y6QA 3J7Z5 3EIHA 3CEMA 4X54A 2NU8B 4K28A 1X74A 1HWKA 2BJ7A 1YVPA 2GD1O 3GIWA 3GT3A 3ACDA 4DA8A 3L5OA 4FQ8A 1AW0A 4B9TA 1U5BB 3QE9Y 2XNHA 3FETA 3DVAB 2DLDA 4MUKA 4YHBA 3FCAA 3H2JA 3LPCA 4DFJA 1CZLA 4G5GA 3VAJA 2WYVA 4RWXA 5B7GA 3DC7A 1T05A 4YQWA 3IRXB 1F2VA 3SAJA 2CYBA 5HKKD 1RLUA 2FG6C 4QBFA 3NS7A 1W4LA 3EZGA 3HDJA 3RQIA 4ZVFA 1GZHB 1UWBA 3G8CA 3OQ2A 1MLDA 3NH9A 1GL3A 2JBHA 4IKAA 3GCXP 4XWKA 3WHPA 4FD3A 4OI4A 3F8SA 3P19A 3I2FA 1AS0A 2RG7A 3SCZA 1SH3A 4LXTA 3BXHA 4ZCIA 1XZKA 2CLHB 2EFPA 1KAGA 5BSGA 2I34A 4TMYA 2OFHX 4TMFA 4O4LB 3QSGA 4PWYA 2F3JA 4TTJA 4Q0BA 2GMLA 3GBVA 2HIYA 3HU1A 2HCJB 4LQ3A 4WZ6A 2W9BA 1GMVA 2IZ1A 2PFSA 4WP9A 2R1ZA 3EZ9A 1V9OA 4H6PA 3ROQA 4BNJA 1UK7A 3E1GA 4F06A 2MHCA 2O06A 5DI9A 1RXCA 4AW9A 2R6ZA 3RS7A 3I23A 1QZ3A 1M75A 4BAGA 4KKOA 2Y0CA 3NVKI 3VVBA 2IBTA 1G2QA 1GPMA 1S6UA 4BZQA 4H3KB 2NSJA 4CRWB 4LOAA 5BSHA 5E2QA 4FSHA 2XOKA 3M5WA 1YA8A 3EOZA 5CXSA 4S2UA 1Z22A 4TZKA 1DTTB 3W1EA 2XCPA 4XGRA 4JI1B 5JBNA 3UFCX 1JJCB 2OGZA 4FGJA 4BTLA 2XMPA 5CIQA 2HHSA 4Q39A 2AX1A 4IICA 2LKZA 4KWEA 1RXYA 5HCUA 2ASYA 4EQ6B 1NNDA 4XKJA 2BBWA 4BQPA 5FBZA 4FCVA 1PKUA 4G25A 3D7LA 2Y9PB 3KT8A 4ZU3A 2I2DA 3EIXA 4H3VA 4JVNA 2XF2A 4BVFA 4YR0A 2HU8A 1D0VA 5LP6A 4F4DA 3SG0A 1NQVA 1T4GA 5COAA 1G8AA 4HT5A 1YIDA 3GUYA 2YFYA 3BR9A 1PJAA 1OUMA 4UMVA 4DSTA 3DLPX 3R7WA 1ZPDA 2ANCA 4Q4HB 1W4CA 3ZHYA 4BXOB 4CM2A 4TYPA 4AJOA 1DRZA 1X9SA 4B3GA 4GZLA 1GTSA 1E92A 2AZ3A 3F2IA 2YWHA 3FSGA 3F3KA 1GT8A 4ETMA 3BMCA 3OW2R 1RHMA 1GVHA 4DLEA 2B1RA 2NG1A 3IO3A 5FLXA 3S1AA 3GH3A 1ZU5A 2ZSKA 4KBFA 1HDGO 1USKA 5IH7A 1L3VA 5KYUB 2FR8C 3DCYA 3T5LA 1XALA 3NDBB 4IR7A 3GPLA 2VHCA 3EWIA 4DVJA 1KD1T 2Q4BA 2Z2IA 4XYMA 5G41A 3SBXA 4DCOA 5HIMA 1CB0A 2GN9A 2ZIXB 2ZBGA 2G5GX 3SZLA 5EIWA 3DZFA 2JLUA 2GHPA 4Y6RA 3UN5A 1E1NA 5KG1A 2P11A 3LWZA 1GUDA 4KXNA 2G7ZA 4XYEA 4OCZA 2ZE6A 3KRTA 4NPOA 5KC9A 1J5PA 4RW7B 5JH7B 3EZXA 2HQSA 3BEGB 4PPGA 3JATA 1XDGA 2B34A 4R1OA 4RTMA 2XM3A 4CEJB 4LRAA 3N3AC 1SIUA 2DVMA 4JP5A 1ATIA 3DCJA 4KGXB 2NO5A 3MEGB 4NMHA 2F8SA 2AT1B 3AHHA 3TAPA 3A1SA 2FOLA 2DNKA 3OI7A 4OJ1A 1CCWA 1ISIA 1JAHA 5IVKA 3FLMA 2X8WA 5BWLA 2BFFB 1RT9A 3FCXA 1DCMA 3W7AA 1ZK1A 3PC3A 4TQUS 3C3MA 2BM8A 2FE1A 2O4CA 3MUEA 3X3UA 3GU3A 3PYDA 1Q0HA 3A1NA 1M34B 4TGLA 2QIFA 2IDKA 5L1JA 4KFSA 4P9NA 4W82A 1VXRA 4ZPJA 1M2HA 4PIPA 3ZD8A 3H11B 5HRUA 4ZPWR 3V4IB 3PTLA 4IILA 4B08A 2PGNA 1A2BA 5T4EA 1KJJA 5ARDA 2V8HA 4DA6A 3VYTB 1JMKC 1ZNYA 7ABPA 3QHAA 3T9CA 1UFVA 2H16A 4S24A 1XERA 5GV7A 1J9ZA 2GLTA 1T4CA 1V1MA 5A7HA 4RV5A 5I45A 4HAXA 4JI8B 4GKJJ 4B3SB 1J0AA 1X6VA 3N5BA 2QT1A 1DO0A 1WPQA 1PV2A 2MINB 1D8AA 1Q7TA 3NYRA 4D9MA 3P45A 4LW8A 4R98A 3FRHA 3BMNA 1N5LA 3BGOS 4IUDS 4G8JA 4N39A 1O95A 2X3GA 3ER6A 3ZY2A 2C7VA 1HGXA 1SCJA 2LW7A 5CA0A 4DZTA 2DX7A 4KB5A 1S1WA 4FT4A 1HE3A 3L3CA 1FFXB 2WJZB 1VJDA 1POWA 5CPBA 2CFTA 3FKBA 1XK8A 4RW9B 1GLGA 2HAEA 1SIBE 2D7JA 3DZKA 2O0JA 3CSKA 3KPWA 3M8YA 5L3VA 3ICOA 4B3TF 4MV4A 4TXMA 4AP5A 1K86A 4Q37A 2B43A 1P33A 2GV1A 2W8KA 4BMXA 3AQ4A 2BV3A 1YJ7A 2OO7A 4A7PA 3D1LA 2VJLA 5HF9A 1EMDA 1CULC 2YY5A 2BGWA 1LNQA 5SY6A 1SBIA 3PNYA 4C7KA 2P4SA 2BJVA 4LYFA 4JLUA 4PRKA 5A4AA 1DKOA 3BGIA 3ZGNA 2RILA 3A3OA 5AM3A 3KDNA 1TMJA 1RLJA 3TZHA 2OAUA 2YX4A 4ZKEA 3RJMB 2ACVA 3WNCA 3K2YA 3RTAA 2ORED 3IPYA 4C6HA 5ETSA 4U2BA 4MYTA 2DXDA 1M6YA 1IN0A 4L0DA 3HCDA 3JVIA 2OCLA 5ALHA 1C1HA 1KSFX 4ICLB 2OTJS 2KZZA 2BT4A 2PVPA 2CF6A 5DNCA 4D0LB 3MTJA 3BTOA 1OV4A 1CRWG 4JJGA 1ISFA 3QLEA 4CLSA 1T8PA 4BX8A 4E2WA 2XVYA 3ZBPA 1CVJA 4R84A 1NX9A 1YAJA 5EN4A 2QBYB 1E5LA 2RDDA 3UYKA 2G88A 3R3ZA 3UJ6A 2XUFA 4Z1MD 2CVQA 4CLKA 2OAP1 3HHDA 3BG5A 1JG6A 2GCNA 2IPAB 3CWCA 4E2FB 2ZIGA 5C31A 3KS9A 1G20B 3Q8VA 1CWUA 1HETA 4RMNA 2IITA 1K92A 1T9BA 2AE2A 3CZCA 5JD5A 3E7PA 2O8CA 3UAYA 1YAHA 3PWZA 4WPAA 4AZ3B 4UEJA 2R7NA 3O4GA 1VCOA 221PA 1MA0A 3WL7A 5EWMB 4IH5A 4FFMA 4DNQA 1RWOA 2DULA 2ZE2A 1YZLA 4NJMA 5I7WA 2YC4C 1KKMA 1E77A 2ZD1A 4CLWA 2ZH8A 1ADBA 2X9GA 2ZQ5A 4FI3C 4LF5B 2YY7A 3TPCA 1WBDA 5JMTA 3U3JA 1VQ9S 1C1BA 3BIXA 3H0EA 3TKYA 4DCOB 1ONPA 1U0SA 3O8WA 1JHDA 3SS7X 3F5QA 3J7AC 2HPUA 3ESDA 1K0TA 1I2ZA 3AF4A 3KL4A 3DGEC 1BQ4A 1W2WB 4LYGA 1HWUA 1P2BA 2GO9A 1E2IA 4ITVA 2P9YA 4QHSA 1GNKA 3T1HF 1AS3A 3HCOA 4RABA 3WRYC 1T2UA 2Q8NA 3FJOA 5KB3A 5KREA 4ZICA 3E9RA 1FTGA 3OIGA 1OSNA 1SKYE 1PRYA 2WFZA 4MQMA 1DQYA 5HUHA 4P93A 4BPBA 1GCAA 4WYWA 1P8JA 1RBOB 4MWSA 2EWMA 1NC1A 1JEYB 3UJDA 2D5AA 3BEDA 3GRZA 4WINA 4UEOA 4KKXB 1PK7A 2ZBEA 4KXLA 1AO3A 3RUHA 3E9MA 4O4JA 2ZJRQ 2WF9A 3WKDA 3AETA 4DMFA 2VPZA 1RGVA 1U8TA 5TMPA 2LECA 4ETWA 3AQIA 4JKOA 3V00A 1YZ6A 3QKTA 3RVKA 1JXEA 5ER9A 4MMXB 3OM9A 2QRJA 1TTQB 4AJIA 1DS6A 2H8KA 3GIDA 3HM9A 3JSBA 3KZOA 1YU6A 3IVRA 4MZXA 5CFMA 3EZLA 3PKZA 4DLNA 1K06A 3MBKA 1RYYA 3ZIAD 1KR4A 2MCFA 3VHLB 2BE9A 3LP0A 1UIRA 3HZEA 2M32A 1GTHA 4QIEA 2CK3D 1WUIS 1TTHB 2C7BA 3KSBC 4IIXA 4A73A 2GHWA 2ADCA 2BFPA 1ETUA 2ZLBA 3OTIA 2EF0A 2UU9J 4CTAB 3G71S 2CHGA 3U0VA 4IEFB 3UV7A 2N7CA 2PQ2A 3M2RB 3KDSE 5EP1A 2JLXA 3JQFA 5B0FA 3N6XA 1Y8RB 4EHHA 5ESRA 1VIYA 5CXUA 4PX5A 2PKRA 2YV5A 1WHSA 3NBQA 5ITZA 2R62A 2J7UA 1XMOJ 4LSLA 4OL8A 3T9ZA 1H2XA 3M2PA 1HR0J 4QFCA 3COPA 4L1KA 2FXVA 2IV2X 2F4NA 1KFBB 3D6FB 5C24B 4QAQA 2A58A 4KN6A 5AVZA 2XOKD 2CNOA 2E85A 3MS2A 2B8EA 3C6UB 4OJQA 4HG2A 2OXIA 3AW8A 2ZPAA 2UXDB 4ZI5A 3DMHA 1UODA 4E1BA 2C83A 1SVWA 3RARA 4AP9A 4QYRA 2QTTA 3VO1A 3GG1A 2VBCA 1YMUA 1K8QA 5F52A 1WCYA 1CSJA 4TWRA 3ZE7A 4QATA 5HQMA 4IIEA 3G6VA 3BB1A 5SZJA 4Q3BA 3HXLA 2CSXA 3IR7A 4J03A 4F4UA 3QYPA 1UC5B 4TTSA 3BE5A 1WTBA 1VRTB 4AQYB 4WH0A 4BJ1A 3Q2SC 3AVYA 4PSAA 1SBTA 5G1OA 1YL6A 3RYHA 3AQOA 2BW7A 1EE9A 4C07A 5CDYA 4E7PA 3VTFA 4QXOA 2QENA 5DO2A 2GMJA 3HB7A 3Q86A 2BY4A 4JR0A 4I19A 4KPGA 5L7WA 1TKAA 4KXFB 3I0NA 2QNIA 3G2PA 4UHKA 1E94E 2R8BA 1FRKA 3Q3HA 1HNWF 3UT5A 4C4AA 2QI9C 2LEAA 3GRCA 4CYMA 2ATCA 2CJYB 1WXFA 4DR3F 2GDZA 3D6HB 2BWJA 5BSMA 4PGFA 1ZDMA 2C2XA 2M0GB 4GO1A 1DBVO 1O9GA 3BJMA 3R7DA 3QU7A 2J4DA 3HHLA 2VOOA 5J2TF 3CJQA 1YL7A 3NONA 4KR2A 1KSJA 3RS2A 4H4MB 3HA5A 3LM8A 3FWZA 3FTCA 2OXRA 2BPOA 5CAAA 1KMIY 1FK9A 2JA1A 2PQ6A 3KQUA 3UGTA 3Q9NA 3RSCA 1DRUA 1MAAA 3M49A 2C99A 1ZM2A 1Z3IX 2GERA 3WO1A 3GFBA 3QJYA 4FCCA 4EJSA 2DSTA 3VHXA 4EIWA 4OVKA 1M73E 4LEIA 3UENA 1E62A 4J2HA 3OFNA 4DG5A 5K0ZA 2VLBA 4OYXA 4Q9JA 4HYKA 1AF7A 3ZS8A 1PAUA 1RADA 1S1WB 1XNGA 4G5XA 4H0NA 3CZ4A 3RHZA 3EHDA 2RH4A 4N6OA 5BWNA 1UBJS 4F46A 3AVUA 1EINA 5D87A 1W76A 1SC4B 2Z43A 5HVGA 5I8ZA 2X2PA 4IXWA 1UAYA 5FYDA 2YQ1A 2L0XA 3HJFA 2VTVA 1QYXA 2YNHB 4QGBA 4DRZA 3WTCA 1NK9A 1H94A 1AO0A 4FLMA 1DKMA 2CC2A 3KUUA 4IH6A 4PNEA 4EA7A 3TJAA 1A5SB 1G98A 3GJQA 4A2CA 1WZEA 1HZJA 3PL1A 2YCBA 3CCVS 2PUBA 1XCPA 3HPQA 5KYYB 4NL4H 3JXOA 2G0IA 2CCJA 3O1JC 1H4VB 2R5FA 2ZOMA 2UXCB 3L0OA 2K3IA 1QB7A 3FRIA 3G0OA 2Z8XA 4YAFA 4RTKA 4QOFA 1YMVA 3DA8A 2L2QA 3NRCA 5DHAA 1FNSA 4DLTA 4DR7J 3WZ0A 3LCUA 3W5JA 1Y1LA 5B30A 2B7CA 3VPFA 4QFMA 4EEZA 1N4AA 1CDZA 3H87A 1WMFA 4FZVA 3UH0A 5CLGA 4XFKA 5J2PB 3TQSA 3F6YA 1GPWB 3CUVA 2WTXA 3TMAA 2XUDA 4E2ZA 4OTZA 4D1YA 1KO4A 3OVAA 1I9CA 1XQYA 3S68A 2V67A 3L40A 4JR1A 5KTRA 5LU8A 2RD2A 4LBHA 3BBPA 3QA9A 2XMMA 4ECRA 1F2HA 4AG3A 1UWKA 4CLEA 1WWKA 4QDUA 4PR0A 3VPHA 4TSKA 1J1ZA 3W63A 3QLJA 5EQFA 3JATB 1A9PA 2Z2LA 1KPGA 2XBLA 2ZD1B 1LX7A 2F63A 2WYUA 1P1IA 3SMQA 2ZH6A 5HZMA 2GVZB 1RWOB 4NE2A 4JN6B 4NKRA 2HYIC 1TIPA 3NGXA 5IK2A 1PGQA 1CE8A 2JD2A 4AN1A 2EDAA 5JY1A 1Y9DA 3LLSA 4UY8T 2XLCA 1HEIA 4ZYVA 4BNVA 3EXHC 3AP1A 5THQA 3VC2A 2AMVA 3A9CA 3C19A 4ZPVR 1QTMA 3A8EA 3JR7A 2Q29A 1DG1G 3DO8A 4N7RA 3LWNA 2WWWA 1YHNA 4IV5A 5KYVA 3U4QB 4DR2F 5EI5A 4JVLA 1ONSA 5GGYA 2PLAA 1R4AA 4DBQA 4Z1MA 4EFMA 4PRZA 3ADPA 1AXEA 1E9AA 1VE9A 5I8WA 3LAMA 2PBLA 4GKBA 3K5IA 2N82B 4RJKA 1D04A 2X41A 5JD6A 2CAJA 4WP3A 3AXMA 3SWWA 3MN1A 1KFEB 4KUGA 1X14A 2TS1A 4HFRA 3MA0A 1KHHA 3BDVA 1B14A 1M1ZA 4F60A 3NBUA 1A9OA 5EXSA 1Y5RA 3BEOA 3FMVA 1EFVA 5KT3A 3TRKA 5HROB 4RD6A 2VJKA 1PYOA 1O54A 3EBOA 3RWMB 4A0GA 5JRZA 5C34B 3FDZB 2R7WA 2WSFC 3ZFVA 1O6ZA 2B8NA 4EUHA 1UFKA 4FEEA 2C00A 2R1VA 4OQMA 3ASVA 1MC1A 4IDNA 5AVSA 4DL4A 4HGRA 5I9IA 2GXAA 2G09A 4MJXA 5CYQB 1PEYA 1JB1A 3HCEA 2BFEA 4DR7F 3RYFA 2EYUA 3OFSA 2CNBA 4IDEA 1NR7A 1FYVA 1LPMA 4L22A 4X93A 3WMXA 4KWCA 5KOXA 4ESOA 1KL7A 4O4GB 3Q4GA 4UU0A 4CI9A 3IWXA 1LXJA 2HNZA 3W05A 1J2RA 1ZEMA 3O8LA 3LUBA 1RTTA 2BLLA 1GTZA 2Z9DA 1WLYA 3KEFA 3NT2A 4CR8A 3UGQA 3GGPA 1DTQB 4WERA 3KKEA 3KUEA 5F98A 2C22A 1K5DA 5DYYA 5B2ZA 2Y8YA 2R42A 3AUKA 3C3PA 4URUR 2HWKA 1GU7A 4F04A 4KKOB 3TW8A 1KEEB 4YRRA 3GRYA 1SV5B 1T13A 4FKMA 3GAFA 4L8WB 3IV9A 1U7XA 1Y5NB 2D3UA 4PG8A 4Z9BA 2CQ3A 3B89A 1IQ0A 2Y1IA 1UJ2A 1PW7A 1TO1E 4IKEA 3GNLA 1R27B 3JR3A 3VR6A 4ZVEA 3L6BA 4Q4JA 9GPBA 1AT1A 4GQBA 3MERA 2W7AA 1XFAA 5E1BA 2FUKA 5T8KC 2B2NA 4NXNB 4BGIA 3DXZA 4LKRA 2EKBA 1N2ZA 3D2BA 2NYRA 2V7VA 4PXCA 3CEDA 2WWIA 2DGWA 1XAHA 1Z4OA 1BQMB 5LYYA 3GFFA 1BDJA 1RWWB 3AFGA 1MENA 1X7XB 2QTMA 2YR0A 2N3ZA 5KKNB 3BPDA 3CEAA 4G36A 4HB3A 2L41A 4CEIA 4QGHA 2C2RA 2IV3A 3FMBA 4PSVA 1HNXB 4ECXA 2GCOB 2MGZA 3SFZA 2H4XA 3FGZA 2PRIA 3Q89A 1JAXA 3R24A 4Y2XA 1SK9A 2X0NA 2H5JB 1AGNA 1K27A 5CFQA 2GAOA 4DKJA 4OYHA 1YR1A 1AVTA 4U9IS 1BMFA 1QZUA 3FMPB 3PJWA 4EYIB 1TLFA 1ZONA 4HYYA 1Q8IA 2H17A 4Y2YA 2D54A 5I4BA 4P3XA 4OLHA 2HLDD 2LEPA 1HX7A 1GM5A 5REQB 2BFDB 3RB6A 4UBIA 2AC2A 1E3QA 1Y6JA 4Q00A 4BFXA 3H5UA 1IG3A 3R6WA 2XE4A 3NBKA 4AKGA 3NDJA 4Y2QA 4FR2A 1NVAA 3HFJA 5LXRA 1KQGA 3KZMA 3OVMA 1Y8AA 2R7VA 1L4EA 1SHJA 1ZUNB 3KTFA 4WOBA 1RT7A 1HFWA 1GMWA 3ZDCA 3A9UA 3K8WA 3EXEB 4RBTA 1NQXA 2GZMA 4Y18A 2FJEB 1KO1A 4HUTA 2GA8A 3PJ9A 3UK2A 1YTLA 3A04A 4KO0A 4TQSA 2PZAA 1ZK2A 4GDFA 1GQFA 3GCWA 3BYRA 2ZH3A 3W0LB 4P3KA 4C88A 3MFYA 1S0NA 1QRUA 3FTEA 4X92A 4Y6QA 1PKEA 2LQ9A 3S6EA 1KBOA 3N3BC 4LF5F 2ZVPX 4NU0A 1QP8A 1FDSA 1CS0B 3EW7A 3WIVA 3GEIA 2EFHB 3FNHA 3UICA 2YW9A 4KPYA 4MQ6A 4DQSA 1G4CA 1ZR2A 2ZBRA 4CM4B 5ILOA 1CF4A 3GUCA 4P83A 3HMJG 2YJGA 4JUFA 2O54A 3ENKA 4TX1A 4IV8A 2A0FA 1PS9A 2BEJA 3M6IA 4A0FA 4TVKA 4HFNA 5ALXA 4IIJF 1YU9A 1BQEA 4UOEA 2R8ZA 2JG3A 1ZA1A 2GFHA 3D68A 2V1XA 2GQCA 3PX4A 3R2CJ 5ITWA 1UBSB 3A3NA 4ERDA 2QM0A 4HPWA 1U2GA 3NWOA 1Z2PX 1L5HB 4O3OA 2HG4A 2PSSA 4X4NA 3IAAA 1Z4IA 3OIVA 2CD9A 2OIHA 3PBKA 4UREA 1UCFA 5KFMA 1ZJWA 1LY1A 1FE4A 3HKCB 1GCGA 1YRYE 2V5VA 2FU5C 1OYVA 3OTBA 2J9XB 1FPMA 3SVZA 3PXGa 1O5TA 4Q16A 2F64A 3SFUA 1C4KA 2IYSA 2VHUA 1RWNB 4CLTA 1D2MA 4WXEA 5F2OA 3DV2A 4X97A 3Q5DA 3B6EA 2BGGA 3U80A 4P81A 2I3DA 1XZJA 4X84A 1JBEA 2BGIA 1O9BA 2QT0A 2XTNA 2ZYRA 1OLXB 2DY1A 3HVHA 5J5VA 5GZ6A 1T10A 4HHUA 3PXBA 1TZ2A 2WU0A 3VH4A 3IGVA 2I65A 2JAPA 1M5SA 2ZI4A 3I32A 1VFNA 3MJFA 2XRYA 1VSTA 4E21A 3NIFB 3UJ9A 2VHTA 3IM8A 4YR2A 1JDSA 7MDHA 4E6PA 2V34A 2VP4A 3HD1A 4YMLA 4E4TA 1RKIA 5EWFA 4UOQA 4IMIB 4IJ5A 1T5IA 2QTRA 4BNXA 2F9DA 4NBWA 4F0HA 4G26A 3OZUA 4PAOA 3EGZA 3UO0A 821PA 1AK9A 2YKAA 1A9TA 4BYGA 3DUFA 3GJQB 1IKYA 2XSZA 5BQFA 1D1TA 1ZLXA 4CIWA 2KSQA 4LK3A 5F3RA 4IEEA 2HTFA 2IE0A 5I7UA 5EEGA 5IBRA 4WYLA 4P92A 1B3TA 1E2PA 1Z82A 4UE6A 3SSQA 3OOWA 1VE3A 2IYYA 3J7A1 5A6SB 2FSHA 1ZMBA 3BZBA 3ETLA 3ZGVA 2HO5A 2XF8A 3PJDA 1XPJA 3QFWA 2V68A 5KSZA 1KJYA 2FUG6 9RUBA 3ZEAA 4QTTB 2E1PA 4ZVSB 3K2IA 1Q83A 1R6VA 1PLLA 2F40A 4ZCKA 2PMDA 4MKXA 3RVOA 3ZHBA 1FT8A 1L3UA 3E0XA 2W0MA 4B6PA 3D02A 5ETQA 7REQB 4MVJP 2C2OB 4EJSB 4NLOA 2B0GA 1SXJE 1RKQA 4RS4A 3IR5A 1ZH0A 1TUEA 1JSRA 4Y2KA 1BD4A 3IALA 3RSLA 2H11A 1PD0A 4AROA 2R48A 1WUTA 3TPZA 1U4SA 3NEJA 1PN3A 4AFFA 3RVJA 4N5LA 2PGOA 2ID8A 3Q5GA 2GBLC 1RE0A 3TBHA 1NW4A 4BBPA 3FFAA 3G9CA 5IFLA 4GE3A 1CP3A 3R7SB 4A8XA 3LALA 3LUPA 3ILIA 5E41A 8ATCA 3RSHA 4A23A 3D6HA 4ND8A 1RHKB 3PDNA 1IDOA 4URSA 1LLFA 5DWQA 1JLGB 4RPFA 3KLVA 2F1HA 3J7ZT 5KFNA 1XEXA 1K68A 4EYHB 1XMIA 1E0JA 3WX0A 4ETIA 5M04A 4DIUA 3L6UA 2YWCA 4JL8A 2AQKA 2PUFA 4WGFA 2EKZA 3PRBA 1M6VA 1QRSA 3PV0A 4WIIA 4AY2A 1FTSA 3B3AA 1PZEA