4ATNA

Crystal structure of c2498 2'-o-ribose methyltransferase rlmm from escherichia coli
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
357
structure length
356
Chain Sequence
MNKVVLLCRPGFEKECAAEITDKAGQREIFGFARVKENAGYVIYECYQPDDGDKLIRELPFSSLIFARQWFVVGELLQHLPPEDRITPIVGMLQGVVEKGGELRVEVADTNESKELLKFCRKFTVPLRAALRDAGVLANYETPKRPVVHVFFIAPGCYTGYSYSNNNSPFYMGIPRLKFPADAPSRSTLKLEEAFHVFIPADEWDERLANGMWAVDLGACPGGWTYQLVKRNMWVYSVDNGPMAQSLMDTGQVTWLREDGFKFRPTRSNISWMVCDMVEKPAKVAALMAQWLVNGWCRETIFNLKLPMKKRYEEVSHNLAYIQAQLDEHGINAQIQARQLYHDREEVTVHVRRIWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Rlmm, the 2'O-Ribose Methyltransferase for C2498 of Escherichia Coli 23S Rrna.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords RIBOSOMAL RNA LARGE SUBUNIT METHYLTRANSFERASE M
total genus 117
structure length 356
sequence length 357
ec nomenclature ec 2.1.1.186: 23S rRNA (cytidine(2498)-2'-O)-methyltransferase.
pdb deposition date 2012-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01728 FtsJ FtsJ-like methyltransferase
A PF18125 RlmM_FDX RlmM ferredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2810 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4atnA01
3.30.2300.20 Alpha Beta 2-Layer Sandwich THUMP fold THUMP fold 4atnA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4atnA03
2QRVA 3DXZA 4X61A 4ER7A 4F86A 4ER6A 5HOQA 4PYJA 4ISCA 4RTOA 2PXCA 2AOTA 3EVGA 5DWQA 3KPVA 3OFJA 2F8LA 2OB2A 3KQVA 5DXAA 2P40A 3LBYA 3FPEA 1G55A 4G56A 4MQ4A 2ZFUA 3JWIA 4QPPA 5GP1A 4DM3A 3UJCA 1JQEA 3MQ2A 2JJQA 4YMGA 1YB2A 2GAFA 1UWVA 2P3LA 1HNNA 1RI5A 1XCJA 3SVZA 2NNWB 4YUWA 3PX2A 3CJQA 4L7VA 5EKXA 1L3CA 3CKKA 5JUWA 1OR8A 1VL5A 2O57A 4RV9A 3UA4A 5LQNA 1Q0TA 1G38A 3P2KA 3FTFA 1XTPA 3A7DA 3GDHA 5BP7A 2P3QA 1QZZA 3SXJA 4DF3A 2FK7A 5DT2A 2PX5A 3BWBA 5K01A 3OZRA 5DRTA 5DM4A 1WZNA 4AX8A 2ZZKA 1NW8A 3GRZA 3KQOA 5KVAA 2XYVA 4P58A 3KR9A 4EK9A 3V97A 1L9KA 2Y1WA 2ZCJA 2PJDA 2YVLA 1F3LA 2CMHA 2JH8A 5FUBA 2GLUA 2QRVB 3R6TA 3T7TA 3LSTA 4LECA 3R0QA 3LCCA 2FRXA 3A4TA 3ER8A 3T7SA 2AZTA 2BR3A 3GJYA 3HCDA 5HIIA 3LCVB 3GU3A 3GXOA 4EVIA 1U2ZA 2V74B 1INLA 3K0BA 1VPTA 3I53A 4YUVA 1BKYA 3M6XA 3G8BA 1NV9A 2C7RA 3BUSA 4PYIA 2QM3A 3OE5A 2XVMA 2IH5A 1KPGA 3EVDA 3UJ8A 3EEOA 1ORIA 3C3PA 4RWZA 1MHTA 2ORED 1AF7A 2K4MA 9MHTA 3JWJA 3BKXA 3LPMA 4P7KA 2VDWA 1XVAA 3KU1A 5CM2Z 5E9QA 3CBGA 2CKDA 2PXXA 2NXCA 5DTQA 2QE6A 2AN4A 3GRRA 3IV6A 3KPJA 1VE3A 5EEHA 3PVCA 5K0GA 1IY9A 2CMGA 4RTNA 2FHPA 3M4XA 3OPNA 1NW5A 3DR5A 2CWWA 3DXXA 4HRAA 1R6AA 2GPYA 1I9GA 2YTZA 1SUSA 2OB1A 2PX4A 2ZVJA 1R00A 4V0QA 3DMFA 3DMHA 3GWZA 4PCLA 5HIMA 4CTJA 5E1DA 4PGHA 4PYOA 4QVGA 1FPQA 3EMDA 3TKAA 2PSSA 3TRKA 2FCAA 5GWXA 1KR5A 1WG8A 1AV6A 3V8VA 3ME5A 4DA4A 5E9WA 3TOSA 1YF3A 3U81A 2I7CA 3P9NA 3DXYA 3KQSA 4FZVA 5LQKA 1P1CA 1WXXA 3ELYA 4E2ZA 2AOUA 3PB3A 1ORHA 4F84A 2UYCA 1EIZA 2O0LA 1DCTA 4RX1A 1DUSA 4MTLA 4C04A 5CCXA 3OFKA 2V7EA 3BKWA 2XYQA 1XCLA 5DX8A 5FCDA 4GOOD 2B25A 3AXSA 5FHQA 4A6DA 3WSTA 1JSZA 4RVDA 4EKIA 3H2BA 5E2BA 5KQRA 1RI3A 1ZKDA 4KIFA 2BH2A 1T43A 5DPMA 1JR4A 4QTTB 1VBFA 2ZTHA 2PLWA 1DL5A 3HNRA 2AOTB 1EAMA 4RVGA 4KDCA 5EHGA 5K0EA 1NE2A 1VQ1A 2PX2A 3HA5A 3KR2A 2ZULA 2IBSA 4BLWA 5H02A 5EKUA 3DTNA 3FRHA 5D1NA 1JTFA 5BXYA 2LD4A 5DRYA 5CVUA 4AZVA 5K0CA 4KRGA 5GOZA 3THRA 3GRUA 4EKGA 3P2EA 3LDUA 5GIPE 2OYRA 4K6MA 5E1MA 3A26A 3BWCA 3G88A 2A14A 2OZVA 2UYQA 1AQIA 3I9FA 2EJTA 3KQQA 4C4AA 5K09A 1PRYA 1ZGJA 4MHTA 2PV0A 1BOOA 1X1AA 3AXTA 3FZGA 1JG3A 3FTDA 4P7GA 1RJDA 5BW4A 2C7OA 3C3YA 3NVMB 2FYTA 3L8DA 3SMQA 5HZMA 2G70A 2H11A 2OPBA 4KVZA 1TPYA 2YX1A 2ZWAA 1YFLA 5HIKA 4DMGA 2KW5A 4WXHA 2H1RA 3OU6A 2VDVE 5C1IA 3UJ6A 5DM1A 5EZSA 3FPFA 3FYDA 5G02A 1BC5A 1XDUA 3MCTA 3R3HA 1WY7A 3B3JA 2UZ4A 3LDGA 2NXNA 2IH4A 4B17A 1RI1A 4Y30A 3B3GA 2PBFA 1ZGAA 2R3SA 3GRVA 3EGEA 3DLCA 3PLAE 2HTEA 3PT9A 1D2CA 4CXMA 4KWCA 5T64A 1SKMA 3FPGA 3HM2A 5DTMA 5LR6A 3C6KA 4C08A 1P39A 3GRYA 1X19A 4DKJA 5C0OE 4E31A 4YV0A 3PTAA 2PWYA 3KQYA 4QDKA 1QAQA 2HWKA 3EVFA 4RTQA 2I9KA 3KR0A 2PWPA 4FT4A 3SSNA 2P3OA 4OBXA 5FQNA 3VYWA 4C06A 1EQAA 3LCUA 2EJUA 4R05A 4RTJA 3M33A 2QY6A 5K0FA 5FHRA 5CUQA 3A27A 4PYNA 3IYLW 4X63A 3THSA 3I5UA 2VZ9A 1JQ3A 1YZ3A 4KW7A 5HIJA 5GM1A 2WA1A 3G2OA 4HGYA 3M70A 3MERA 4PONA 3T7RA 2P7IA 2BZGA 4YMHA 3LDFA 8MHTA 1R8XA 5E2AA 2JH9A 3FTEA 3KPUA 2ZZMA 4LWOA 5K0LA 3B5IA 1NW7A 1I1NA 3EVBA 1VP3A 2ZW9A 5KQSA 4R8SA 4BLVA 2ZLBA 2E5WA 3ORHA 2B3TA 4M37A 2FPOA 5DM2A 1R74A 2OBFA 3NWEA 4QQKA 3CC8A 5EG5A 3E23A 3ERCA 5U4XA 1EJ0A 3MTIA 3O31A 3BWYA 4FSXA 1FBNA 1XDSA 3FUTA 1TW3A 2IGTA 4FGZA 5CVVA 4HG2A 3EPPA 3NJRA 3NDJA 3A7EA 3QOXA 3MTEA 3QV2A 5HFJA 5P8WA 2AN3A 3TM5A 2EFJA 1L3IA 3B7PA 3BGDA 1QYRA 3G5TA 3GO4A 3M6WA 4QTUB 4X1OA 3TM4A 1YFJA 4IWNA 5FWDA 4R6WA 2ZIFA 3FPJA 4GOLD 5E1BA 4ER5A 4OA5A 4POOA 3PFGA 3ELUA 2GH1A 3FTCA 3DMGA 1YZHA 3OZTA 1G8AA 1H1DA 3BXOA 3G7UA 4C07A 4Z2YA 5EMLA 1SQGA 4MIKA 5K8VA 3FPHA 3VC2A 2ZIGA 5LQUA 2ESRA 2R6ZA 2B9EA 2N47A 4PYQA 3LL7A 2BM9A 1KXZA 4XCXA 1Y8CA 3M6UA 5EIWA 2P7HA 4PGGA 5KS2A 3FUVA 3KPWA 3JWGA 1RI4A 4X41A 2G8NA 1NV8A 3OZSA 1FJXA 3O7WA 2AOUB 3BZBA 3REOA 3S68A 5GIOE 2AOVA 2I62A 1P1BA 5FA8A 4RVFA 2XBMA 1KHHA 4P7JA 5K03A 5M5BA 3SM3A 1V39A 1UIRA 2PGXA 1BHJA 2OXTA 3G5LA 3HTXA 4RVHA 3FUXA 5ICEA 1NKVA 2XYRA 3NDIA 4UOEA 3ID6C 3EVAA 4HC4A 4KIGA 1QAMA 4OQDA 1NBHA 2CL5A 5B1SA 5T67A 1IM8A 1P91A 4E2YA 4FS8A 4IV0A 1O9GA 2ZBPA 1Z3CA 2JHAA 3AJDA 3FUUA 5E8JA 1KYZA 3Q87B 4BY9E 3E05A 4HTFB 2YR0A 5EZQA 4FSDA 1R18A 4CKEA 3HCBA 1G8SA 5EC8A 4DZRA 1EG2A 2O07A 1D2HA 2OKCA 1JTEA 3HP7A 3UWPA 2ERCA 2EX4A 3IHTA 1IXKA 3P9IA 2JHCA 5EIFA 2YUIA 3HVIA 4AZWA 4E33A 4OA8A 1NW3A 2AR0A 3E8SA 3SGLA 2AVDA 3HCAA 4WVLA 1QANA 3CGGA 3LECA 1MJFA 5DSTA 2YQZA 5HILA 4IV8A 3SSMA 4BLUA 4CKBA 2P41A 3R24A 3F4KA 4YUXA 3HCCA 3X0DA 4RTSA 3FRIA 3OU2A 2WA2A 4FT2A 5DX0A 3P97A 2PY6A 3TR6A 5GINE 3BT7A 3KKZA 3P8ZA 4QQNA 2AS0A 5K05A 2BR5A 2ZWVA 3A25A 5FULA 3ANXA 4E32A 2ZBRA 3ELWA 4AUKA 4GQBA 4P7FA 4JXJA 2Z6QA 3HA7A 3I64A 2HV9A 3UJ7A 3ELDA 1AQJA 4YUYA 3UJDA 3EEYA 2PT9A 4HTFA 1RI2A 3SX0A 1KPIA 2OO3A 3P2IA 4KDRA 3TPZA 4PYKA 2NP6A 3R9XB 2Z6AA 4GF5A 5D1HA 4PIPA 2H00A 3HVJA 2IPXA 3IEIA 2PXAA 3ER9A 3RW9A 4FR0A 4BP1A 1SG9A 3G2QA 3EVCA 5IKMA 2BR4A 2HNKA 5K0JA 1XDZA 4QVKA 7MHTA 1JG4A 3K6RA 2I6GA 4QDJA 4M36A 4OBWA 4CKCA 2G71A 3HCEA 5EGSA 2ONZA 3CJTA 2PKWA 4OX9Y 10MHA 5EEGA 3MAGA 5LQRA 3DULA 4YV2A 1VIDA 1XJ5A 1KP9A 1VLMA 1FP1D 3NWBA 3PX3A 2UYOA 3VSEA 3DH0A 4RYLA 5HEKA 4YV1A 2C7QA 3CCFA 3KQMA 1WXWA 4HH4A 5FWAA 1TW2A 5ICCA 3EGVA 4PNEA 1M6EX 4R8RA 3KQPA 1F38A 3RIEA 1KYWA 3KQTA 1KIAA 1HMYA 2IDJA 3EGIA 4E2WA 5DM0A 2B2CA 2P8JA 2NXJA 4GOND 2AN5A 4O29A 2G1PA 4EMSA 3EMBA 2QYOA 4GEKA 4ER0A 5KYGA 4AZTA 1NW6A 2NYUA 2WK1A 5DTRA 4RTRA 5DLYA 1ZHFA 2BM8A 5LQAA 3BGVA 5F2KA 2P35A 3C6MA 5EMKA 1M6YA 2AOWA 4U7PB 3NTVA 4R6XA 1R8YA 3KR1A 5EPEA 5BW5A 3B3FA 4AZSA 5FADA 3I58A 3MB5A 4Y2HA 2ZZNA 4QPNA 2UYHA 4RTMA 3TKYA 4ZTBA 4XUDA 5CIYA 3KPYA 2O06A 1NT2A 4PWYA 1D2GA 3LHDA 5K0NA 3UFBA 5ICGA 5EVJA 2O05A 3HVHA 3HVKA 3UJBA 4X60A 3UA3A 3AY0A 2ADMA 4DCGA 5EHIA 2DULA 3E7PA 3QOWA 3G8AA 4V0RA 1JG2A 1JSXA 5MHTA 1XXLA 3AWIA 3GGDA 4CWAA 4PYLA 4YUZA 1SUIA 1QAOA 3LKDA 4HGZA 2FK8A 2IIPA 1ZQ9A 3DLIA 1X1DA 3CJRA 5FTWA 4F85A 3MCZA 2P1DA 5LSAA 3GIWA 2ZIEA 3CVOA 5GM2A 4RTPA 3O4FA 4FP9A 4PYMA 4GC9A 1RJFA 4A6EA 3GCZA 3HA3A 3TFWA 3DUWA 3JWHA 4HSGA 3NMUF 3HEMA 2G72A 3C0KA 1SVUA 1FP2A 2YXEA 2HMYB 1N7IA 2HR1A 3SR4A 2VP3A 2OY0A 3LGAA 4XUCA 1I4WA 4GUAA 5DX1A 5E1OA 4GOMD 2NXEA 4GBED 3EVEA 2AVNA 3UZUA 4ER3A 3EVZA 4E70A 3VC1A 1O54A 5EOVA 3TQSA 4RTKA 4E30A 3G2PA 3KHKA 2EG5A 3FUWA 3OE4A 3NVKI 1G60A 2PX8A 2JHPA 1X1BA 2IFTA 3LBFA 2PT6A 3M6VA 2PVCA 2VDUE 2ZSUA 4IKPA 4U7TB 5EMJA 1WS6A 2DPMA 1NBIA 3B89A 1M0EA 5F2OA 5JR3A 3UBTA 5ICFA 4DCMA 4MWZA 3SSOA 2NP7A 4XUEA 5IH3A 1KPHA 1JG1A 5CVEA 1B42A 1X1CA 3BWMA 3Q7EA 3UJAA 2IDKA 1O9HA 2YXLA 5EMMA 2IH2A 2ONYA 2VS1A 4M7RA 4PIMA 2C7PA 5CCBA 3KQWA 4RTLA 5EQJB 5CD1A 1RJGA 1ZG3A 3PS9A 1G6Q1 4LG1A 4RSRA 3P71T 2XVAA 5CVDA 5LQCA 2B78A 3FYCA 3NW9A 3OU7A 3GNLA 5DSXA 1Q0SA 3RODA 5C9ZA 5E9JA 1VP9A 1EJ6A 5F2NA 1N7JA 3DOUA 2AOXA 4M38A 2GA9A 2YXDA 4OQEA 3DP7A 2Z6UA 1SQFA 5DXJA 5LQJA 1N2XA 4CTKA 1UFKA 3LKZA 2ZBQA 3P9KA 1YUBA 5FQOA 2Q41A 3G2MA 3TLJA 4C03A 2GB4A 4NECA 2Y1XA 3BGIA 3P9CA 4PINA 5FA5A 5K0BA 3TMAA 4BP3A 1L1EA 4GC5A 1JQDA 4DQ0A 2IBTA 5E8RA 4PCAA 4E2XA 4H0NA 5CVJA 3UJ9A 4EQZA 3PFHA 1RJEA 3HCFA 1PJZA 2GS9A 3MGGA 1L3BA 4LWPA 5ERGB 2JG3A 4ATNA 3OCJA 3G89A 3T0IA 4C05A 3LX6A 3MHTA 5T6BA 3D2LA 2IP2A
chains in the Genus database with same CATH superfamily
3QLHA 2PGLA 4IJMA 4OYMA 3CE8A 3N6LA 4K8RA 4TU9A 1H0HA 4DFDA 1QH0A 4P6QA 1F3LA 4GLBA 3VQSA 4F96A 2CBXA 1Y3JA 5LDDC 2D2FA 3MOZA 3EJWA 3EOAI 2IL1A 1M5RA 1RQ2A 1JLLB 2GHWA 2Q3DA 1RLCL 2XVMA 1RHKA 4C0WA 2V8GA 2GUGA 1CZKA 4UVHA 3DEJA 3IV6A 1W94A 3PVCA 1JJAA 2FLNA 4TXNA 1WHYA 5FOXA 3GB9A 4BKMA 3FVQA 2GX8A 4XXHA 3GCWA 3JVIA 4RHFA 4II7A 4MYCA 3AUSA 2GNKA 3ZLTA 4LR9A 1JHDA 1G6OA 3NG8A 4ZQFA 3I73A 1T4GA 4MKHA 5DX8A 1R4MA 4DV6F 1VCNA 3RTGA 3WFJA 3OQIA 3W1WA 3D6UA 3QAEA 5KVQA 3RSQA 1ZICA 3SR3A 3QQ5A 2BA9A 2AOTB 2PV7A 5ALTA 4UNPA 4B7XA 4KHMA 4RUAA 3B82A 3ZVLA 3B51X 1MNEA 4M1MA 3W66A 5EJ7A 3OURA 1IOLA 3KBBA 1EVKA 2VYND 5SY9A 1SJRA 4LYAA 3EZLA 2KVQE 2BOVA 2H11A 621PA 2F8HA 4AFNA 4YRZA 1TT5A 4B7AA 3MCTA 1TIKA 4IHJB 1T1EA 3O92A 1YC2A 3SZUA 2FW8A 2QW0X 3BULA 3ILYA 4J8PA 1HI0P 3P4YA 1JLEB 3I01M 1U3TA 4YV0A 2XB6A 1UOEA 4HDSB 1KEZA 2RQMA 1Z9BA 3CF4A 3FLEA 1P19A 1DARA 1ML4A 3ZWAA 3V00A 2CNLB 5CB6A 1Z83A 4MJXA 3V1UA 4DEVA 3GJQA 4ES6A 4BLQA 1A76A 2JJ2A 4G3IA 3BOSA 3P2YA 3C70A 4ZDJA 2FRDC 4R6WA 1H6AA 3ZHSA 1JECA 1R6XA 4ZJOA 3OZXA 4LRBA 5HK8A 2R8IA 1TC1A 4QO7A 5I4MA 2FR0A 2WJPA 4EKYA 1OPZA 4HACA 4HH3C 3ESCA 2PZGA 1CVRA 3TOVA 2Z2ZA 4CJXA 3W9JA 4WK1A 4URXR 1JIQA 3SZOA 3V6KA 1YGYA 2Y1RI 4OX9J 4HVCA 3UICA 2EG1A 1AX9A 4ED3A 4USTA 3M6FA 4YDXA 1P0CA 1U6ZA 1KQSR 3FQKA 2QOEA 1A82A 4GI2A 4PRYA 4DG9A 3M4YA 5MFPA 1JJFA 4MKYA 1M0WA 1EBFA 1VJTA 4WV3A 4A92A 3FMIA 3U4MA 3ET6A 2GK6A 3ZJUA 1U99A 3Q7RA 4MVJD 4DZTA 4L3WA 1DQAA 4LJYA 4JOSA 3X2FA 5IT9U 1BWSA 4YO7A 3HH8A 4NICA 3D81A 3CNQP 3AIMA 4DWWA 2GGPA 2YZMA 3VKGA 2H2FA 3KZCA 5AUPB 2X77A 3OTQA 4W9NA 2I6GA 2OHGA 5KNDD 2Z4RA 2QAJA 3TSWA 1L7RA 2NO7A 3E5NA 5HEKA 4GOJA 4C6RA 2H16A 4UY8T 4ED2A 4MWDA 5C8YF 3D1VA 5K45A 3DRPB 4II2A 3BEOA 3N0VA 2BX6A 1IUPA 4NZ0A 1Z18A 1UAGA 2VB6A 1F6TA 4JZYA 5JVDF 4A8JB 4GMXA 4P71A 2CVZA 4YAFA 1RAEA 2MSCB 3H5IA 3LKDA 3DLIA 3O0TA 3B85A 5ENZA 1R6VA 3P19A 4OXYA 1XKLA 4FB5A 2VKZG 2QEQA 3KLGB 3NBKA 3R9LA 1R88A 4MPDA 4JI2B 3E7XA 2HV8A 3HABA 2J0QD 3SQGB 4RTKA 1X9IA 2QLBA 3LF2A 1PILA 3ZCXA 3V1KA 1I2AA 5JYEA 3R6GB 3SXLA 5KT5A 1YIOA 3NTOA 3SY8A 2ZR9A 3Q7EA 5KSWB 4WGFA 1T1RA 4D8UA 4PR0A 4W1RA 4FINA 3PC8C 5GAGU 5A2QY 1CQIA 4G6ZA 5B37A 4E13A 1C50A 4OATA 3VZIA 4IRMA 5KJCA 3A11A 1GXLA 5EFOA 2NO5A 4X4OA 4GC5A 5H82A 1J49A 3HUFA 4YB6A 1TTQB 4EQZA 2PH1A 4FGWA 5D3KA 3LRTA 4US0R 1WV0A 3DAPA 2IW1A 1QORA 4NNOA 3MWEB 2G13A 3FJOA 2ZFUA 1OPXA 4LF5B 3TGPA 3BGLA 4YUWA 4DR1B 5FI1B 1IXSB 2R85A 2JFXA 5H9EJ 4DR7B 5JJLA 4JVSB 2BZ2A 2X4LA 3GRZA 1NH8A 4UHJA 5G0UA 5AWFC 1EDZA 4N8SA 1SKYE 1GT91 3W5CA 1BD6A 4CDGA 5E7OB 1C0UA 4HCJA 1O0SA 1KAGA 4RHEA 4WEOA 4ECSA 4MVWA 5IM5A 1PNRA 5AJZA 3EC7A 3IHLA 3S5JA 3CIZA 2ZVJA 3UCUP 1RWUA 1OWXA 3DMFA 4ERDA 4UOFA 4YP5A 1N6QB 3A4NA 1KDVA 3DLAA 4UU1A 1TMYA 4ENUA 1XA4A 4OX9B 1H0RA 4GYYA 2VFUA 2AG8A 4B3FX 4CG3A 4H0FA 3SXPA 3R5AA 2O8DA 2P2GA 4J3JA 1NBEA 2R3VA 1ZUHA 3U4CA 6AT1B 2H54A 2DWQA 5CLQA 3ZQUA 2DNYA 1JMKC 1S2LA 4UXJA 5L95A 4OAPA 5FOWA 5D4NA 3IWXA 1RE1B 3IUNA 3T3OA 1V7ZA 3NVMB 2OPPA 3L3BA 4JUCA 1Y3FE 5K3CA 2Y2UA 1E60A 2P9QA 3RSGA 3P0FA 4P1ZA 4NLSA 1ZGAA 3JZIA 3EGEA 5JRZA 4LRCA 2ZIZA 3T99A 2DH7A 4RZ2A 3W2TA 1FWKA 1R4NB 4BFXA 1G1MA 2DT8A 1QG4A 5JMTA 2Z4TA 1KQNA 2UUWA 2H2GA 5AKYA 5FIIA 3FIJA 3D8TA 1R4AA 1C4XA 2QTMA 4ZPBA 4Y6IA 2BFNA 3K94A 4P38A 2YY6A 1UDAA 3O1IC 5E2IA 3IIKA 2ZUWA 1UXGA 4LBWA 4CMCA 2ZVPX 4EJSB 3FSIA 3UHPA 3B6KA 4FSXA 4NX2A 4ZHQB 1K8YB 4H4KC 2FC9A 3A2LA 4RZQA 4EQ6B 1JE1A 3MCAA 4OKNA 2AYZA 1T4DA 1MA3A 3R0ZA 4YDQA 2IHNA 2QL7B 4XZ3A 3E9EA 1F9EB 2JDJA 3JQ7B 1Z26A 1FMTA 1H3EA 3ETJA 1O6BA 1DRWA 3GIKA 1HHTP 2ZU0C 1H2AS 4KHRA 1DAHA 1EQUA 1TEZA 4F9EA 3E5MA 1M5OC 1G7SA 4XIYA 2BJWA 3TLXA 4ZU3A 2DBBA 3AHEA 1WMDA 4FSDA 1UZDA 3BX1A 3O38A 5DNDA 3HBNA 4CDRA 3SAJA 1YQTA 4KYVA 2LEBA 2P9JA 3RKRA 3K9GA 4L8WB 1YJBA 1T2DA 2X8JB 2DGDA 4QT4A 3F5FA 1VPWA 1M1NA 3HFJA 2RJNA 4NE2A 2EVZA 2ZJ2A 1JV2B 3TAHA 4QHYA 4MXDA 2XLKA 5ETQA 5F9FA 2C03A 2Z6AA 3RRNA 1AF4A 4Y28C 4DMFA 4MJKA 4FI3F 3AGPA 2I7XA 2ASLA 5KFCA 2E9SA 3EXIA 4P0PB 1FTNA 4DU8A 1VHQA 2GEDA 3ZCTA 1UPCA 4KHPJ 3DE2X 1KEEB 4BCDA 1UBMS 3I9KA 2J9FB 4DT1B 1R7IA 2RGEA 2AJTA 2IPAB 1ADYA 5AOVA 3DQPA 3ZY5A 1CERA 3L7CA 3BGSA 4JU8A 3FUCA 1ODFA 3N2KB 4MUKA 5FV4A 1Q7CA 4RY2A 1QHHB 1FDOA 4YJGA 3F3KA 5A5EA 4W1PA 4E14A 2QQEA 3BGFA 1D2MA 2VRBA 1SUIA 5J1TB 3ANMA 1WG1A 3ICEA 1N2GA 1XTZA 1FXUA 3TZ6A 1NI3A 3MFIA 2ABWA 1C8LA 3D4IA 1EFCA 3RE1A 4I4LA 5HQTA 4EB8A 4C2TA 1RRVA 3RUDA 2ZYIA 1G2EA 2QAGC 3VZRA 3DZFA 5F2OA 2IEBA 3BH7B 1RKVA 3A14A 2MQLA 3PXAA 3GPLA 3WC4A 1LQUA 1YMVA 1C1BB 3WB9A 1E8NA 3U39A 2F65A 3TQFA 5EE0A 4PZUA 3M81A 5IK2A 2YOHA 4Q5IA 1XB2A 4ILEA 4W6QA 3PX7A 5IT4A 1YQXA 3LX6A 4IHJA 3L92A 1IN5A 4J16C 4V39A 4WESA 4R1OA 4I7FA 2ZJ5A 3KJXA 5M34A 4UBMA 4QXPA 3OSNA 1J22A 4KQIA 4LHXA 3ZBPA 2HMUA 4AMVA 1WOSA 4D43A 5HQ3A 1TUBB 1M2VA 4CHTA 1K97A 2PMKA 2FX3A 3R6TA 4DV2J 3BMOB 1DRKA 4MPRA 3ER8A 4GPD1 3QRQA 3L0ZA 3RUFA 1RMYA 2DR2A 4NPAA 5JI3E 3W0LB 2DVIA 2NU7B 1N9GA 2Z8ZA 1X9SA 2OGZA 4L9WA 5FA6A 2GN9A 5CB8A 4FPXA 2FSVA 5C5CA 1X86B 5EN4A 2QRHA 1RW4A 2QMUA 5FUVA 1DFDA 1GFIA 3ESYA 4L16A 3REQA 4LI0A 4XJXA 1K7XB 3EMDA 3VQTA 5B36A 2F00A 1QE1A 3O2IA 3LUYA 4D99A 2RB7A 4RX1A 3TZBA 3WYGA 5H9FK 1RABB 1V11A 5IFMA 3PXUA 5HP1A 5I8ZA 1Z12A 1JU3A 2CFOA 4IH9A 1LXNA 4DL6A 3TNVA 2XMDA 1SUQB 1RJ9A 1XVLA 3E03A 3R7WB 1CHNA 3M9MB 2VG5A 1M8FA 4BWFB 2YJ3A 3M8RA 1REVB 3EUFA 4PSKA 3MEEB 3GLHB 1YBAA 2BFFA 3HCOA 3LYAA 3FPSA 3NOQA 4KVFA 4Q7KA 1T9VA 5B6PA 1IJEB 5C1IA 4L3NA 2DLNA 4QUJA 2SCUA 2D3TA 1K06A 3B3JA 3MJRA 1KY5A 1QHIA 1ZISA 3PIRA 3IN5A 3UUWA 1IUKA 1VMAA 4WD3A 4Z3DA 5AK0A 1N0HA 4DC9A 3GCXA 1BJRE 2XI2A 4D9JA 2ZI3A 2F3SA 4NA1A 3WRWA 4M0EA 3X43A 5C3MA 1OAOA 3B3QA 1GZ7A 2K7FA 4NXMJ 1WLYA 3MT8A 2ZHOA 4PHCA 1N6IA 3STVA 2VT6A 5KTPA 3D3NA 4ZU6X 5FWXB 5KFQA 3THVA 1KSPA 4JLKA 3LUFA 1J99A 1GPKA 5KC9A 1H2RS 3OEED 2H0QA 5JZ9A 3DZDA 3WQQA 1KYIA 1SBRA 2AV6A 3F5SA 3NHYA 4C3ZA 2IQIA 3MCNA 1BROA 2BJ9A 4LF1A 2ASEA 3H2SA 3BN4A 3M6UA 1BHO1 4NS1A 3TZXA 2MLZA 3A36A 2H92A 2TYSB 3Q3JB 1IOZA 3A12A 5DDQC 3CX8A 1GAQA 1U7PA 1R5NA 2Z5LA 3WGZA 5D3QA 1YRYE 3TTYA 1K0FA 3M8ZA 5DLDA 3AILA 4G84A 3D6HB 1T3TA 2FGKA 1HBOB 5HRAA 3HVIA 4EPXA 1FCAA 4IFBA 3IIJA 2AX0A 3E7WA 3ZWBA 1NK0A 5KYXA 2XS5A 2ZANA 3H4BA 2I3GA 4KUHA 3MR5A 4I5IA 3R5CA 4KY3A 3ECAA 4L73A 5KWSA 3OR2A 4MR7A 3FNBA 3QFFA 2P5SA 4BP9A 1J97A 1DRVA 1UWAA 3A0RB 2DCUA 5JY6A 1TLFA 5AHWA 4YREA 5GVQA 4GO1A 4QVKA 3F96A 2LKZA 2Q5HA 3DZGA 3CZMA 2G71A 4MW6A 4WZAE 2XUZA 4LTDA 4AQDA 3AJ9A 2HNDB 4EAQA 2OV3A 3DYVA 3N2GB 4AUEA 3ZVNA 1PFWA 1TW2A 5HF9A 5CK4A 2BCJQ 3V5NA 1H4SA 3UD3P 4P32A 4C9BA 4AE5A 5FEMA 2IYUA 3GT0A 3I3SR 1PFGA 3P9PA 3KZVA 2AFIB 4O2AF 4P2BA 1IRIA 2HU7A 3VALA 1YR3A 1ZSVA 2G80A 1NLFA 4KV7A 4IOCQ 4B85A 1KZ7B 4CWAA 1XTTA 1DWQA 3ZZRA 1Y3AA 3DAGA 2VUHB 2ZJFA 3C19A 4LBYA 1NLZA 1UXOA 4OY3A 4ANFA 2MKJA 5IXYA 4YLYA 4NPOA 3QLUA 4LNUA 1IR1A 1N2SA 4LFAF 1KMNA 4LYYA 1LZKA 3ZEAA 5IBRA 4XQGA 4ZOQI 4FB4A 2GVZA 4QYIA 4WAUA 4AZ3A 3DMJB 4OZ2A 1A2QA 3L4BA 3ITHB 4K6KA 3F4BA 3G8DA 2QD5A 5LXTB 1TTHB 5AW7A 3WP1B 4Z54A 5HAOA 2I7TA 1KYYA 3HM9A 4HDQB 2DNMA 3RVMA 2HKEA 1RQLA 4JMLA 5A5FA 1QQ7A 2P6PA 4I55B 2ORWA 1BA3A 3FPEA 1ZJWA 4X20B 1TRKA 3BHJA 3WL4A 3UVJB 1NVBA 1RRPA 3AUTA 2FA9A 5DT2A 2OP0A 4NXMB 5E7IA 1UUFA 4HTIA 1GGVA 3A8TA 5AK6A 3TANA 1QGOA 1KGDA 1X4GA 2E5GA 1IN8A 1JHZA 1Z08A 2DJIA 3FROA 1VE6A 5KTYA 5HWSA 3L7NA 3W06A 3HDSA 3KPJA 1L7MA 4QD3A 1F2UB 1I2ZA 2P9FA 1KZYC 5CJPA 3ODPA 3QFHA 1A6LA 3DCYA 4U3JA 1SQ6A 3UOAB 3K0SA 1N2BA 3V8MA 3L2OB 1DCTA 2VDLB 4R1MA 1NU8A 2DSTA 3MM6A 2B25A 2DFTA 2XXJA 1D2AA 1Y5LB 4MB2A 1ZS6A 2ZBVA 3EIUA 3P9ZA 4CM7A 4YJGB 5KFIA 4O4GA 3N7AA 4ZAGA 4H7IA 1NUUA 1E4EB 4U9HS 1S02A 3D3CJ 5K0CA 2CK3A 4NMXB 4ZVSA 3KHLA 5G0TA 3ZEIA 2C92A 2RKWA 3EA5A 4TV9B 3C6BA 3D4OA 3KYJB 1Y11A 3KDPA 1G4AE 1GJRA 2OLKA 2O4UX 3A1CA 2OORA 1W2WB 1VXOA 2KW5A 3VYRB 2XQGA 4GQIA 3KAKA 2GIRA 1RYRA 4DG1A 3DBIA 4WX2B 3JWPA 1UBOS 5DTEA 2DQYA 3GCDA 4I5GA 3CWCA 3NHJA 3D7KA 5HQ3B 2PRYA 4NR0A 5EMNA 4DKJA 3MJHA 1S72S 3AT1A 3WIEA 3WNBA 2QIOA 2VYNA 4X8MA 2ATLA 1JSCA 3O26A 2X1HA 2RNEA 3DOHA 1KMMA 1J7KA 3G0DA 5G40A 3HGTA 3TG8A 5I9SA 4DCOA 1XNQB 2OSVA 1PVVA 3UHOA 1YFJA 3N2KA 2WYVA 4V03A 4DV4B 4OOEA 2XXBA 2NO6A 4FKXA 2HBRA 1QPGA 1HYBA 3REGA 1Z7WA 4EJ6A 2BGWA 3WKEA 3HYTA 2NUAA 3O4JA 6AT1A 5FLYA 3UUGA 2HQSA 4LY3A 1Y10A 3BDAA 3DKDA 2P6SA 3JQ9C 1KARA 3RBZA 1KYZA 4IDKB 3EZ6A 4P82A 2YYYA 4UTGA 5AM1A 2YBDA 1D09B 3TGWA 1GGKA 4L0CA 4RFLA 3AP3A 3D3JA 2XCOA 5DSZA 1ZEJA 4YJ2A 3HO1A 5JD3A 1BDJA 1WCYA 3D4PA 1TMGE 4O3OA 2V9PA 3R7WA 1SG6A 1S3FA 4IX9A 1E5LA 4DR5J 1E1RD 3EAQA 1MU0A 2HXGA 3SX2A 1VA5A 4LSLB 4Q47A 1JLFB 1YQ9A 2EZ8A 5FBVB 4OX9Y 3CIMA 5CX1B 4IKAA 2C5AA 1W4LA 1J2EA 2WLTA 1N3BA 3UMGA 4JIGA 5JRJA 1E2LA 4B0OA 3LBIA 3N2LA 4HX9A 3UC9A 5J2NB 4ER0A 5C7IO 4FOSA 1HR0F 2J3QA 5ETPA 3NJ4A 1AQYA 4Z0NA 4WIAA 5FEUA 4HF7A 5KAPA 1LW2B 1YBUA 3WZ0A 3Q7TA 5AE2A 3OEYA 3K70D 1SOUA 1HNVB 1ZU5A 4LF4B 1FNCA 2C97A 5KOHA 1N6RA 5ALFA 2XDAA 3C8DA 1BKDR 3ACDA 3U7EB 3QOWA 3V2HA 2WBMA 4J9PA 4V0KA 3TE6A 4OQQA 1NAHA 5DDPC 1QYWA 4FHCA 2CNNA 4FP9A 2W2PP 2EERA 1AB8A 4PXAA 3PV8A 1TL5A 5JH7B 1QZXA 5JMNA 5DM6Q 3KHKA 2QX4A 1FMLA 3GEIA 1H23A 3O8LA 3EDCA 3PEVA 5FT9A 4ZIVA 3ICCA 5ESRA 3Q3CA 1PJAA 2HGLA 1VGRA 2CNKA 2ZKLA 2B5WA 4ECQA 2ALYB 1QTNB 5DSXA 4U9UA 4WPAA 5BMVF 2ZS7A 1YB7A 2Z6UA 3LHKA 3HJNA 3CKMA 2RB4A 4KR2A 2DEIA 1UFKA 1G9SA 4UE2A 1GKLA 4KG7A 2QPTA 1GA4A 3E1KA 2FZ5A 3K92A 1IPHA 1NVUQ 3UDEA 4UAJA 1GZVA 1SO8A 2F62A 2VPPA 4PXSA 4FEEA 4MDFA 1YQEA 3L8ZA 4F86A 4TU7A 1OXXK 1FA0A 1KFCB 4NARA 3KB8A 3GU0A 2BKVA 3WLIA 2BJ3A 3C3AA 3KQHA 5JZOA 2DR0A 2P9BA 3GRCA 1KJ9A 4RNDB 4NC9A 1Z0AA 3KVNA 1W85B 1QLWA 5BVGA 3SXJA 2Q5LA 3BWBA 3KQOA 1SKRA 3ZOZA 3OUYB 1UM8A 4FUTA 1QHHA 4P9NA 1NT4A 3AU9A 5HANA 1D9FA 3FHCB 4C21A 5H4HA 1FTCA 3TP2A 1UBJS 1LWEB 2CB9A 1L7OA 5EJ2A 2QTVB 3CN9A 2WQ7A 1B0ZA 3C3PA 3EPJA 3BSCA 3FNIA 3HO8A 3NEJA 4MR9A 1YVFA 3RADC 1NYTA 4NBUA 1VQNS 3AVWA 5DT9A 5IDYA 4AKIA 2O5EA 3CZCA 3M8QB 4EEZA 1YITS 3UAVA 4NLOA 2FFHA 3CNOA 2RD5C 2BABA 2DWCA 2I0XA 3AKEA 3NBYC 1GMWD 2J5KA 5GWXA 4CL2A 1BXRA 3N6VA 1LPBB 4R2XA 4DR3J 4FD3A 4C04A 2E44A 3PTWA 3PQ6A 4UXIA 1N4DA 3ZHTA 1G63A 5FF9A 1CFZA 4HN4B 4KR0A 4YRBA 2R5FA 1TVKA 4UNRA 4NPHA 4A8MP 3B13B 5D84A 4I1IA 4ENVA 4F72A 4DX8H 1DCKA 3OBBA 3ZTSA 4YJ2B 4CBVA 5D51S 2Z3WA 1G8MA 5FOVA 1LDYA 2VDIA 3GJSA 2CPDA 3EG9A 3OQPA 1Z38A 5TQ0A 4MQEA 1BEUB 3EXYA 4I55A 3DS8A 1YDWA 1MJ5A 4WFZA 4J1TA 3N59A 4GVBA 1AQ6A 2F7SA 2H59A 2ZIUB 1F12A 4H0CA 3K5WA 5FBZA 3RU2A 4JVNA 1ZR2A 4QFCA 1CJCA 4FFDA 1J0CA 4IIJB 4F46A 2OESA 5DTMA 1KTVA 3ZTRA 4Q3OA 4JT4A 3PD1A 2QI9C 2RG7A 3BMOA 4AJLA 2OQRA 3TD6A 3Q98A 4F4XA 5A6SA 4B2YA 1VRVA 3KS9A 3FMPB 2ZOGA 2V34A 3RS4A 4KDFA 3BRSA 4IXTA 4P33A 2HS4A 4LWOA 4XQCA 4J7UA 1RWQA 4C43A 5EPUA 2IW3A 1ONPA 2HBQB 3ON5A 1FFSB 2YWCA 3H42A 3F1LA 4LPKA 4BX2A 2C2MB 3H2UB 1FDUA 4LCEA 1Q1KA 1R0BG 3OPYI 1S1VB 1XAGA 3OR1B 2RARA 5ETTA 3CZAA 3A1FA 4YHBA 2HHUA 3KNAA 2CJXB 4E03A 2KJQA 3EPHA 2GERA 4R8LA 3PGJA 1QAYA 1DEKA 5JSUA 4X1KB 1EVYA 2J3KA 1RAIA 3R3XA 4ZZ1A 4GI1A 4UUWA 2VK1A 2YJGA 2WAMA 2CFCA 3K8WA 4EB3A 2W2VA 3GNTA 3LTOA 4YMIA 2CXUA 4HTFB 5EC8A 3T1TA 2LXIA 5AM4A 2NSHA 4C87A 5K9ZA 4M8KA 4S0XA 1RACA 4KAFA 2IXDA 4JWKA 4FT2A 4CLPA 1Y00A 3QHAA 4DDFA 3G0OA 3H5SA 1KVIA 2JIOA 1JJIA 1KPIA 4F3CA 4HYQA 4EO9A 4YGXB 2NP6A 3BB1A 1GAWA 2E1PA 4MA5A 4FF4A 1D03A 5BR8B 2IY7A 3PUZA 3RFTA 3AO0B 1N0VC 3KK0A 1TYEB 4R1TA 3IR7A 3TI9A 2BI8A 1GKYA 1X8XA 1E69A 1YI1A 3WAGA 5LB2A 4G5OA 2C4TA 3DHVA 4PNEA 3GLIE 3OHAA 4LRSB 1UP4A 2PS9A 3HJTA 5CZXA 4UJ5A 1I51A 1E6YA 2FVYA 4LY6A 4IF4A 1XNRB 3ACBA 1AKVA 5I9NA 4QOSA 1CEYA 3SHOA 3UFBA 1NSQA 3VGVA 3VWSA 1DQPA 3O0DA 2QL7A 1HGXA 2B1GA 3LHIA 4QBIA 1A96A 4J4HA 4A6EA 3DUWA 2NO1A 1ZAYA 5DE3A 2JIBA 4XCVA 1AHNA 1D1QA 2IYXA 2BQRA 1V4BA 4RLHA 2X3UA 3H2KA 1Y8ZA 3RWBA 5H81A 1C8BA 3VGUA 4KYUA 4EK2A 1FP6A 1R0ZA 4YFYA 1P0QA 1SC3A 4KQGA 1VK8A 1C3OA 1TKBA 4B82A 4PZDA 1LPSA 1GY8A 2C54A 1T9TA 5M29A 2QGFA 1Z2EA 2L08A 4RY0A 4TN5A 5ICSA 2NZ4A 4LUCA 4P4LA 1H5UA 1UW4A 2AD9A 4N48A 1PGNA 3S81A 4NECA 1PG2A 1HWKA 2CCJA 1KJ8A 2GK4A 3D0QA 1SXJB 1I7DA 4EY7A 3CLTC 2VPZB 3WX4A 4FYVA 3OTCA 2MEWA 2VSNA 1K7CA 4LJ8A 1DIBA 5H9FJ 3RVNA 5K6RA 5CXQA 3ZTOA 2JFGA 4Y2XA 4LHVA 3UXMA 1P31A 4Y7DA 4RMIA 1STOA 1OOEA 4YP3A 1DX4A 1WACA 3C66A 1SC9A 4ZKDA 2MQOA 4NDZA 1ONOA 3NORA 3TNDA 1TJYA 2QRLA 2KHCA 1Q81T 4EO6A 3DDWA 1SXGA 4A27A 5AM2A 3PE3A 3PQEA 2ID8A 5KOJA 1A5SB 1MA0A 1LBEA 3SJCA 3NJ8A 1S5ZA 1ZUWA 4FIDA 4V2IA 1AQUA 4RGBA 1NXVA 1B43A 4OXIA 4Z99A 4A3SA 4B1FA 4U39A 4K5SA 3I9V6 1YZFA 2PSFA 4BO7A 1PWHA 4M95A 3CXUA 2XRMA 1Z07A 5J4LA 2NYVA 1BMFA 4BJHB 5CH7B 1NBMA 1I5OB 1VCTA 2F3PA 3NVDA 3SCKE 2XRYA 4M98A 4S1VA 3CDWA 5CVUA 4AL4A 1V5FA 1UKYA 1JIVA 1UWCA 5I7OA 4J7AA 3E3OA 2JAWA 2YZGA 3H4IA 3R20A 5THWA 2GAIA 1AYEA 4U2EA 4O4HB 3G8YA 4C7JA 3VAMA 4K2XA 3LD9A 4ZCTA 4BJ6A 2CVEA 4U7WA 2H7XA 3AERB 1SUFA 4LJ5A 4XSHA 1QONA 3T19A 1TM4E 4TT3A 2QI9F 1MEJA 2HDHA 1G3RA 4X1IB 2OFHX 3PQDA 2RBEA 2CQ3A 3WC0A 1WBDA 1YCFA 5K0FA 3DHYA 1Q95A 1OI4A 6FDRA 4Z8YA 3V4RA 4DSJA 1B8VA 1XZNA 4DSIA 1NJIT 1OB5A 1C0IA 3RSLA 4C9DA 1Y1PA 3FNNA 4N3AA 1I30A 2BGLA 2EQBA 1PG5B 1SK8A 5UKDA 1MKYA 2RIPA 3TA2A 3ORHA 5AHXA 1THTA 5FLXU 3DF9A 3T4UA 1T1SA 2E9TA 4BC0A 3QGPA 3PFWO 1VQ8S 1MAAA 3RIHA 4BQOA 4ZQGA 3FUTA 4Q1AA 4U7FA 3R0IA 3I12A 5P8WA 2V7VA 3DONA 2XI3A 5KFJA 2PJRA 1NXQA 2W43A 2SICE 1LU9A 1UOOA 3EQ6A 3PHLA 4MIKA 4FMCB 3MOSA 3FEXB 3QPAA 3U1TA 3SFUA 4JJ8A 1BD4A 3GMDA 2DR3A 2QENA 3ZGOA 1MORA 2ZJ4A 1BCSA 4CLFA 1OAAA 1U47A 3ANSA 4H77A 3RUCA 1DXYA 3NDIA 5ALNA 1UZHA 2QGFB 5A02A 2DPYA 2JAPA 3U3KA 1XHLA 4KAXA 1P5HA 4N3GA 4J37A 4MDEA 2KJVA 4S1PA 4ED1A 4QT0A 4UBIA 3OA2A 1WZIA 2I29A 1U1LA 5F78A 4OL9A 1PO7A 4BLUA 3WK9A 4CTNA 3H5RA 1BXGA 4XYLA 4I2VA 4ZYWA 3E2IA 2HJSA 2DY1A 1W35A 3EPRA 4KFBB 1XMOB 4BB5A 3A2MA 1O58A 5FULA 3UDVA 2WM8A 2JCSA 4URUR 1I0LA 2H4YA 2JGLA 4DRXA 3AFNA 1L5SA 2YNFB 3GRKA 4TMYA 3DRPA 1Q6YA 5KFVA 2VSFA 3T06B 1QO0D 2Q1TA 3E8OA 3RF6A 1J8MF 2DY0A 4FYKA 1AD2A 3VO2A 1OREA 5A9TA 2AZ4A 2BELA 3KFVA 1VHJA 4Q2LA 1XJ5A 1HFKA 1V1JA 4ROSA 5I7WA 2DIRA 1GL7A 4ME6A 4REOA 1RQNA 3L8HA 5K9FA 4TTAA 3NMAA 1N6PA 3L07A 4GEKA 4RPJA 1CVJA 2H2DA 3HBJA 2BSAA 3FBEA 3LPNA 4MWCA 1Q16A 3A6GA 3H86A 1A1VA 2JIDA 1N32J 2FMFA 1OYOA 1HRKA 1MROB 3G82B 1LFPA 3S29A 1SRRA 1D9AA 5K4HA 1WUIS 2P2CB 3ROEA 4XFDA 1PUXA 3AA8A 3R5KA 1LZLA 4HEJA 4ZCQA 4CLHA 1SFRA 4HH1A 3T94A 2GQ2A 1OKKD 3I52A 3OY7A 2JAXA 4XUCA 1Z0SA 4JR0A 1MJGM 2Q4BA 4RMHA 4JBXA 5J1PA 2CPHA 4HV4A 1NYLA 2BFEA 3VR5H 2NP7A 3DVAA 5AO9A 2V3CC 4R1SA 4RSHA 3MEDA 2J45A 1HV8A 3IXLA 4Q05A 3C3CA 1RWKA 2Y0BA 3WAJA 2GZSA 1R4NA 1BN6A 1QGUA 1FYVA 4USIA 2VOEA 4J0GA 1XXHE 2VJAA 4LWZA 1M1ZA 1U1OA 1JQDA 1S3SA 2FSPA 3Q1KA 3DU5A 2ILTA 1Z0ZA 2C9YA 3QX9A 4QWWA 1T5TA 3AEXA 4FYYA 4H31A 2FWPA 4UTPA 2WMNB 3ZNQA 2W9BA 3W79A 3IDFA 4QRHA 5DHRA 4XTRA 3HFSA 4UOZA 2H1IA 2ODTX 2B5VA 1CULB 1P2UA 6Q21A 3L4JA 8RUCA 5THKA 3MGCA 4YCNA 5B30A 2M5YA 2IF2A 1DIGA 3IVMA 4RU1A 2XNRA 2EC0A 4D8YA 1DCFA 3L0YA 4KSBA 4YJ2F 1YR7A 5M2QA 5ITZB 3TUIC 2MSWA 1XQWA 1FNNA 3ZWYA 2LQ5A 4PCQA 4AT1B 4LY0A 2J5RA 1MU2A 2OCKA 3CWZA 3PYMA 1DPGA 2DNZA 2V97A 4O8ZA 3DXXA 2AYYA 1SUSA 3RTEA 2FFJA 3H90A 3K6SB 1R31A 4UU7A 1WJ9A 3QFCA 1FI4A 1BUXA 2Z9DA 4MQUA 3SC3A 2X13A 5LBUA 2FQWA 5BSRA 2CV0A 1B8UA 1FLNA 4GOOD 2XGOA 4K4SA 5COBA 5LZ4A 4QPZA 4DQQA 4LQ3A 3FHTA 3GGPA 5BSKA 1RWMA 1TTPB 1TUWA 1GPAA 2CJWB 1O9BA 7AT1A 4CT9A 3T1YB 1KEVA 3ZLVA 3TEGA 1B6RA 4U0KA 1TU0A 4GKAA 2PGCA 2JZOA 1E62A 2QW8A 1CUBA 3W7VA 4F7DA 4CQMD 5CM8B 4Q3AA 4R1NA 3TJ9A 3W2HA 3B3GA 3CB2A 2QR2A 5C8VA 3L9XA 4BNZA 2KHZA 2J3LA 5COQA 3LH2S 4Q0BA 3CNLA 2FZCA 1IWAA 1HKUA 4Y00A 4UTXA 3KR0A 2VOOA 3RS3A 4GPAA 4YRDA 4CLTA 3I04A 2AGPA 2MZSA 3QATA 4JP8A 3BBLA 1YULA 2IDLA 2Q5CA 1VPDA 4DMCA 4XVQA 1R8XA 1K6XA 4CT5A 2C82A 1XERA 3QSYA 3K8OE 4F3MA 1WSBA 1QQTA 1F5SA 3EEFA 4IYRA 4YB1P 5IVHA 2YWKA 2O0HA 3OQJA 1U98A 1L7PA 3T9ZA 4CVNA 1M74A 3IEVA 5EMLA 4TV9F 2K3KA 3HDJA 4MK4A 2X7IA 1KXZA 3NDPA 4AAYA 4JLBA 2QE7D 2BKXA 3MUMP 3BXXA 1UWLA 1FYDA 2J09A 3VMFA 1C9MA 1J0EA 2WJJA 4FE4A 4KL8S 1J23A 3T6KA 1R0CA 2W2QP 1JTEA 3PCRB 3SDEA 2BEVB 3AJEA 3G9CA 3ZHVA 3R9IA 5FXMA 3V1TC 2VUIB 2Q5QA 4L9SA 3DEKA 4R1LA 1N32B 2DHCA 1RXEA 3BXZA 2JFHA 3LYLA 3HI9A 4Q01A 2ZWPA 1MABB 3CEDA 1H8HD 2YZ2A 4NSNA 5JNWA 1Y6GA 5C80A 3BSWA 3I23A 2C2GA 5FD8A 1EK1A 4BO5A 1DADA 1FVQA 5FV7A 3K73O 2BFCB 4Q66C 5LB4A 5KBYA 3CISA 3CC4S 5JS2A 4NCIA 3NL0A 1QYIA 4K4WA 5B2ZA 4HEA6 5FOSA 4YQZA 2XWXA 5F1KA 3KLNA 5HYVA 3L05A 1NW6A 4TKTA 4LDZA 4D9KA 5ULLA 4REQB 1JIHA 2HQOA 1L2TA 2JI6A 1UJ5A 3QWUA 5DW3A 1NSPA 2XSJA 2P3SA 1M6VB 3DYAB 1YDGA 1JKHB 2GCEA 1ZOTA 2C07A 3TQOA 3I0RA 1N6QA 3UCFA 2FMHA 2YZNA 2VHYA 1G20E 4D44A 3PQ7A 4KCGA 4OX8A 1WKVA 2Y4OA 1R66A 2E4AA 5GM2A 1RJFA 5FWYB 4LVOP 1KRHA 5DGDA 4KE6A 2HR1A 5I7UA 2OY0A 2LIVA 1UPFA 4F71A 5BV7A 1E66A 3LRPA 4FWTA 2JBHA 4L3OA 1LV7A 3QJGA 4D6YA 3GMTA 4HAOA 1YJQA 3W2EA 2IH2A 2NVOA 3VAGA 2PAFA 4C76A 3KUCA 3TQEA 3PWZA 3ZY6A 1ND6A 5LQJA 2H9YA 4F25A 1MOQA 5BWBA 3THYA 1KZ6A 4L5CA 1BX0A 1XMJA 5J43A 3JX9A 2W2XA 2PPLA 4J3NA 5DDIP 1M2VB 1OAKA 1P7WA 4IH1A 4V1CA 3F2VA 3HU2A 2AKAB 4L6IA 4YEAA 4HKTA 4E7PA 3J7AC 5IKPA 2OB2A 2X1VA 2B4YA 3DKKA 3BFVA 2BANA 1FEZA 5TJHA 2JEYA 2WHYA 1SKYB 3LCMA 2QA1A 4M6WB 1JHXA 1KDRA 4Q12A 4YRSA 1NW8A 1UKUA 2JFBA 1LRJA 3P32A 4GNKA 5CT6A 5AUQA 5JAIA 1QDEA 1V2GA 3FNFA 3W3AA 1XLTC 3QT5A 3FFXA 2H1WA 5TRTA 4PYIA 3HZRA 3SDSA 4F0HA 3NPAA 2WU0A 4D0LB 2J32A 1EHCA 1F3OA 4TX1A 5IV3A 3D5EA 5C7PA 2J87A 5F77A 3TKAA 2PO5A 2BFEB 5DBHX 1SC3B 4HKQA 1SVDA 1NR7A 4Q1EA 2JCGA 1QU2A 3L1JA 3HFVA 2HUPA 4IIUA 4BFLA 3KFLA 1QV6A 3PRVA 1KAQA 4MYUA 5E0OA 3BXFA 3EF0A 3A4IA 1S7IA 3AH6A 3MJSA 2BJEA 4WLFA 1Q5YA 4DPOA 3QOYA 2EBEA 4IINA 1LPAB 2WU8A 4WNIA 2HWYA 2FQYA 3Q8SB 2ZRFA 2JLQA 2MLXA 2Y3YA 1NAIA 4ZMSA 4RV4A 4NLTA 4D6PA 1YFLA 3L7PA 1E3WB 4DPMA 1V9SA 4A8HA 3UENA 1D09A 4Y30A 3NAGA 1EX8A 1J5EJ 2GPTA 1B14A 2CPEA 1AQLA 5DYNA 4ZPDA 1M1KT 2HSDA 4MITA 1Y4AE 3ZGNA 5D6OA 3EW7A 1KAOA 4G1VA 3TI0A 2DHRA 3O8BA 4UM5A 2CYYA 2UUTA 2NOAA 2MQ8A 2P2DA 2ZZMA 2A4MA 2DKOB 2NVWA 1S1UA 1MDFA 4R9RA 3R8XA 2F4VF 1Z28A 1MT3A 1V96A 4AYWA 2VJKA 2IBOA 1QYRA 3DGEC 2QJOA 3NAIA 3CR8A 3S40A 5CEJA 1HQEB 3LQKA 4L4ZA 2JFPA 1XFAA 2BM9A 4HAXA 3H20A 3FRJA 3U44A 1OX6A 4NLQA 3AL0C 2JEIA 3M30A 4G0QA 4X97A 3BE8A 3RB0A 5E3AA 3I2HA 5DN6A 4RVHA 2VH7A 5LQMA 3QIPA 2R87A 1L5VA 1TKCA 2UZIR 1P91A 1SZCA 2VYFA 3ISZA 4PANA 5I42B 4AURA 1CUFA 1U9CA 1EG2A 1NW9B 3KLBA 1Z6XA 3S1AB 3TWZA 1DAEA 4QIWD 1UP1A 2JFDA 4INZA 1QO9A 2F1KA 5L9NA 2VG5B 2VNAA 2Z2YA 5DX0A 1T25A 3ELWA 3C3JA 4ITRC 1Q1BA 4HGQA 4WBNA 2HQ1A 4M87A 1KAMA 3NGMA 4ANEA 3CZ4A 5BNZA 1HNXJ 1UC5B 4JKOA 4YONB 3L93A 2ANBA 5CDYA 2E9ZA 1M5HA 4DGSA 1RWBA 4JJGA 1D4OA 1JRLA 1X1TA 3PA6A 3PX3A 1WULS 1KMHA 4B6RA 1T6YA 1EETA 2OGTA 1VCHA 3GLGA 4QATA 3MLAA 1O87A 4DEZA 1HE2A 1DG3A 1KIAA 1A7KA 3FDXA 3IMQJ 2JFNA 4I1PA 1HDGO 2JGMA 4F4KA 1ZA2A 2QE7A 2P35A 1M54A 3ZJTA 4XVRA 1H5QA 4AZSA 5FADA 5FPYA 1RHUA 4FCTA 1KYVA 2PGAA 5IZCA 1OLSA 4OUDA 1PFVA 4F8EA 2ASJA 1C1HA 3KHTA 3F9IA 1FSPA 4YUZA 1ZL2A 4PZYA 1O5OA 2C9OA 2XQFA 1V8PA 4G89A 3CCWA 4ZVMA 3W9IA 3AOBA 3PKYA 2JBAB 5CM9C 2WWYA 5E1OA 4RA9B 4P36A 1CJVB 2FSUA 4TYWA 1ODKA 4IFYA 4JUIA 3UWSA 2VF3A 5CXXA 4V19X 3UMVA 3ZD9A 4LOJA 1EAYC 5A62A 3NR2A 3WLAA 4GC7A 5B09A 3RW6A 2CL0X 2ZI7A 1BC6A 3UVJA 1K6IA 2HB6A 3GAAA 4G0NA 4TYYA 3ASYA 1AUVA 1UEUA 5G4KA 1RCFA 3AA9A 1TF2A 3CWQA 4EGQA 4PTLA 5A3RA 5JSFA 4RW7B 2QRVA 5JDCA 3L0OA 3I6QA 3GFVA 5EE9A 1Q95G 3LYHA 4RW6B 4G09A 2DLCX 4YRNA 3Q8UA 3C7KA 4ZI7A 4QG3A 3HY4A 4DSUA 5CRIA 1GNSA 5G1PA 5SZKB 2OHJA 4F3QA 4EY8A 5FWXA 3GDHA 4YJDA 1W29A 2PKQO 3QMVA 4RNNA 3MAQA 1VJCA 4TKVB 2FX5A 3OAAD 2BR3A 4MUMA 3IPAA 2LEPA 1NVFA 1RAIB 1FFWA 1IBMF 1Q77A 3C15A 3BKXA 1OJ4A 4PWUA 4QASA 1ZCJA 3BGOS 7MDHA 2X1AA 5F4BA 1KAEA 1UR5A 3CZQA 3GMGA 2ZSEA 3U3MA 2UYCA 1JYEA 3E15A 1VHWA 1EEHA 2VYQA 4RCYA 3W05A 2JLVA 3NI2A 2I5PO 4E5PA 3RC3A 5EJFA 2HMSA 1NXOA 3H1BA 4EABA 4UNNA 3D9QX 1RAGA 4ZT2A 2B61A 2KZMA 4U95A 4PSVA 2FLWA 2HAEA 4BLWA 4PIVA 2VG6A 1RWPA 3P2EA 2TMDA 4Z0PA 4J7CA 3UATA 2WU4A 3ET6B 4PAGA 4BU0A 4KGVB 1CZLA 1H85A 3BVPA 1T4CA 2GPWA 1XBWA 5G0VA 3QLEA 3Q15C 2VPZA 3QLVA 2E18A 4Y9UA 3N2ZB 4RC9A 3T7IA 2X8BA 1IR2A 2XKBA 1BD3A 3H6KA 2XF2A 1FJGF 4WCVA 4IQXA 2H5JB 2YS6A 3LHFA 1YDMA 5U4QA 3S2GA 3M2VB 3HP6A 3JQGB 1NDCA 4BMYA 4RIIA 2HWHA 4HLCA 1W1WA 4R05A 3T3EA 3AB4B 4H4OB 4URWR 1RZUA 4CEJB 2D1CA 2C57A 3CPJB 1HWJA 2ZTSA 3JYTA 3G1WA 2VDRB 5DZ6A 3LQVA 4MYDA 1TEVA 3EIXA 3B5IA 3BMCB 5DNAA 3IP7A 1U3VA 1S4MA 2E5WA 1WCIB 5MGNA 3R1HA 3TH5A 1H2TZ 3UAYA 4DNOA 4X1OA 1JKHA 2XNCA 4JV5B 2GH1A 1XL0A 4JENA 1TYAE 4OZJA 3OZTA 3H2ZA 1YA6A 5JCPA 2V5HG 5CLIA 2XMJA 4FDFA 4OI4A 2DHHA 3HHKA 2BY4A 3KPWA 3GE9A 2BYTA 3SFGA 3IBTA 2V7WA 2MGZA 3COYA 2JI9A 4FFRA 5AW9A 4UBKA 2BKOA 4KEAA 2PGNA 4MEJA 1JEQA 5BW8A 1YHZA 1WZ2A 3CV3A 1S77D 3KDSE 2DPLA 1IM8A 2WTBA 3G0BA 3D67A 5TV2A 1A0OB 1MNQA 4L8VA 3V1MA 1ZN9A 1KR4A 5IJ9A 1OMOA 3TX2A 4KITB 1RPZA 4EY6A 1JLCA 1LW0A 1XZCA 2OC4A 3ZI7A 2ECOA 1G6BA 5JS8A 1QM5A 3ZLUA 2DFDA 1FVXA 1JJ2R 1D0IA 2QSJA 2MCFA 5E3QA 4TV9A 3OJXA 2C31A 1LCIA 3CUEF 4PWWA 4W82A 4GF5A 1NBWB 5JVGQ 1N5OX 2D3WA 5IM4A 1KFDA 2IA0A 4JL5A 2DGSA 1PSDA 1N5KA 2FP4A 5LVAA 3C8MA 4QLBA 3UGKA 2ZH1A 1MX3A 3ROTA 3MVEA 2W2MP 3DOJA 3EGIA 2EXXA 3VTKA 1S2OA 2A9OA 5JCOC 1RBLA 3BGRA 1N48A 5DLYA 4N82A 1A9SA 3DNFA 3GMIA 4X92A 4BQNA 5EVCA 4XEUA 4MVJP 1ZH5A 4MHSA 4JLUA 2ZYAA 2JEOA 1FFCA 4IIFA 3VKHA 6CHYA 3U61B 4W5OA 4GC9A 4JEHA 4ECAA 1IJBA 3L0IB 4CEHB 4DV1F 1E79A 4MA0A 4YACA 1S6PA 4DA9A 1H1TA 2F1JA 1Q92A 2X8JA 1PAUA 3PHHA 2RE1A 4QU8A 1CY7A 4DQKA 2XS7A 3CNQS 4ZO6A 3SSOA 4ZITA 3ZCPA 3BD8A 4LDJA 3W8GA 5AW2A 5C7YA 4UAGA 1GNLA 1I1HA 2BJHA 1VB3A 3OHPA 4CM4A 4GZ5A 4BXOA 3TARA 1ZTTA 2LMIA 2YXDA 3QRPA 4A8PA 4AC9A 5CDTA 1IHXA 2NU7A 4IEFB 1R0AA 1BH2A 5KG4A 2XB9A 4LZAA 2EEYA 1R10A 2IU0A 4E08A 4P54A 2Y9HA 2WFAA 2IS2A 1KDTA 1O95D 2IELA 4OLHA 2PANA 1EVQA 3HCFA 4AL7A 3LS2A 4IVNA 1I6WA 2CPJA 3IA2A 3OUYA 5A6PA 3A9RA 3SCIE 5KIAA 1O5TA 4I6GA 2IZ7A 3AI1A 5IC5A 4CH7A 4V19J 1M5SA 1JQGA 3I76A 3ZHOA 1E7WA 4ENWA 1NLKL 4QXRA 3MG9A 1GGNA 1H9AA 1HNNA 3NEYA 4LI3X 5AH0A 2BP7B 1X2BA 1D5WA 2OHVA 1T15A 3W7BA 2R7XA 3UK6A 4Q9IA 1UEKA 1HBUB 1XF1A 3AVYA 2WE7A 4UAVA 2OO4A 1EFRD 4DFJA 1SWWA 2NAFA 3VNUA 5CFMA 2HQRA 3CR7A 1UFOA 3T7DA 1F2GA 4DSEA 2C7RA 2IRWA 4NIMA 1BYIA 3AZPA 3EAFA 2MIIA 2F3QA 3JW8A 4JP5A 4QYSA 1NPPA 2GMHA 4UZEA 5LXRA 5DTQA 2V67A 1VFNA 3RRJA 5ADVA 4KRWA 2A1UA 4UM7A 3ICQB 3QMMA 3H1TA 1J1IA 2MQMA 4JJ6A 1GHTA 1U5BB 5E1DA 3BC1A 5DULA 2DUUA 5D4PA 1VL8A 1YUNA 5JCZA 1RACB 5F7JA 1ZVVA 3AHFA 1YKWA 3SSSA 3T5KA 1KOOA 2FOXA 2RI0A 2X0JA 3K4HA 5THQA 5HS6A 1RP5A 3I1FA 3TUZC 1LKZA 2X19A 4OHWA 4EUHA 4M8SA 3JS9A 2JHGA 3RRMA 2YWGA 2LKCA 3TJZA 4YRQA 2YNMA 1RXCA 1IQPA 5AHOA 4GKJJ 3BEDA 2LXNA 1XRQA 1V4NA 1ZGJA 3K5MA 2K2PA 2FKAA 2AMYA 1U4BA 2D0OB 1P61B 3LO3A 5CD9A 4RDXA 1O3YA 2FEOA 4OFXA 4HRVA 4ND3A 3NH9A 5F73A 2FJBB 4ZCKA 4DRZA 2HHHJ 4UBJA 4WU2A 1ZITA 1KDNA 3ETDA 3ZS9A 4G5RA 4I50F 4X4NA 5SZHB 2YFYA 5ALEA 4N7TA 3X1DA 2Q8NA 1OWLA 5A4AA 4C06A 4G1BA 4ONEA 1P6UA 4OJYA 2EFQA 3V2UA 4HI2A 4YN3B 5C2GA 4TQAA 3QPVA 1T1JA 4TXLA 4XVHA 3GLGB 2BZGA 4H27A 1WC6A 2EKNA 2G28A 1P4SA 1FQKA 1GYQA 1OZAA 4DAEA 2DPJA 1M1YB 2WOOA 4R0VA 1EJ0A 2GMWA 4W7SA 4IW3B 5BWMA 3FOBA 3TM4A 4MIBA 3CF6R 2IE0A 1CBUA 2KG1A 3T8YA 1WHSB 2PRIA 1MG0A 3IS9A 4CV1A 3Q7SA 2M70A 1VSTA 3RFUA 1QFSA 1SCJB 4HUTA 1BHJA 3TTXA 3ISNC 5IMBA 1DBVO 4OYOA 4ETNA 3SIXA 3HN7A 4BLTA 3FSRA 2P30A 1PSWA 1E2QA 4MDYA 4G1QB 2FUG1 4ITSA 1FDNA 4L7QA 3BSNA 3HP7A 4O4IA 4PLFA 3W1VA 1SVMA 2W8KA 3AUYA 2LV8A 2A58A 3EIHA 4R40A 1QMPA 2RHHA 1GG9A 1O97D 2C9MA 1RAAB 2ZE7A 3O6QA 4BGUA 4DSNA 1Y4ZB 3INRA 4CIOA 1B76A 3CCQS 4I0WA 1AKQA 1AZSC 2AHOB 3R2JA 3DT9A 1ROFA 2QUKA 3D4BA 1N25A 3ZTPA 3ILXA 5E6RB 3UD4P 1S1UB 1A7AA 1BQEA 4OHRA 4BFVA 4FHDA 2QMHA 4OHZA 1RADA 1ZEMA 4F3YA 1ODCA 4Z7JA 3J7YI 2QRJA 3RYIA 1YB6A 2MINB 5IAOA 1YJ7A 3TNFA 4TKVA 5B0DA 3EIOA 3PXCX 3R6GA 4RZSA 5IF3A 3DHEA 1WM1A 4GVPA 3T4PA 3CJKA 3KIPA 3I5XA 2WMYA 4KPUB 3B3FA 4V1Ak 4RTMA 1XDWA 3GC6A 3Q24A 5KFGA 3LBAA 3O6VA 3LLUA 1N7GA 1W2IA 1JWAB 4LGYA 3ZV7A 3EASA 2Y67A 1KDZA 5KSZA 3H83A 4O2AA 3WBKA 3AKZA 2JD1A 1C8VB 3H7IA 5ANRB 5AVKA 5LM3A 3EDRB 4P31A 3DN9A 2R44A 3OR2B 2ICAA 4EY5A 3TQQA 5BWCA 1EHWA 4KQ2A 4ZPJA 2G17A 1T9GS 1M0EA 3RU9A 4IO0A 1AUPA 2AGOA 2FPPA 4LX0A 4G6VB 3AIOA 2BBSA 3LUBA 3SHTA 3PPYA 1HA1A 1NB2A 3JALB 4H7KA 4ND4A 1KZGB 2VTVA 2HVEA 5AVVA 3M7IA 2C95A 2WJWA 2ZIWB 1U4OA 4A03A 1IE3A 2JGIA 2HNDA 3GPDG 4AJ2A 1TU0B 1QBKC 2RHLA 3N74A 2HHHB 4HAUA 2B4UA 1BX1A 1G55A 4AKSA 2J9YB 3IOCA 3AM4A 1E7SA 5HP4A 1V8DA 2G9VA 2A0UA 4UBNA 1DQYA 2W7OA 1W5FA 1P75A 4EMDA 3FCCA 2BW2A 3MRXA 3GPBA 3DR3A 4OI2A 1CJBA 1U6KA 1U8WA 5IWAB 2O2DA 4N5SA 2QMZA 5AVRA 1WC3A 4QUEA 2ZSFA 3CN7A 2WNHA 2MJNA 9MHTA 4LDRA 2CJXA 1F9FA 2VRWA 4TWZA 1SUPA 3VDNB 3BQMB 3OL6A 1O0BA 2OE2A 4V0QA 1D3WA 2ZSIA 3DBRA 4QYIB 4DX5A 5AVXA 5DLPA 2DBVO 2XUOA 3FFTA 1LC3A 3O4HA 3NWJA 4JASB 4L27A 2WIAA 3VAKA 2F40A 1JXQA 5I7RA 1E9CA 5KYNA 4JP2A 4R5MA 1L4LA 2HPAA 1PFKA 2Q3PA 4ZVUB 4N9WA 2R7MA 4DUZJ 3WGTA 4GRSA 1PUJA 3L43A 5FR1A 2GYWA 1L4MA 3V6JA 2O2SA 4DCNA 1GSOA 2C7OA 4JK3A 2QMQA 3L7AA 2VL7A 3KHUA 1OLUA 2N1BA 4KVZA 3H25A 4U7UK 1ZK4A 2PQ0A 2YQ4A 1LQTA 4JKIA 2ZSAA 3TOCA 1JHRA 4PYRA 4QR0A 1E6WA 2AYBA 3NAQA 5JXHA 3C48A 4KAAA 4BHTA 3G96A 2ZDQA 2Z2LA 4TSRA 2ZS8A 3GQBA 4EFDA 3MCSA 1DELA 2P2SA 3AEKB 1LVGA 1PHRA 1R0WA 4U67Q 2MKHA 3QZUA 1IQRA 1X7YB 3EZ7A 1ECFA 2DQSA 4OQZA 5GV8A 1NDHA 1TW3A 4OJHA 4X6XA 3WIBA 3I8XA 3EUWA 3RIXA 4LHSA 4WPGA 4Q37A 3PFOA 1TFUA 4QX6A 4MAAA 4PO8A 4UATA 3RB3A 3DP9A 2EEZA 4ZQBA 1PYGA 3CJ3A 3OX2A 3FVWA 1IY0A 4BRSA 1YQUA 5AUNB 2ZBFA 2GVDB 3HTXA 4UOEA 1N3LA 4RHYA 1HI9A 1XN9A 1Q1ZA 3T1HF 4RF2A 3SEQA 4LMBA 1PZEA 2N82B 1ZD8A 4DOMA 1H2YA 3MJVA 1YJUA 5HILA 1U3DA 3H2IA 3M34A 5BYKA 1LWNA 1UK6A 1UF9A 2GN0A 2G7ZA 5BV1A 4X95A 3LPYA 4G07A 4ZLNA 3C5CA 3EZGA 3LXRA 4HGRA 2GQ0A 2WVGA 2G5TA 4ESOA 2UXCB 1VKZA 2WYIA 1ZYQA 2PYIA 3WP0A 2REQA 2ZJPQ 1EWTA 5E3JA 5DHPA 2B7BA 5JZBA 3U19A 5JMWA 4EB6B 1J5OB 1ZH8A 4LIPD 4OL0A 1K7EB 3Q2OA 2RGXA 1UETA 3CSUA 2GHIA 4JYCA 4BTEA 4MKBA 2QG9A 2WJAA 1RAFB 3IAHA 2YRWA 3TZLA 1SJ9A 1V1MB 1OY9A 3W62A 1G5TA 4KIUA 4HGZA 3MEDB 5AICA 9LDBA 1EFDN 2Y71A 1OQ6A 3TEFA 3KLHB 4LOLA 2DUWA 5AVQA 4J9UE 3G2PA 1C9DB 3OWHA 3E8XA 3PJGA 3VDRA 5J1SB 4EUSA 4UCQA 2A2CA 3J81k 1NMZA 2BE9A 1VJ5A 3M6IA 1A4RA 3NOVA 4YCJA 3A1VA 5H59A 3FVTA 4RM3A 3L8MA 4OGKA 4LC9A 2VF4X 4JT9A 2AOXA 4P2SA 4OFWA 5HZHA 1ETUA 4CTKA 1X7DA 4D9MA 1Q8KA 2G6BA 3NNNA 1B99A 1WMEA 2UVDA 1VXRA 1QVAA 2G0IA 2V4ZA 4XB2A 1DO0A 5KYWB 4LR8A 1BMQA 3P0HA 5LPNA 4B3MJ 3VR4D 2GSWA 1RYNA 4XUGB 1Z4JA 1KEWA 2SBTA 3RW7A 1WTBA 4HS9A 1GPH1 4IHKA 2FQQB 1KNQA 3KOMA 2HGNA 2RGDA 1GTL1 2PGJA 1EDEA 5INTA 4GXNA 5KYTA 2G2ZA 4KPUA 2RH5A 3BKUA 1XLTA 4H4KA 3GFSA 2DHGA 1OXBB 3T5DA 1P45A 4UEQA 2DFVA 3F5QA 1OWMA 1QR2A 1LX6A 4HNRA 1EHIA 4EYIB 2CFTA 5JFOA 3M1LA 4FNHA 3MWYW 3H3XA 5KCZA 3DPIA 1B0PA 4DWIA 2C5LA 4KRXA 1L3UA 2OEJA 4RL6A 4BLOA 1ZIXA 5GONA 1SBIA 4YPOA 3I32A 4BFZA 3WQSB 4F06A 4FFSA 3PUVA 1VPEA 1DKNA 4FYXA 4US1R 1JXOA 5TQ2B 2NUAB 1GKIA 4BVGA 5LMNF 1G2PA 1ZGGA 5HBRA 2M52A 2XYQA 4LFCB 4BV8A 1TUBA 3OLYA 4MFBA 4J9VA 2VSQA 3GSIA 2ZM6J 3FFAA 1NQXA 3TLEA 4XOIA 5J2TF 4IL5A 3ZHZA 1XZMA 4RUHA 3IOEA 3AQPA 1B2RA 1J2UA 2ZJZA 2I4TA 3DEYX 1FL9A 4AS2A 3QELA 3RYFA 3M7VA 4MB6A 4P34A 3P2MA 4OAOA 4OX7A 5I3UA 3W65A 1SBZA 3O2QB 4G0UA 4QQ8A 1XDBA 3DO5A 1MSWD 1H5NA 1GADO 5TGTA 4ZVPB 4L5IA 1NX6A 2GGSA 2BQ3A 3DLCA 4E4YA 5D3GB 3QZ7A 4ZVRB 4GE0A 3EFBA 4C8LA 3QLJA 1WNTA 3HHLC 4YCCA 3SVLA 5LZ7A 2KS6A 3GIRA 4LXYA 2P1ZA 1ZBQA 5EE1A 4LFAB 3GRAA 3FRZA 3SE0A 4HGYA 1WOYA 3F78A 3TTWA 5L8RC 2JH9A 2KI5A 1EFKA 1NLYA 5CG1A 1I1NA 4RNCA 2AJCA 4R8UB 2HREA 1KQFB 5EMHA 4QQKA 4F11A 1PZMA 4OO3A 2OILA 3QE4A 2OPRB 2WB2A 1D5CA 2XMGA 2QL9A 1PR0A 1E59A 4PU0A 1KJIA 4BKQA 3FYHA 4R2LA 4F3KA 3RSZA 3ITNA 2G4BA 2V7XA 4S1NA 2V8VA 2AC4A 2ZJ0A 3PQFA 3PG5A 1VFPA 3ABSB 2P7HA 4FFOA 1JLMA 1C2YA 4CU2A 4LF5F 1DLOA 1Q1GA 4KXMA 1NM5A 1BOFA 3GIMA 4UE6A 4JX9A 1BFDA 5A0TA 4JQYA 2XYRA 4KIGA 4DHEA 3GT3A 1L0BA 1BMTA 2ZRJA 1SUQA 1RJ9B 1FA9A 2Z95A 2BW7A 3RUPA 1HA3A 3Q9NA 1TECE 3KC2A 5F8GA 1XHEA 5BQ5A 2VG6B 4C7XA 1N6NA 1S1WA 3E7FA 3GGSA 2J7UA 3K1YA 3CGGA 4Z7NB 4KXLA 3OUZA 2A9VA 4JJ4A 1NOJA 4PAAA 4JI8F 5KU7A 4WKOA 4TSFD 3RBEA 4ZOLA 4NYPA 1X9WA 1XU7A 4PC6A 5E3RA 2IRYA 2X8WA 2QZSA 1NMYA 3DBLA 4LSWA 2XGQA 3S2YA 3H05A 4WCDA 1SVIA 3ZOKA 4B3MB 3SQMA 4O0MA 5EYPB 1X7XB 2H00A 4BP1A 3H13A 5K8MA 3ZIDA 1U2FA 1HSOA 2XV1A 3K6RA 1N36B 1P7PA 3K2YA 5IFKA 4QU5A 4O0NA 2IXGA 3NBPA 2X4GA 1O95C 1CDZA 4EHAA 1Z2AA 4PPYA 1RLIA 5ITZA 4R8RA 4EMSA 2HGSA 5K8CA 3GVHA 1AGXA 2ASDA 1Z7YA 5KHOC 3TFOA 2I38A 2I2AA 4UPDA 2JFYA 3SQLA 1U31A 421PA 2Z83A 4OJ3A 3QGHA 4XUDA 4ENQA 1KH3A 4XDYA 3A3PB 2O05A 4QUGA 1V35A 2XI4A 1QAIA 1K1EA 5I47A 4TUYF 1OFIA 3MCZA 4Z86A 4HR7A 2JANA 3ZHCA 4IUBS 1GM5A 2RHCA 4UAUA 2IWRA 1SL2A 4O4IB 1QQ5A 4RK7A 4CN9A 5CXSA 4HDMB 1YQDA 5EOVA 1Y5IA 4DU7A 2PX8A 1IM2A 3WYNA 1TM3E 3HR7A 1WF3A 4FKZA 4U6SA 3FDFA 2YXBA 3D0RA 4DLUA 3K30A 2YXLA 2UVUA 1JHOA 3FTNA 2X3FA 1GL9B 3DTVD 3AOCA 3ORQA 2PIIA 1UKAA 3EEQA 1JJBA 3KOAA 3H5AA 4YXWA 1Y7TA 4COKA 1PGZA 5K3FB 2IBTA 3QWBA 1ZAXA 1LD3A 1SBYA 2V3WA 1YO6A 1KZ9A 2QD4A 5CCDA 5IEJA 1VQSA 4BMOB 3O82A 1RA7A 5HE9A 4KGVA 5LOQA 3BA6A 5EXDA 3OJEA 5ETOA 1N9ZA 1JF8A 3KK1A 3QQPA 3V32A 1UWVA 4NBSA 4HHEA 2L9NA 4AJKA 2QZ8A 1F8FA 2CQDA 4CIDA 4E94A 2Z56A 1I5OA 2CDCA 2ZM6B 2OWDA 4F0KA 5EIBC 5DRTA 1KJJA 1UQRA 4LZNA 3F71A 4BFWA 3K89A 5BUQA 3S44A 2RKBA 4RE6A 4MP3A 3RKUA 1I7QB 3AEUB 4FDAA 1FVFA 4YNBA 2GAJA 2FFAA 1MRZA 3NALA 2GBLC 1TKAA 1U0GA 4C30A 5JWOA 2D9PA 5C42B 5HVNA 4OHUA 1AH2A 4FYHA 3TOSA 3LOUA 2VWPA 4QG7A 3PB3A 5K6AC 4C89A 4EW2A 5G53C 1FE8A 1CJTB 2AEJA 1O94A 1XX6A 2QVYX 1CIJA 5FO1A 3TZKA 1OGJA 2W01A 4LSZA 4R5HA 3D7NA 4USWA 2D5AA 4KYIB 3F4LA 4XE5A 3V2GA 3LNTA 5A1JA 4ZVLA 3OUUA 1LY1A 4OQFA 3PTLA 2CJBA 4HR2A 3KQQA 2EBUA 3SXUB 2JPDA 2HK3A 2VH5R 1MW9X 1Z0UA 1X74A 3PFCA 4RD3A 1TMKA 1Z6QA 2BFBB 3T9AA 2NXNA 4DEYA 4B17A 1Z4OA 4OLFA 3KJVB 1L4UA 3ZO7A 2VHTA 1RYFA 2P91A 1IZ9A 2B5JA 3PTAA 1VRUA 2B4OA 1RHMB 2OEKA 3IV9A 4RTQA 3G8TA 4EVQA 3X1ZA 3DV0B 4WH0A 5G0SA 2QN6B 3I5UA 3Q3VA 1TEHA 1RWNB 3HACA 1YS1X 3ESZA 1X15A 2R6JA 4MVJF 2VP4A 3TF5A 3ENZA 3QT7A 3L0SA 3J81j 3ZUGA 4QYMA 5JO0A 3RKSA 4LE0A 4CR7A 1HI8A 1OTHA 5U4XA 5JHHB 1V8OA 3PNBA 4KR9A 1WO8A 5IJ0B 2J30A 3AIKA 3MFQA 3NTLA 3U02A 4CL8A 4O02B 4WFNQ 1H1DA 3V48A 3DC7A 4Q21A 1HDEA 2PKXA 1CS0B 2YNMC 4HBZA 1SU4A 4IZIA 2ZWOA 4XGKA 1T3GA 4FFMA 1QUEA 3CGIA 4OU4A 2XA2A 2QZPA 4L6V3 4KNYA 4LMZA 1AZLA 3ZDQA 5KFHA 4L8GA 4OB8A 1B1AA 1D8AA 3ANTA 4JLPA 1Z4NA 2NZJA 5EZQA 3KYDA 5BUZA 4ANDA 3M0EA 1DE0A 5EWLB 3ER6A 1HLGA 1QANA 1XHFA 2GZMA 3KZMA 4U7JA 3R24A 4K81B 4KDEA 3KJZA 5HLFA 1B7FA 3A9TA 2AUMA 3JQKA 1BAPA 3EQ8A 1FPMA 4C8KA 2JAQA 1QGED 3PEUA 3TNYA 1ZHOA 1F5CA 5IASA 4K6HA 1DBSA 3GJ8A 3GJ4A 4KWHA 3SPXA 4HNSA 1IQZA 4NYJQ 3DDCA 3DL7A 4YV1A 1YRTA 4V1CI 2OCBA 5CXUA 3OFEA 1T2FA 1BQXA 4MWEA 2ATCB 5GJWC 2RGGA 2WZCA 2IKSA 1I6LA 1QSSA 2IHKA 3GLVA 4NBWA 3TCNA 3OXGA 4HVZA 2W25A 3M8PB 4LF8J 1PC4A 4GLFA 3E3NA 5A8RB 3I58A 2AR7A 3MB5A 4M1EA 3FZQA 3OKPA 1U7HA 5A7GA 5CPBA 3DDHA 5AW4A 5H83A 3BXPA 3GA5A 1XN1A 3M1AA 4F9FA 1M9NA 5U1PA 3LY8A 4QU6A 1JDZA 1HWIA 4L4SA 1WTFA 1XE3A 4CDMA 3BKTA 1KKMA 3ROXA 2YQ3A 2H17A 1HNWF 4ER3A 3DLLQ 4B3SJ 3L8CA 5F4ZA 4OYYA 1UT5A 4AX4A 1J00A 3B4DA 3CJ8A 2IFTA 2VBXA 1WRBA 2QL5A 2YKMB 4RHXA 4Y2VA 5HF6A 3CRRA 4QYZJ 1O0PA 2X3DA 5GADl 1E3JA 5I4IA 1KO1A 1SNYA 5CVDA 3FPLA 4DAOA 4X7RA 1NZJA 3G6ES 1N7JA 1UH5A 2VJUA 2DBRA 1WW8A 2D7JA 3W2IA 4KH0B 4ZI5A 4FNGA 3GEMA 1WF6A 1ZPWX 4DF8A 3WNZA 3N87A 2BFDB 4ELUA 3VRHA 5K0BA 5DNEA 2DIVA 2JGDB 5FFMA 4PZEA 3BR8A 2IVZA 1XEXA 1ZK3A 4OYZA 4QEKA 3O8WA 4AYXA 3PDUA 1QMGA 4N03A 5I9TA 4DQPA 1GLNA 3ZWQA 1PVDA 3ENKA 4X1IA 3FMWA 2XNDA 1JDUA 2JI4A 2CKWA 1Z5WA 4EHKA 2I1LA 5DG7A 5EJ8A 2ZZKA 4W5JA 4AYBD 2A0YA 1MMNA 2DC1A 1ZYUA 5IRCD 2YVSA 4C3VA 2FRXA 3PGKA 5L7WA 3NO4A 3G2NA 4DMRA 1DIHA 3RIGA 1HT2E 5DCUA 3BTSA 1H2VZ 1HBMB 2YS7A 4OGLA 2PIDA 3L41A 4L1KA 1D9XA 2VDWA 4JUZA 2F1RA 1CS0A 2CMGA 3CWJA 1KYTA 4BB6A 4YHHB 3RVLA 1T1GA 4G4SP 4K28A 2JI7A 2MSEB 4XB6B 1GA6A 2IHR1 1XCLA 2UXDJ 1CUAA 5KC8A 1FDVA 2HVIA 4L0DA 1RT3B 3AXSA 1G42A 3TDKA 4PLWA 3QM1A 2O50A 5G4LA 4HQ0A 2X42A 2G9QA 5CPFA 1M1NB 1NDPA 1CNMA 4ZU1X 3PNKA 4DYDA 5AKXA 3PZBA 2WHQA 3ZE2B 2FAXA 1L1QA 4ZVNA 2BCEA 5JQWA 1LPOA 4Z9BA 4K6OA 3BAZA 1SPXA 3LOQA 2I4OA 3RSFA 3CCRS 3I0NA 5HQ8A 3G1TA 4DJTA 1XELA 2ZSHA 4KWCA 2PTHA 1LW2A 3DLKB 1XNQF 3ZH2A 4YX9A 3EVFA 2I9KA 4HLDA 3TNLA 1EQAA 4DIUA 4G4GA 2JZCA 5IOLA 2CLEB 5K5EA 4A0RA 2VOJA 1XMQJ 2H6EA 3G2OA 4CQMB 4QWCA 4LDPA 1TJPB 5K0LA 3OLVA 3AVQA 2QZJA 4OQYA 2OSRA 4DR3F 1VHTA 4HDNA 2P6MA 3O1HB 5EX3A 4YS6A 2H54B 4DXLA 1NQUA 3WYCA 4DNPA 1DAFA 4G0MA 1BHQ1 2JK0A 4WHMA 3OMXA 1I10A 4P4GA 4YP7A 3JQJA 2CNKB 3RBDA 2QRPA 4IG3B 2BE7D 3EA4A 2CMKA 2CZVC 1CJVA 1KHHA 1T8PA 3C1OA 3C4QA 1H05A 1NVGA 2ABYA 2HOQA 4P52A 3LG2A 1E2NA 1Y80A 1RXYA 4N65A 2XCUA 4P2XA 3WHKA 3USES 1ZP6A 3CG0A 3H8YA 1Y1LA 5GADI 4W92B 2NGRA 3KSRA 1R12A 5CFRA 5D01A 3IAM1 5EJ5A 4WOKA