4ATNA

Crystal structure of c2498 2'-o-ribose methyltransferase rlmm from escherichia coli
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
357
structure length
356
Chain Sequence
b'MNKVVLLCRPGFEKECAAEITDKAGQREIFGFARVKENAGYVIYECYQPDDGDKLIRELPFSSLIFARQWFVVGELLQHLPPEDRITPIVGMLQGVVEKGGELRVEVADTNESKELLKFCRKFTVPLRAALRDAGVLANYETPKRPVVHVFFIAPGCYTGYSYSNNNSPFYMGIPRLKFPADAPSRSTLKLEEAFHVFIPADEWDERLANGMWAVDLGACPGGWTYQLVKRNMWVYSVDNGPMAQSLMDTGQVTWLREDGFKFRPTRSNISWMVCDMVEKPAKVAALMAQWLVNGWCRETIFNLKLPMKKRYEEVSHNLAYIQAQLDEHGINAQIQARQLYHDREEVTVHVRRIWA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBOSOMAL RNA LARGE SUBUNIT METHYLTRANSFERASE M
publication title Crystal Structure of Rlmm, the 2'O-Ribose Methyltransferase for C2498 of Escherichia Coli 23S Rrna.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 117
structure length 356
sequence length 357
ec nomenclature ec 2.1.1.186: 23S rRNA (cytidine(2498)-2'-O)-methyltransferase.
pdb deposition date 2012-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01728 FtsJ FtsJ-like methyltransferase
A PF18125 RlmM_FDX RlmM ferredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2810 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4atnA01
3.30.2300.20 Alpha Beta 2-Layer Sandwich THUMP fold THUMP fold 4atnA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4atnA03
3T0IA 2H1RA 2EFJA 2PV0A 4EVIA 4GBED 1D2HA 3P9NA 2FHPA 2ZZMA 4RVDA 2ZIGA 5DRYA 5E1MA 2GS9A 3EGVA 4BP3A 8MHTA 3AXTA 5EMJA 1JG1A 4IKPA 3SSOA 5DT2A 2OB1A 3ELUA 5GM1A 5K05A 4GUAA 4DZRA 1ZGAA 2PX5A 2AN3A 4PYJA 4PYNA 2O57A 2ONYA 4PYQA 4YUWA 2HNKA 3KR2A 4OBWA 4KDCA 3NMUF 4C4AA 5EOVA 3HCCA 2ZULA 5P8WA 4CWAA 5LR6A 5EIWA 3G5LA 3LKZA 4YUYA 5JUWA 3GRYA 5CD1A 3F4KA 2B9EA 2G71A 3FYCA 1WZNA 3IHTA 3TOSA 4CKEA 5JR3A 5FA5A 3TRKA 2NXNA 5DX1A 4PYKA 4E33A 3QV2A 4RYLA 3CVOA 1KIAA 4BP1A 5GM2A 5LQCA 3KPVA 3FUWA 2YTZA 4C08A 4YUXA 5ICCA 1L3CA 5DTMA 3LCVB 3CBGA 1JSZA 2ZW9A 4PYMA 3UJBA 4LWPA 2P35A 4GEKA 3FPJA 2OXTA 3SVZA 2NP6A 4P58A 3V8VA 4QVGA 5DWQA 2R3SA 3FTFA 1X1DA 5EG5A 2IBSA 1M0EA 5GINE 3PT9A 2P3QA 3BWBA 3P97A 1VQ1A 5KQSA 4GOOD 2ZZKA 2XVAA 2NYUA 3THRA 7MHTA 1SUSA 2ZSUA 3NDJA 4V0RA 5EGSA 2P7IA 5FQNA 1JR4A 5U4XA 4X1OA 2AZTA 4DF3A 2DULA 4K6MA 3NVKI 3SSNA 3MB5A 1YB2A 3GXOA 3KPYA 3KQTA 1XCLA 3P2KA 1NBHA 2IH4A 2B25A 4PGGA 3AXSA 3M6VA 3E23A 2PT6A 2O06A 2YXLA 2ZTHA 2IP2A 5E8JA 3X0DA 3DMFA 3B7PA 4BLUA 1F38A 3AY0A 5E1BA 3S68A 5LQAA 5DSXA 5EMKA 3CKKA 3PX2A 3VC2A 3KQOA 1ZHFA 4CKCA 1FPQA 2EJUA 2ORED 3UZUA 5CVDA 5F2NA 1RJGA 3EEYA 3HCEA 2I6GA 2ZBRA 3DXYA 3EGIA 4KIFA 3HM2A 3LBFA 4GQBA 5DTRA 5HIMA 3UJ9A 3E8SA 4RTKA 1IY9A 3G2OA 3QOXA 3HVHA 3BKWA 3C3PA 4RVHA 1DUSA 3TLJA 2GLUA 4QPPA 2IGTA 4YUVA 3BWMA 5C0OE 4OX9Y 3KPJA 2AOWA 1P1BA 1INLA 3H2BA 3LCUA 5E8RA 5K0JA 4WXHA 4EKGA 1TW3A 2Z6UA 3KPUA 4RTSA 3KKZA 3I53A 2UYQA 3HCDA 2PX2A 3OZTA 2V7EA 5G02A 1SQFA 4FGZA 3TR6A 4RTJA 2CMGA 2BR3A 3DXZA 4CTKA 4M7RA 2V74B 1Y8CA 3REOA 1R8XA 3SR4A 3T7SA 2FRXA 1I9GA 5CM2Z 3GRVA 1TW2A 1UWVA 3EVBA 1WXXA 4HG2A 5HEKA 2PJDA 3LDUA 3NJRA 2CL5A 5LQKA 2O07A 4XUEA 4A6EA 3CC8A 3G7UA 5FHRA 1ORIA 3DLCA 1X1BA 3BZBA 3OCJA 3CJTA 3M4XA 4XUCA 3TQSA 5T64A 4QVKA 3DH0A 4C04A 2O0LA 4RVGA 4DCMA 2P1DA 3KHKA 1KPGA 4GC9A 1NW7A 2UYHA 3ER8A 3WSTA 1H1DA 2EX4A 3A25A 3EVEA 1VLMA 3EMDA 4YV1A 1YF3A 3CCFA 4NECA 5GIPE 2HTEA 4BLWA 3TM5A 4POOA 2ONZA 3A27A 1T43A 3GNLA 2R6ZA 2ZZNA 3K6RA 2HV9A 1XVAA 3HA3A 1VPTA 5ICGA 4AX8A 1OR8A 4HC4A 4HH4A 4DM3A 2PT9A 4XUDA 5GP1A 1FJXA 3PFGA 4R8SA 3FPEA 2AN4A 2PXAA 4HGZA 4Z2YA 2NP7A 3MERA 2EJTA 3A4TA 3B5IA 3P8ZA 4GOLD 4RVFA 5BXYA 1ZQ9A 1D2CA 1KR5A 2GAFA 3A7DA 2ERCA 1RI2A 3KQYA 3BKXA 2HMYB 3MCTA 3C6MA 3FPFA 3IEIA 4H0NA 4R6WA 5T67A 2ZBQA 3ANXA 2XYRA 2YXDA 3EVZA 3FPGA 3HCBA 3O4FA 4FT4A 4HRAA 4QQNA 4CXMA 1YZHA 3ERCA 3CJRA 1HMYA 3M6WA 1MJFA 4GOMD 5FULA 4M37A 4EKIA 5CVEA 3DLIA 3OU7A 3B89A 1N7JA 2EG5A 3Q87B 4RTNA 3GO4A 4ER5A 1MHTA 1KHHA 2IPXA 3HP7A 3ME5A 2NXJA 5F2OA 1R18A 1ZKDA 1BC5A 1PJZA 1NW6A 3ELWA 3FRIA 4PYOA 2AOTB 3KPWA 4LECA 5ERGB 4F84A 3GGDA 4V0QA 3VC1A 4ER6A 1JQ3A 1RJEA 3MTIA 2OYRA 3P71T 4KW7A 2PXCA 2AOXA 2IH2A 3K0BA 5E9WA 1P1CA 5DRTA 4ZTBA 5FWAA 1R74A 4C05A 5D1NA 4E2XA 2ZCJA 1QAQA 2I62A 3DOUA 2GPYA 1G60A 1O9GA 4E30A 2VDWA 4OQDA 2IDKA 3FZGA 5KQRA 1AF7A 2F8LA 4FZVA 2P3OA 5HIKA 2FYTA 3FUTA 5DXAA 3OE5A 3VSEA 3EGEA 4LG1A 5K0BA 2C7QA 1IM8A 4MWZA 3G2QA 3BT7A 4PGHA 2QE6A 4IV8A 2P3LA 2QRVB 4GOND 5DM1A 5K0CA 5MHTA 1AV6A 1G38A 3M70A 3EEOA 4EMSA 2CWWA 1M6YA 4XCXA 1JG2A 4QPNA 4DQ0A 5K0FA 4ER0A 3GRUA 3A26A 2NXEA 1YZ3A 3MHTA 4RV9A 2C7RA 2H11A 2AOUB 4AZWA 1VP3A 3GJYA 1NKVA 1FP1D 3DP7A 1R00A 4OA8A 4ER7A 1JG3A 1NV9A 3V97A 2HR1A 4A6DA 5DXJA 5C9ZA 4RTQA 2VDUE 5HIJA 3LPMA 2IH5A 1I4WA 4ISCA 3EMBA 5BW4A 3LL7A 4PONA 3ELDA 4QDJA 4YMGA 2GA9A 2OZVA 2P41A 2B2CA 2ZBPA 4YV0A 3BWYA 3M6UA 3NVMB 3UFBA 1AQIA 3G8BA 3GDHA 4PYIA 5DM2A 4HSGA 3HNRA 5DTQA 5EKUA 3UJDA 2JJQA 3UJAA 5HZMA 3LDFA 4FR0A 1G6Q1 3KQSA 1YFJA 2VS1A 3I64A 5CUQA 1XCJA 2AOTA 1SKMA 1VP9A 2NXCA 1SQGA 5IKMA 2BH2A 4RTMA 3LBYA 1HNNA 4PCAA 4UOEA 5KYGA 2ZFUA 1FP2A 4ER3A 3IV6A 4WVLA 1DCTA 3O31A 1XTPA 2ZWAA 3ID6C 3OFJA 3G2MA 4U7TB 2O05A 4P7KA 3UBTA 2AS0A 2HWKA 2QYOA 5FA8A 1ORHA 1TPYA 3FTDA 4M38A 2UZ4A 3G2PA 4PNEA 1Q0SA 2CKDA 2FK8A 2FK7A 4JXJA 5CVUA 2PWYA 4QTUB 5EMLA 5KVAA 2JH9A 3OPNA 3CJQA 4GF5A 2N47A 3GRRA 2OBFA 3DMGA 4AUKA 5K8VA 4BLVA 3NTVA 2ZLBA 3BGDA 5K0GA 3KQPA 5DM4A 3DULA 3L8DA 4P7JA 2QRVA 10MHA 3PS9A 4QDKA 2PWPA 1NW8A 5EQJB 1KXZA 2IFTA 3FUUA 1L3IA 2P8JA 2ZWVA 2OPBA 3M6XA 4HTFB 3I9FA 4P7GA 5K0NA 4FSDA 3UJ6A 1SVUA 3UA3A 4R6XA 5LQNA 3ORHA 2AOVA 4PYLA 3EVFA 3Q7EA 5CCXA 4E2WA 5EEGA 3HVIA 4PINA 5KS2A 3R3HA 1X1AA 2AOUA 2FCAA 2JH8A 2WA2A 3FTCA 1JTFA 3RODA 5C1IA 4FSXA 5BP7A 1FBNA 3SX0A 1XDUA 2PKWA 3PX3A 4U7PB 5E2BA 4C03A 1RJFA 3LECA 3FYDA 2PVCA 4KRGA 3MCZA 5K0LA 2BM8A 3UJCA 3NWBA 1RJDA 5FUBA 3GWZA 3KQMA 2ZVJA 2G8NA 2JG3A 2JHAA 4DCGA 1VBFA 1RI5A 2YUIA 3BGIA 5CVJA 1G55A 1XDSA 2PBFA 3FUXA 4B17A 1NE2A 3GU3A 3LKDA 1SG9A 4G56A 4MTLA 4OQEA 1AQJA 4IV0A 1JSXA 5HOQA 4CTJA 1RI3A 2JHCA 1QANA 4YV2A 2YVLA 3FTEA 4P7FA 1O54A 4PIPA 5B1SA 1ZGJA 1QAMA 2AVNA 3B3JA 1G8AA 4X41A 2YR0A 3DTNA 4E31A 4YUZA 5E1DA 5EZQA 2BZGA 3NW9A 3SXJA 5CVVA 1WS6A 2NNWB 5GOZA 1X19A 2P40A 3BUSA 3HVJA 4DA4A 5DPMA 2C7PA 3O7WA 1G8SA 4AZSA 5GIOE 3B3GA 2YQZA 1KPHA 4Y2HA 4DKJA 3JWGA 1BHJA 1KPIA 5E1OA 1ZG3A 3OZRA 3G8AA 2Z6AA 3UJ7A 3T7RA 3C0KA 3JWJA 3THSA 1U2ZA 5T6BA 3HCAA 3MTEA 1WY7A 3UWPA 3GCZA 3TKYA 5EC8A 3KU1A 2GH1A 3DXXA 3R9XB 2XYVA 3LCCA 3MGGA 3TKAA 1BKYA 1KYZA 1NBIA 5E2AA 1V39A 3EVGA 5K0EA 4X61A 2ESRA 4DMGA 3HTXA 3ELYA 3HEMA 1B42A 3FPHA 3G89A 4AZVA 3ER9A 2ZIFA 5HFJA 3BWCA 3EVDA 3KQWA 2G1PA 2IBTA 3R24A 4IWNA 5FTWA 2Y1WA 1F3LA 1UIRA 3KR9A 3OFKA 4F85A 2XBMA 3PVCA 4HTFA 5DX0A 5CCBA 3JWHA 5ICFA 3TFWA 3IYLW 1P91A 2PSSA 3LGAA 3P2IA 2AN5A 3PTAA 1JG4A 3DUWA 2YX1A 2VDVE 5EZSA 5EKXA 1EJ0A 2KW5A 2VP3A 5LQUA 2A14A 2Z6QA 4BY9E 4E2YA 2Y1XA 3NDIA 4QQKA 1L9KA 3TM4A 3OZSA 2C7OA 4KVZA 2CMHA 5LQJA 1XXLA 4X63A 4R05A 1EAMA 4CKBA 4PCLA 3TPZA 5DM0A 2BM9A 5IH3A 4C06A 4KWCA 5EHIA 4KIGA 5DLYA 1SUIA 3MQ2A 4QTTB 4RTLA 2VZ9A 3HCFA 2BR5A 1PRYA 1O9HA 2AR0A 2P7HA 3OE4A 1N7IA 3MAGA 5DX8A 5E9JA 3KR0A 4L7VA 3P9KA 3EVAA 5FWDA 5F2KA 3VYWA 3DMHA 3GRZA 3C3YA 2B3TA 3LHDA 2ADMA 3R6TA 4KDRA 3FUVA 3EPPA 5EVJA 1QZZA 1DL5A 3M33A 3R0QA 1QAOA 4GC5A 5HILA 1IXKA 4PIMA 5H02A 3T7TA 2FPOA 4OA5A 4PWYA 4RWZA 3KQQA 3LDGA 1M6EX 3SSMA 2PGXA 3P2EA 1QYRA 2PLWA 4EQZA 5CIYA 1VL5A 5FADA 4RX1A 1I1NA 1EIZA 1EQAA 4RTPA 4RTOA 2PX4A 5BW5A 3D2LA 3OU2A 5LSAA 1Q0TA 9MHTA 5K09A 4F86A 2BR4A 5FHQA 3EVCA 5EHGA 3OU6A 5K03A 3I58A 4E32A 3RIEA 3HA7A 1R8YA 2JHPA 1NW3A 3HA5A 2OO3A 2PY6A 1Z3CA 4RTRA 4E2ZA 2GB4A 5GWXA 1XJ5A 5DSTA 1UFKA 4AZTA 4C07A 5M5BA 3SM3A 4FS8A 1VE3A 4MIKA 3HVKA 2ZIEA 1WG8A 5D1HA 2K4MA 5K01A 3CGGA 3LX6A 3QOWA 1L3BA 2AVDA 2PX8A 4FT2A 3G5TA 1BOOA 2IDJA 4X60A 5LQRA 1EG2A 1JQDA 4FP9A 2I9KA 4LWOA 1JTEA 1P39A 3AWIA 1KP9A 5EIFA 2QM3A 1X1CA 2UYOA 1NV8A 3G88A 3GIWA 5E9QA 2UYCA 1N2XA 1RI1A 2G70A 3PB3A 2G72A 4MQ4A 3RW9A 2IIPA 3TMAA 3E7PA 3U81A 3JWIA 1YUBA 2Q41A 5HIIA 2XYQA 4ATNA 3E05A 4O29A 5FQOA 4E70A 5ICEA 5EPEA 3UJ8A 2OY0A 3A7EA 3NWEA 4MHTA 2WA1A 1KYWA 1VIDA 3PFHA 3SGLA 3KR1A 4HGYA 1EJ6A 1YFLA 1XDZA 2H00A 3BXOA 5EMMA 2B78A 2YXEA 4M36A 3SMQA 4YMHA 3DR5A 5EEHA 1NT2A 1WXWA 2WK1A 1JQEA 2OB2A 5FCDA 3I5UA 3FRHA 2E5WA 3P9CA 2QY6A 1R6AA 4Y30A 3C6KA 3B3FA 2I7CA 1D2GA 4RSRA 4OBXA 3AJDA 2LD4A 4EK9A 2OKCA 3UA4A 3PLAE 4R8RA 1L1EA 2PXXA 2XVMA 1RI4A 1NW5A 3LSTA 3P9IA 2DPMA 3KQVA 3BGVA
chains in the Genus database with same CATH superfamily
1CRZA 5JNWA 2WSSA 2GBGA 3EGVA 1VPWA 4OM8A 2HU2A 5H8WA 2CQPA 1E2GA 2ZYHA 3NS7B 3GFGA 1JPUA 1PW7A 3SVLA 1GT6A 3DXFA 3O2JA 3KKEA 1JDNA 2D3WA 3ROTA 4X1YA 1WQ1R 3AK4A 5CD1A 3VVMA 4I2QB 3GF4A 2P9CA 5JR3A 2HJRA 5JVDF 2HIYA 1HO3A 1PLKA 5LQCA 4N8SA 2FN9A 5TGTA 3EGOA 3KT3A 1NCLA 2C07A 3LHKA 3K15A 4KV7A 1T1SA 1VLZA 1FTSA 2FG5A 4H3HB 4LC0A 3E5HA 3ZZRA 3P27A 5JMWA 3A6EA 2XM3A 3GLGA 4CCHA 1UPMB 2DITA 3AQPA 1UJMA 4NKRA 3B7PA 1FUYB 2JLAA 5AJZA 2D54A 5I9BA 4A1OA 2RHGB 5JSUA 4C88A 4QGFA 1IM5A 4B47A 3CXCR 2I8LA 5HQTA 3N6LA 3IFEA 2B6AB 2BZ1A 3C5HA 1B26A 3DVSX 2Z5GA 3B1YA 1F1BA 2GIRA 1RU3A 1FD2A 2EYUA 2GAHC 4Y6IA 1IJFB 2QD4A 4JNCA 3UAXA 2VPZB 3QSIA 1JVSA 4I8IA 3UGTA 3EVEA 4X71A 1Q7RA 2C2BA 1FX2A 4E5VA 4QJ5A 4R40A 3V46A 4IIJB 1XVAA 1JHAA 1GDDA 4D5GA 2NZCA 2ZS8A 1IUJA 1GNQA 4C0XA 4PWZA 3A4TA 1QAJA 4G0QA 3U6BA 4KH1B 5C8DA 5GAGI 3BQ1A 1XVVA 4QQNA 5JD4A 1R31A 3QBEA 1AUQA 4KRFA 1TKTB 3T1YB 4O1HA 3CSSA 3HDJA 3IPRA 3OETA 5CAAA 4A8YA 3RC9A 1VQLS 4B2IA 4Z99A 3G2HA 1CJUA 1DEXA 2EFCB 1GT91 4CYMA 3QAEA 4MW7A 3EMKA 4MW4A 2I62A 2WUWE 4EO4A 5HQ3B 2WM3A 1BXKA 1DTSA 5DG8A 3A1VA 4C7QA 2VOJA 4IV8A 1RWXB 1KQ3A 1DNPA 5LNK1 3SQOP 3V81A 3R1LA 1FP1D 1HQDA 1WVMA 5GVRA 4TGLA 1RT9A 2FWIA 2DH7A 5HYVA 1F12A 4BQEA 5BNTA 4PONA 3WWYA 2BQ3A 3L0OA 2ZBPA 3GPDG 3PDWA 2NV0A 3CE6A 2HG4A 2IUEA 4X65J 5C8YB 3GFXA 4DEZA 1VJTA 3OMXA 2FW1A 4JUIA 3ID6C 2NPFA 5TQ2B 3AY6A 5HQLA 3EZXA 3MSCA 2ZH5A 1WHXA 3ICQB 1VMDA 4F9EA 3TXXA 2QVCA 2RMLA 3I9ZA 4RA9B 1RTJB 3S7RA 3QWIA 1Y9DA 1ZCZA 4NULA 3CCZA 2II6A 1XMQB 1FFWA 3PF9A 3PUJA 3QUTA 3HVIA 1Y9JA 3U1MA 1T2DA 2WWGA 3LGNA 6AT1A 1CLEA 5ETQA 1Z5PA 3SFGA 2PMHA 3EZGA 4YCBA 3OX2A 3WGVA 3W3AD 1RHKB 4YP6A 2J9XB 5EE3A 4MR8A 4ARVA 4JUBA 5K4GA 1ZICA 2WUFA 3OTWA 4YIKA 2HSEB 1NUTA 3OZEA 3G8AA 3D7RA 5F3TA 1JVNA 3NYRA 5DGIA 4P33A 1V0JA 1XNRJ 3K16A 4EEYA 3M1AA 4QTZA 1FQOA 1W8IA 3IESA 5A9SB 3KR9A 4K2XA 4E4TA 3EZNA 3ML1A 2H1HA 5GZ3A 4QUJA 1Z8DA 2AJ2A 4DR2J 2TS1A 1CUFA 2C1XA 1PT7A 3CV3A 1QCDA 3A70A 3F4BA 4Q4AB 4F8EA 3QU5A 4F4WA 2AG5A 2NYAA 4WK6A 2OOSA 1QOZA 4KH0A 1NQTA 1ZXXA 1K92A 3CLTD 3FLAA 1NVUQ 1B23P 1JAXA 1B7GO 4RWZA 1RT3A 4XQGA 5J3JA 4WZ6A 1EIZA 1Q0TA 3ZS9A 3B7WA 2F43A 4FVCA 5DSTA 3S6EA 4OYMA 3UK2A 4DZDA 3R8XA 1B0VA 1U28A 3NHFA 1CZKA 5JMOA 3PG9A 2GNOA 3EVNA 4TQSA 3FWPA 1SXJB 1CYEA 4DN9A 2QR3A 5HIIA 1QX3A 3H5VA 5GOTA 2K6GA 5T5QA 4NLUA 3PFHA 1UEUA 5AW4A 1F8GA 3G17A 3I9V6 3FRHA 3BH0A 4RF5A 3C6KA 4RSRA 1X3LA 2RS2A 3VMMA 3QRPA 4L0CA 3EIOA 2J30A 1QRSA 2FHPA 2GEBA 2ERYA 5A8KB 3KC2A 4HYEA 4QOGA 3B52X 5EMJA 2YYSA 3THWA 1DV1A 2DHDA 2I65A 2AGPA 1RTHB 2B4OA 2JVJA 1CVIA 2DEIA 2FWPA 3HDYA 1RT4A 2ECOA 3T3IA 4B1FA 3D5EA 4X8OA 3N2GA 1Y63A 3L1KA 3HXPA 4YA6A 5SV2A 1NK9A 2HX1A 1NBEA 1A2QA 5F52A 1U0BB 1FQJA 3CH7A 4K4TA 1ZRMA 1ZVKA 4GKAA 4ZGBA 4MH8A 4KB7A 3SYMA 1NW4A 2CEKA 3I09A 3NAZA 4RHCA 3I5MA 5LQAA 2N4CA 4KHPF 4ZQHA 2C1EB 1A9YA 3BMNA 5B4VA 1UK9A 3K09C 3Q7IA 4DREA 2IGTA 2I78A 2E7WA 2FJEB 3QXSA 3WRYC 3UJHA 2WAOA 1R8XA 1WRBA 4IFIA 3PDNA 1F8UA 1PNQA 1IVSA 1EVZA 1ZUIA 3IBCA 4U95A 3AQOA 4D8WA 5A4AA 4OYAA 4PBTA 3Q4GA 4MPTA 2QLMA 5IKEA 3H5WA 2VBGA 4PVDA 5CFMA 2M4MA 1Z15A 2KLBA 2Q7OE 3MERA 1NDKA 2OORC 4WJKB 1RI2A 1B7YB 2NUAB 3SDEB 5C42B 1YZYA 1B70B 4YHHB 4BC0A 3HP7A 1KAEA 1EEHA 4CV0A 1H3FA 1R0WA 1L4HA 4OI6A 1Q7YT 1FFBA 3SOZA 3GLHA 4UTRA 1TL7A 1UP1A 2PD4A 4J16A 1TR0A 4NLVA 4MIWA 3QJYA 3K6JA 1ZDMA 1SOWA 2ZR7A 4UUBA 1S57A 1EXVA 1KAMA 4QBKA 3GGCA 4XVQA 2PMFA 3Q6MA 1AY0A 2I55A 2H48A 3EARA 3IEUA 4R68A 4B3SJ 2HA6A 2PUDA 4ZDJA 3D7LA 4ABTA 1SOMA 4EJ6A 1XCJA 5EZ5A 2PD1A 4F3MA 3A9VA 4PCAA 3HBJA 1O95D 4D3ZA 2FG7C 4MARA 1A9TA 4M0LA 3P19A 4DL4A 3GFBA 4MUMA 2XEDA 3EMVA 4M38A 2B5JA 3H4DA 1XNQF 1IFXA 1MIHA 3DRSB 3NV7A 5EMLA 3MOSA 2J45A 5JTTA 5J2UA 1DEHA 5SZTA 1OI4A 3VZQA 3EXHC 1K7YA 4LFBB 1MDFA 1EK0A 2F3RA 1XJQA 1EVQA 2GA8A 1T94A 3TH5A 5BXIA 3DC2A 5AJUA 1RJDA 4FNMA 4JC0A 5L1IA 1AD2A 3PDHA 3C3AA 2QEXS 3VR5D 4QXOA 5AVTA 3R0IA 1U0NA 3MM6B 3QXCA 1L9XA 1JLLA 3V8PA 2IUYA 3ZIAD 4Q1BA 1HHSA 3OTDA 1SOVA 3OG9A 1HBJA 1U2ZA 2Y2VA 3NXZA 5HI7A 4TSFA 1NJXA 4MJKA 2O1PA 3D0HE 4PPZA 1ZA2B 4ERXA 1NZJA 1QHGA 5EUMA 4GP7A 1F3OA 2CADA 1U49A 4DUYJ 4U7CA 3CVUA 1P74A 4ZXPA 2O3JA 2ID8A 2A67A 5EZSA 2A14A 5E2QA 2JIMA 3K4QA 1U9ZA 3C97A 1TUGB 4EY8A 3NAMA 4V1Ak 3P4UA 1ACLA 2ODBA 5D6OA 3RYFB 3UICA 3O26A 3GW8A 1KKLA 5L9XA 1IBSA 2YW9A 4ENWA 1NSKL 3S8YA 2VFRA 3K0EA 2J32A 2BTQA 4E5KA 5F12A 1HYGA 4WXWA 3PZRA 3PL5A 3KE9A 1IPHA 2O20A 2R8YA 3O8BA 3QGPA 1Y0BA 1TKDA 2HPZA 3ZWBA 1FS4A 4D0NA 1XAJA 4OHXA 3WC2A 4QYTA 3E7FA 1EP4B 3ROMA 1JDSA 5D6GA 1YDGA 2PKYX 2Z30A 4K7QA 1PBNA 3HHEA 2AL7A 4B71A 4Y1RB 4DF4A 1J5OB 3EJ6A 5DASA 4P08A 2W70A 1P0CA 2E5HA 4AD6A 3GUYA 4DA0A 4MLDA 1A69A 3MJCA 3LV8A 4D3GA 1HNZB 1GARA 2YMPA 3E70C 3TQ1A 2X3YA 3E9QA 4C0KA 4M5LA 2C92A 2K7KA 4PX5A 2F64A 1QF6A 3EF3A 1YMQA 3KQVA 2YZGA 5AQ1A 3DPIA 3K5PA 2OBNA 4FPRA 1O3YA 1Y4AE 5FWXA 1ZN8A 2NU7B 4FEEA 2C3YA 1D2MA 3I8XA 5CYQA 2XMRA 3G0GA 2VJLA 2F9FA 3AF4A 1TT5B 4LZWA 4AJ4A 5CX4A 3NO4A 5ICCA 1QMPA 3K31A 1TGVA 2ZBCA 3L6RA 4QHSA 3PY8A 4X4NA 1KZHA 3IL2A 4FIZA 2GHIA 2NAFA 2CJYA 1UJ6A 2GCPA 4S0XA 3MB5A 4WFYA 1NRXA 2M8DB 4M1ZA 3FZEA 2Q5EA 2IM1A 1H9AA 2ZVSA 3E9YA 3KZVA 1HBMB 3D1QA 5MN5A 1DC6A 4PZYA 1XRRA 3L6BA 4JB8A 2VHYA 4C0QC 1E3EA 4UOZA 3CO0P 2HWIA 3C6YA 4IH5A 5CAEA 3PO4A 4KGDA 1T3SA 3JR7A 2BBWA 2F9JA 4D6PA 3V8BA 2LCIA 3T3EA 2UUBB 1RWNA 1VG0B 4HGNA 4CFYA 1UOOA 3BE8A 2HVZA 1LZKA 4CLTA 2HC9A 2VJOA 5GPBA 2NVBA 2GMWA 4K9QA 3X43A 2GJKA 4D9KA 3S44A 3ZIUA 3FLMA 3C15B 1JJCB 1BN7A 2Q1WA 4AKIA 4B4DA 1UXJA 1Q86T 2RK6A 4GRDA 3OHBA 4B3CA 1OJ4A 4B33A 1NHGA 2AYYA 5IXJA 1OA0A 1T4CA 1FWKA 3CJRA 3LUHA 1YBFA 2WOOA 5JVDA 1IUKA 3SMVA 3FCXA 2VHEA 2C78A 3DSRA 1KBOA 2R8EA 2VK2A 4RYDA 1Y4DE 5CTAA 1TKZB 4QTXA 1SR8A 5HGJA 1SKUB 2R6JA 4RIIA 3PTWA 4PXEA 5AVJA 3VGJA 2DB1A 3E3XA 4PC6A 5FPYA 1X9WA 1W8DA 5K0FA 4C48A 3QT7A 3QEAZ 3NOQA 3CLSC 3AR2A 1MRZA 3AIKA 4XDDA 4D41A 5LXTF 3F96A 1AHHA 3ZUGA 3I4HX 4KQ1A 2F5GA 2EXUA 4URVR 1AYEA 4NCAA 6ADHA 2FN8A 4R8MA 3EFOB 3WL8A 4R7TA 2HK8A 5D0HA 1Q16B 1XELA 2W2OP 4U9UA 1VFJA 1VC6A 5I9MA 1Y1QA 1QHHB 2CFRA 4C4SA 1XX6A 1AVTA 4NZ7A 1GQRA 1C9YA 5LB2A 2M6LA 2IHJA 3KLGB 1QLJA 5LMUJ 3WL6A 5L46A 1IOWA 2CZ9A 1US8A 2CXXA 2MYNA 5ANRB 2MCFA 4L27A 4ALKA 4YV2A 1ZGJA 3VHRA 2H08A 4CFSA 3KIPA 5B57C 3W8DA 4JI3B 2IZ0A 4PWDB 1IN0A 3KHRA 4XEHA 1QCCA 4NFHA 4KI0A 3SC4A 3O94A 3VX4A 1UXKA 4CPDA 3H1PA 1X3SA 4ZOEA 5TQ0B 5U4QA 3H5AA 1SVIA 3CLUD 3UT5A 3CJ0A 5KJFA 4RD1A 5C5EA 2CDQA 1QRRA 2OM6A 2I8EA 3UUWA 5KFMA 1UKBA 3ZBUA 4QT0A 5HUHA 2X9VA 2FD2A 2BSQA 2XZTB 1CW2B 4CNBA 3RUAA 1V95A 2AW0A 1M6EX 2ZYTX 3VU3A 5KBYA 4YJKA 1FFSA 1AKWA 4QUIA 2Q49A 4F86A 2VFUA 4WN3A 3JQBC 1I9CA 2ZP1A 4QBTA 2JHPA 2MOKA 2VP9A 3O4JA 4BLSA 3K0CA 4WP9A 4RK1A 2J9DA 5KWIA 4BB9A 4QPDA 3KJNB 4PXCA 3DM2B 5JLJA 1ZJZA 5DBEX 4F9TA 3NDRA 4DAEA 3B1XA 3H5OA 3GJTA 4JCCA 1WTAA 2XLCA 1ZN2A 2IYAA 3PV8A 3KAJA 2ALYB 3H5YA 1XCMA 1M8FA 2ZKUA 4DLSA 3WLRA 1M1NB 5I7VA 2LKZA 5DNAA 4ONEA 2J5KA 1C1CA 2XCPA 1TL3A 1D2GA 3UWSA 5HFNA 1V5IA 4HUQB 4IMIB 2YKGA 4EUKA 2Q6OA 2X0FA 1UJNA 1EYZA 1JALA 2P6TA 1GTHA 3HR8A 4FDVA 1X9IA 4Q45A 4QOSA 5E3QA 4ZC8A 3EYAA 4MVJE 1WUYA 5MAOA 4ZT6A 2VQ3A 3NMUF 3LKZA 4MPPA 1WXIA 3BX1A 4BXOA 3GWGA 1GKKA 4I81A 1I6MA 1MD9A 5WRFA 2PRSA 2Z1NA 2DXFA 4N54A 3NAHA 2AJQA 3TLGA 2PGIA 4A23A 3BXZA 1U0RA 4B3MF 4B3DA 2QTVA 3E2PA 4QO7A 2IRUA 2BDPA 4KQGA 1SNYA 3SCZA 5KWSA 4QU6A 1C9EA 2VHQA 1O6ZA 4NAHA 1XOIA 4GFDA 3AY0A 5E1BA 4I66A 1LVHA 2EFDB 4J2TA 4BO4A 3T4XA 2ZRIA 4JP8A 3CNOA 2AW3A 1MVOA 5G1PA 3DO5A 3RRJA 1I6JA 1A9ZA 2JFGA 5C80A 4NEYA 3O9VA 3W9IA 4DLEA 2QD3A 2HEIA 5G02A 4C4WA 3FYUB 4FZ3A 4P0PB 1DAGA 1MU2A 2YNFA 1F60B 3UD4P 3VOAA 3Q8WA 4X3CA 4J0CA 1HL3A 1VJDA 4WTYA 3AG5A 5CITA 4JI6F 2OVBA 1QE1A 1DU4A 3EMDA 1K73T 1UTAA 4KK3A 4WGGA 3KHHA 1MMFB 3GNLA 1QQAA 4QHYA 5LMNB 2EWVA 3E0XA 1ODKA 4L16A 1IEWA 2P6RA 2REXB 4DMKA 3MCTA 1E32A 4DUZJ 4I4TA 5CDUA 9ATCA 2NGRA 3CDBA 5HE9A 1KFKB 4HRXA 4L4UA 4R1NA 1SOUA 2A9JA 3NMAA 5FLEX 5AMXA 3H1FA 4CLYA 5AOCA 4UTPA 5H3LA 3A3NA 2IWRA 2QYCA 1G98A 2BJVA 5CJ2A 1S7GA 3CW2A 3GBVA 3AVVA 3ONNA 4YK7A 4DQIA 3IMKA 4UM9D 4FHDA 4BO9A 3H5LA 3A2NA 1NPPA 1P33A 1G8MA 3AR9A 2DD8S 3M32A 2H4WA 4MX8A 2QA5A 1YZ7A 1EVKA 2VPTA 5IDVA 2Z8QA 3ETEA 3BPSA 2IYOA 1MQ8B 4QSMA 1WZUA 4AK9A 1E7QA 3H04A 3RPEA 4OYHA 1VBYA 1TZ0A 4P7VA 2EEZA 5FFFA 5BV1A 1EQUA 2MWMA 2DH5A 1Y1TA 3AJEA 4PYAA 5EJ8A 3L7JA 1XR5A 4HI2A 1G3MA 5T4FA 3TQHA 2NNLD 2R7LA 1T0BA 5HRAA 3LZCA 1KH1A 3DHVA 2UVRA 5E6RB 5IM5A 4GM1A 4P1ZA 3KT6A 1QTNB 1HNXJ 1UWKA 3A8KA 2X1FA 4BAUA 1RGVA 3T35A 2CA9A 2ZYUX 1VKHA 1ITPA 1DADA 4B17A 4AXBA 3TUZC 2RGNA 5HG0A 2IC3B 4F4AA 3TR0A 3PI7A 2WOMA 4PS0A 1YS2X 2WKRA 5TIIA 1PBAA 3KB6A 3WLTA 3D67A 2MQNA 1W1WA 3IDZA 3P7MA 4W90B 3WGLA 1IK4A 4HACB 1C5KA 4Y2JA 3Q7TA 2Q1TA 1G42A 3C6TA 5BSEA 3CJSA 1RAIB 1WEZA 3BWCA 1S1TB 3MM9A 3T9AA 4ZPWR 1FRLA 1XLTA 1V3SA 4L2IB 3MM7B 5BWMA 3AM4A 5CLHA 1T1EA 4TNOA 1YZTA 1ZZNA 3P5SA 2EARA 1N0WA 2BBEA 4LC9A 1H1TA 1PO7A 2MEWA 3E82A 2DQYA 5FOUA 4OP2A 5D77A 3PR3A 2ADCA 3CWJA 4M0PA 1VC0A 1SVDA 1D0IA 4NQZA 2ZUTA 2WUGA 3D5QA 1VYAA 2GPTA 1NB2A 3UNGC 3VO9A 3HP4A 3O03A 1HDRA 3BGWA 2O3TA 5D85A 1VQ6S 1U6ZA 3FHTA 4K50A 3J81j 2B69A 2JLGA 1M6VA 5IKPA 2AGQA 2BSAA 4LY6A 3CD6S 1X1CA 2QFIA 2X8BA 3GZNA 1F9FA 3TX8A 1TLLA 2X0EA 3K57A 4AO8A 1MMLA 2X77A 2OH2A 1VSQA 3LC1O 1EINA 1RPNA 2H00A 1KYTA 3KJZA 1LWEA 3L8FA 4QREA 3AWDA 3ZU5A 4G3XA 3UA4A 3U19A 4YB5A 2DPMA 1NBMA 1LWFA 3B9PA 2JFUA 5ECWA 1K5GA 4BNUA 2EJCA 4I64A 4URGA 3AQ4A 1PT8A 4UHCA 2QG9B 2FRVA 5JCJD 2E7ZA 4C2TA 2GR9A 3ZWWA 3AFNA 3ZXWA 1GX6A 2FSVA 4UEWA 2J4CA 4IHAA 1LX7A 2IIVA 3PX6A 3CISA 3CF4G 5DRKA 4D7AA 2HLDA 3L8GA 2IVFA 1BQEA 1EWKA 4BLUA 2ZUCA 2I3GA 4MQMA 1OZGA 2PX6A 2OV2A 4FQ7A 4URYR 1LS1A 1FWLA 3GLTA 5ISMA 5E8RA 1K06A 2B7CB 1VPVA 2ZUUA 1NDUA 3CPHA 2EGGA 3IRUA 3H4BA 4KDFA 1ECPA 2WW8A 4H60A 5GMOA 2OTCA 1FKPA 4Z7QB 1TIKA 3G23A 4F3RA 1L7MA 3D6AA 4CP5A 3TAUA 2IA0A 1E6VB 2RE8A 8AT1A 2W48A 2CVIA 2AXPA 3WG9A 1M1ZA 2CQDA 1I4EB 5HTOA 5BYSA 3F1KA 4ZDNA 1PL0A 1Q7LB 2ZD1B 1QOPB 5I7OA 2OL4A 3IC1A 3BFVA 4FF3A 2P6UA 4B9EA 3UM9A 1MWQA 3AF1A 3T94A 4X4RA 3I61A 3AVOA 3V55A 4A16A 4RW6B 5FEUA 2PEZA 1ZUD1 4EUFA 4EUVA 4MCJA 2QUHA 2Y71A 4B74A 2GJSA 3T52A 3CZCA 1MW9X 3A6HA 1KEPA 3WOHA 3QNWB 2YNGA 1KMHB 4YJFA 1MENA 1H2VZ 4D4MA 5T41A 2P9QA 4X1IA 1BGVA 2QG6A 1IWPB 4F4CA 2AXNA 2C5GA 1M5UA 1I1OA 4M2LA 1NOJA 2QP4A 1GXUA 5AVQA 2X51A 4LVNA 3I9OA 3VR3A 2LRHA 2DPHA 1NKEA 3MHTA 3PEYA 1SVOA 2VJAA 4MQEA 2O54A 2P77A 3BE6A 1AGNA 3RSGA 3CVVA 2HMWA 4M5JA 3IE1A 1RT5A 4N5MA 1CS0B 4LXXA 3UEOA 3TBHA 4P80A 4ZXFA 5GJVC 4NE9C 2SBTA 2V5UA 2PIAA 1W4CA 3CLRC 4Q3EA 4N8DA 4WK0B 2PLRA 3E9MA 1N9GA 1S4MA 3WL4A 2ZHOA 3KK2A 3M34A 3H42A 5B3LA 3D02A 4KX3A 4MK9A 3TL2A 1TQHA 3NRBA 2D1CA 1CDEA 2I2BA 5IM4A 4GMDA 1U5CA 2Z3ZA 4M98A 5D2CA 3IEVA 3AIOA 1N34J 2LUOA 3VUFA 3QT6A 3GLSA 2BEUB 3CNEA 4MHSA 2G9OA 2PSJA 4L72A 2ZJ7A 3PD0A 5TF0A 5E1OA 3OJEA 2QAIA 5B58C 5J40A 2OFGX 3FC9A 1UKAA 1YL6A 1T9XA 4WFJA 2WF6A 4CTOA 3DZGA 2DECA 1JX6A 1HEUA 3HCPA 3H99A 2RHMA 3TP2A 1USGA 4FD2A 3TQCA 1C7ZA 2UU9F 3U26A 1N32B 2YX1A 2UUCB 1E2LA 2I9PA 2QYSA 4I7FB 2D74B 1YHZA 1L9KA 3VAAA 4EVSA 2GLTA 2VT3A 1TKXB 4RE5A 1HG0A 2FZCB 1HWIA 1FE8A 4Y28C 2X6RA 4DV0F 2FZVA 3R44A 3MCAA 4EKEA 5B64A 1QJ4A 4TT3D 2O48X 2BFFA 4C8YA 2GVZA 4AS2A 5KFCA 4UHEA 4C5CA 1ID8A 2H1OA 1RZVA 2R8HA 1IPFA 1L5YA 4P2XA 2GZSA 4XB6B 3OL9A 5D5PA 5D86A 3HFRA 3H8VA 1A9XB 3B6ZA 4V02A 1FTWA 2A5JA 4YDXA 4HDSA 4GXQA 2WM9B 3CS3A 1REVB 2NTNA 1XQVA 3NP5A 2TMDA 1K89A 5C8VA 4MDEA 3SR0A 5EXXA 3KJQB 3JWIA 1ZMXA 3AHHA 4V19J 3FJ2A 3KHSA 1ZOOA 5D0RA 2BEVA 5HAOA 3V1TC 2PA3A 2W2LA 4WESA 2CPJA 3MJHA 4Y6RA 4MGHA 3HCXA 1G21A 2W42A 2HUPA 3MW8A 1W48A 3OAAD 2LXUA 1QYCA 4B43A 3B8HA 1U1KA 5B0DA 5K2MA 3K6SB 1M2NA 3F5DA 4D4KA 4X6YA 2ZT7A 2DFPA 2K1RA 1C4WA 1KIFA 1FUKA 4AZ3B 2Q2NA 5HMWA 1SZJG 4RULA 2HKEA 1XPJA 3IHTA 5B4TA 1PSWA 2JGKA 3QV2A 4BP1A 1SIWB 1H5QA 2XSJA 1VE9A 3UDCA 4F9FA 2AYMA 1VQ5S 2RI6A 1Y3IA 1F7VA 3DOLB 4HV4A 1Y89A 1HI1A 3T1TA 4UBKA 1XEAA 5CRIA 3IBFB 4JBLA 5F9FA 4JOSA 3M6VA 1JLFB 1KFJB 5JQGB 1YA4A 1U2FA 3I6PA 3PBKA 3H4IA 4Q4HA 5IZHA 1RWBA 1CEQA 8ABPA 1C50A 2JFWA 4Y2RA 6Q21A 4LX8A 4U3JB 1XO1A 4U2KA 3C7TA 5AJWA 4ED4A 3TCKA 4UOFA 2BE9A 3A0UA 1CULC 1WC6A 1TW2A 4ZYTA 1P2SA 2CL5A 2VIIA 2NADA 1G8KA 1TLFA 3Q6NA 4A1FA 4BNZA 5AVXA 4WXEA 2R8RA 2HSWA 2FI1A 3O90A 4J0HA 3FH0A 1XXHA 4CMGA 1VIXA 1NQVA 1WSBA 4EI9A 4CLOB 1PS0A 1MROB 1DP4A 1PSDA 5B37A 1G3IA 4JIMA 5HCUA 3U4QA 3JD4A 2AYGA 1HWYA 2CHVA 2KB0A 3ERCA 3MBKA 2RH4A 1VHIA 3CUTA 3S99A 3GDGA 4LJMA 1RT2B 1SUQB 1M66A 2XD9A 1Q1BA 5ERGB 2R00C 5BSUA 2QROA 2CBGA 1ZSVA 2IUFA 5FL7D 4OIMA 1JH9A 2ZRNA 1ZD9A 4FYIA 1P1CA 2P5UA 5K8UA 2J8AA 3IP8A 1L7EA 3DOUA 1ISJA 3JQPA 3DI6A 5J2NB 5JAHA 1NLUA 1JKIA 3ZJ4A 1PJSA 1W88A 4EHIA 2DBVO 4C87A 3LUCA 3DW1X 4MB2A 4GM4A 2DFKB 1FP7A 1B93A 3EG9A 4LYDA 4HHUA 1GKLA 5AXBA 5DBOA 1ECGA 1PCXA 2GF2A 3H1AA 4ZVNA 3UCXA 4NPCA 1P31A 1GPMA 4A82A 4TV8B 2I6UA 1RDRA 2J3IA 4HEA6 4DA6A 2NU9A 3HBMA 3C3BA 5KU7A 4HCJA 3PCRB 3R8FA 2OCIA 2XMAA 3BK2A 3AETA 1BVUA 1WQ3A 5ETMA 4YRJA 1HBNB 4LYHA 3OPNA 1HKAA 1ODIA 1DURA 1SELA 1PVOA 1PX0A 1H0SA 3MMCA 1T8SA 1L3IA 5IT9U 4HEHA 4D96A 1H7WA 5JWOA 4DIBA 4YAKA 2CUKA 5ES3A 3BC1A 1LF5A 4UM9B 4A8FA 1YI2S 3L04A 2BKUA 4OLPA 2DPIA 3VO1A 3AL2A 3ZHBA 3SI8A 2IAJA 2O8BA 5CVVA 1CUWA 4URQU 1X19A 2FR8A 3RBVA 3AW8A 1HLWA 4AL4A 4B6RA 3NTQA 4V1CB 2WICA 1RQ2A 1S5PA 2AR7A 2IYVA 2ZJPQ 3QFTA 2YZ7A 3ROEA 3F6BX 1UPTA 1JNRB 2OVFA 5DK4A 5LP6C 1ISHA 5D3QA 4LF5F 3BN4A 4RXMA 4I46A 3SV3A 1J49A 5IBPA 1C9NA 4MUAA 1T5LA 2IE0A 4BQQA 4QQKA 4PCLA 2OSQA 5AVVA 3UMRA 4YREA 5DLYA 3ASUA 1O9HA 4KAAA 3G0CA 2MKIA 1BWPA 1RT7A 3A6PC 1CF9A 3SFVA 3BGLA 3NBPB 4HATA 3JARB 1VKNA 2V3WA 4MK7A 5L1JA 4LRYA 1RQLA 4RD4A 2HRDA 2OHXA 1EE9A 1YS6A 3K70C 5LKAA 2Q3JA 1P3DA 1JZQA 4HQRA 4MAFA 4QXPA 3OEYA 2LXNA 4MS4A 5HQ8A 1IQUA 1QCYA 1WCWA 3T7AA 3W4KA 1YJQA 1MH9A 3R2DJ 3HA5A 4H4MB 2B8TA 1EGHA 2L2QA 1K6IA 1CY4A 1NP7A 1EM8B 4ZEVA 5F7ZA 3G5TA 3GB0A 2VJBA 1Z6PA 3AA8A 2HRTA 3CXRA 4JVOA 1TMMA 1UMJA 3TAHA 3NTRA 4EB0A 3GLFA 3FK4A 2NU6A 3O38A 5CLLA 4DQVA 1DWQA 1V16A 2JZ5A 5EMMA 1ATZA 2DQZA 1QFXA 4X66B 3VGVA 5BRNA 1OZFA 4BE4A 1RAJA 2DCMA 1E6WA 3PLAE 3JAMU 3BGVA 1OQ3A 5AXMA 4QYWA 2ZZMA 2HIMA 3TNLA 4Q66C 5E41A 4KWEA 5CZXA 2J6UA 5IC5A 4F1KA 1KS2A 2VASA 2YYAA 3VAKA 2ODWA 1D6JA 5JSZB 2HZ7A 1EETB 4TKTA 1LSSA 3DOKA 4I6AA 4MGIR 1TNDA 4FFOA 4NMHA 2FX3A 5JI2E 2DVIA 4IIXA 2GJFA 5GADU 4KGXB 3R27A 2P2GA 2ZNYA 1SZPA 1HFKA 1O77A 2NO5A 1QQBA 2PCLA 2PL1A 3O9ZA 3UTDA 1NR7A 1Z3IX 5BR4A 4QASA 2DBBA 4U5QA 3R5JA 1BW9B 2VSOA 1XRQA 4OQYA 4A6XA 4RM2A 2DUMA 1U9IC 4FKYA 4CMKA 4EJMA 3UI3A 5LLSA 4D46A 3TLJA 3J7YU 3AEKB 1GSHA 4IQ4A 1JR3A 1D6NA 3H2IA 1M5TA 3H1GA 3S29A 3NWPA 2XJ4A 2XC9A 1O6BA 3S2ZA 3SQGA 2JLZA 5FHRA 2BFCB 5DYYA 3A05A 4E5MA 5AK5A 1X8KA 1ZW1A 3ZVMA 5DFAA 3I2FA 3PIIA 4CQ1A 1ZD2P 1Q0PA 3JAWB 3W60A 5JVGQ 2ZYGA 4HGZA 4KC5A 1I2ZA 2VTDA 3CCCA 4GOLD 3B5IA 1LI7A 3STHA 1X7XA 4A3SA 2H17A 1FF2A 4FCVA 5H9EJ 1XA0A 4II2A 4PCQA 2YCLA 2VHCA 4XD7A 2HNAA 2KBFA 1DG1G 1GUAA 2NXJA 2AMFA 2V94A 5DDRC 1WXFA 2YQ1A 2DY1A 1U26A 4M5HA 1L2TA 3EXG2 4OQMA 3HSDA 2J85A 4K0KB 1E6UA 4K8RB 4YJGB 2C7QA 4DMRA 4WEQA 3M70A 3L0ZA 3INRA 1ST3A 4M5KA 4LJAA 1X2BA 2R84A 4ROTA 1FX1A 5BSMA 2PZ8A 1S6QA 1H2EA 1RWKB 2D8AA 4TXJA 1G8PA 3HEBA 4MV4A 1VRCA 3IAUA 5C5CA 2M5YA 1UKUA 3OPQA 5GAJA 2QW1A 5HP1B 1K98A 3OQ6A 2BSXA 4L9RA 1NF2A 4MRNA 1GL3A 1USKA 2B4RO 4NLRA 4B40A 2YV2A 4YN3B 1SAYA 3S2UA 1RBYA 4QL3A 3K9WA 4UBLA 5KS2A 2O1EA 2W2MP 2WMYA 1NXPA 5K0LA 1RP5A 2BM8A 1L5LA 1U2EA 1EGQA 2IXAA 5UKDA 4UUMA 3PQ6A 3VXKA 1TF5A 1RP7A 2B20A 3ASYA 1SBYA 2J09A 5K51A 4GKJB 1MLAA 3TN7A 1YR6A 3A1NA 1JI3A 2RF2A 5CG1A 3KYCA 2I4MA 4DJBA 2DRDA 3EX7C 2ZGVA 2JLRA 1Z2DA 2QAGC 3I1YA 1YB5A 2OENG 3PW4A 2NO9A 4NNJA 4FW8A 4ZVQB 2GCOA 1JEQB 1ZN7A 3EULA 3DQQA 4YAJA 1HURA 1NA5A 4S1PA 4Y7DA 1RABA 2F3TA 3V6HA 4W63A 3DBVO 4ZODA 2MZRA 3RK4A 3EJMA 1BMFA 4Q47A 1G4UR 3ENQA 2CQ4A 2PDAA 3D0IE 1U98A 5KOJA 1P0QA 5GGYA 4ZK7M 3EZFA 1X8XA 1UFWA 4PSUA 1MO2A 2MHCA 1OAOA 1OGYA 4UY85 1JN0A 2PGCA 1G9TA 2Y9HA 3S2GA 1NX9A 4KXFB 2XCQA 1NKSA 5JVHQ 2OY0A 2GPNA 4RW9B 4RD6A 3SZ2A 5E3PA 1JJFA 1GCGA 4JC5A 1Y1LA 3TTUA 1F8XA 1E2FA 2O2DA 5FYDA 4I68A 4WFNQ 3V4IB 2JK0A 5AKYA 5CB4A 3C74A 3FDZA 3EVWA 2FRDA 2QU8A 4ZPDA 4A0RA 1C1DA 3USZA 4BUCA 3SSOA 3D6TB 3ISJA 1BXRB 1FNNA 3DBRA 4HS9A 1PJ4A 2G3YA 1S79A 3ECAA 1CEEA 3FWNA 3CRW1 2HNKA 1USUA 4XASA 3HCCA 2D7DA 1HL6A 1N5DA 4EG5A 3UWKA 4TTSA 5JSYA 3PVXA 1URNA 1S0UA 2WBRA 3CJ4A 1MB9A 4MUEA 5KFNA 1NXOA 4DBVO 1FDDA 1NJZA 3SBEA 4X62J 2CLEB 2C7BA 1VIMA 3FCEA 3IR5A 4RSMA 1SUSA 1A0OB 3TZLA 4LRFA 1D03A 3DAHA 1OREA 3BSNA 3T9FA 2R96A 4AFNA 4BBAA 2ZE2A 3F71A 2IPOB 4H1TA 3R5CA 2EFYA 4FFDA 4LXTA 4NLWA 5I3PA 1G9XA 1U1GA 1K8XB 3BKTA 1U48A 1AA1B 1RHRB 2D5LA 3N8HA 2ZOGA 1GYRA 3PEEA 2I66A 4G1QA 3CKYA 4U1RA 3I2HA 3MLBA 4Y9DA 1RAEA 3FPAA 2W7PA 1RM5A 4CTKA 3QGHA 3CZMA 4X92A 4YR3A 5KJCA 4X7MA 3GHYA 5IFLA 4DV3F 4QT4A 4N6NA 5A4DA 4M53A 1JMVA 3CTPA 3GWCA 1GAOA 2CBXA 3JTOA 2RU3A 4BAGA 3OWHA 5IVHA 3BV8A 1S2NA 1NULA 4NZMA 4YMEA 3U7HB 4XRRA 3I4LA 1VK3A 2PZJA 2FNAA 3HV2A 5M2PA 3A6KA 4UBJA 1R0CA 1V37A 2YIJA 1NSQA 4C0HA 2J7PA 3HVTB 1CJUC 3BXXA 3K2IA 4H27A 2BXJA 1UVJA 2MZ1A 4YPVA 3OL8A 1YB6A 1JMYA 4G1VA 4B5LA 3SCIE 4J9MA 4E5YA 4KVAA 2N1BA 1OBVA 2XRYA 3KPWA 4MWTA 4V0QA 1BQMB 1SBQA 3ON5A 1EXNA 4USKA 3VPSA 4NXMF 3ZWCA 3CFYA 1XKLA 2Y76A 4KGZA 1NFQA 4G85A 2QSFA 5L3RA 3OIGA 1IM8A 4OFXA 3ZWAA 2BBTA 4LFCJ 1JL3A 4O4HB 1XTKA 5J43A 3MXHP 1JLCA 2D8MA 4BNXA 4H6WA 5FI0B 2DX7A 1JFFA 3OC0A 4ZP7A 3P9SA 3G6XA 4X6XA 3RKUA 4X4QA 2E5LF 3WLKX 3ZV6A 1GRRA 5IKMA 2IFXA 3ET6B 5AUNB 3E1KA 2DWQA 2E5IA 1KQSR 3NS6A 5FA8A 3L7KA 4YVFA 3O5AA 3EDQB 2Y0DA 1RWVB 4PZ0A 3LDAA 4G1PA 3OO1A 3CPJB 4HRYA 2GQ2A 2D59A 10MHA 4MQ5A 4OQ4A 3E84A 2PKRA 2OPBA 2M70A 4TLLB 4ZT3A 2HHHF 1HHTP 4PINA 1G20A 3V32A 3C87A 2XTMA 4YTEA 2MU1A 5FUBA 5D84A 3X1MA 5BV8A 1DIOB 4KE6A 3KSDO 4NL4H 1VHQA 3AD8C 1DQNA 2HPHA 1T26A 1L4LA 4KNWA 5IT5A 1EB9A 3P5TL 2AJ1A 4ZIWA 4ZEWA 4ZP8A 4GP6A 2WJJA 3N0RA 2VYND 3H8SA 1OFTA 3TB6A 3LX4A 1JS1X 3BRQA 2YRFA 1JWLA 2XNDD 1CUYA 2LU2A 4RD2A 2V2QA 2ZIFA 3S4YA 2IBTA 1YL5A 5CCBA 4I4TF 3O6VA 3RKSA 3U3RA 4QBIA 3VVLA 1AZSA 4HI0E 2F4VF 1J8FA 1WD7A 4QJ4A 4YBZA 2GETA 4LNUA 2ZRGA 1WNFA 3QELB 1UXGA 2C2KA 4RWEA 1FL9A 4DDVA 2QPAA 3SU8A 3RYHB 3IE2A 2ZSEA 1WMBA 4XIFA 1BFUA 3C46A 4I0WA 4NS4A 3JTEA 2WF8A 2XY4A 4H9GA 2EKBA 1N33J 4U9IS 3ZGXA 2B98A 5FLYA 4ANEA 1NW3A 3GGOA 2HU5A 4XSVA 5CXXA 3KSUA 3F41A 4OV6A 4YB7A 4C3LA 4Q9LA 1TZJA 4YROA 3GOHA 1IHDA 1RWMB 4DR7F 2VD3A 3RAMA 2FSFA 2QN9A 4BU0A 3V6DA 5GMEA 3PB3A 4GE3A 4JOBA 1R3DA 3ZI7A 5EPEA 4J91A 5EN1A 5L95A 3WB0A 4ZPAA 1M1UA 4ZPJA 3N2KB 1FUEA 2M6RA 1DTEA 2GN2A 4A8JC 3RJZA 2EBUA 3HACA 2O7QA 4HFNA 4OBXA 2YS6A 2PEHA 1X4BA 1S2DA 4K6HA 2Q4RA 3ZV7A 2QMXA 1HGXA 4PXBA 5EJ6A 1F5AA 4WYLA 1OKKD 3OJCA 3KLOA 3W65A 1VI5A 1DZ5A 3BFXA 1KFEB 1ZEJA 3ILHA 4BVBA 4MMYB 2XMSA 1Q78A 3IUBA 4YP1A 5HCNA 3SBOA 2C0PA 3ICWA 1SC9A 3ABRB 2QRNA 5DX1A 5FIIA 1ZD3A 2HTFA 1KIAA 4TYPA 2ZB4A 1M34E 3HPQA 3LCVB 2W71A 4F67A 1HWJA 3Q9LA 2RQMA 5AW2A 1PD0A 3NDJA 4C5AA 1P2UA 3FFXA 1OGJA 2QZZA 4ZICA 6REQB 1CY6A 1F38A 4AC9A 4M89A 1AK2A 5EMKA 1TDJA 1Z6YA 3UYLA 5CVDA 3HKWA 3P45B 3EEYA 1ZCFA 2BOAA 2IU3A 1H1LA 2ODAA 3TRJA 3J7ZT 1XRSB 3PRYA 3H0PA 3UQYS 4UCWA 3IEXA 3FE2A 1TP7A 4EF5A 3WMRA 3N2YA 2XAUA 4Q01A 3DJYA 2DUNA 1RLOA 4EUNA 1I9GA 5HVGA 4BVHA 5A0YA 2YC2C 3W2GA 3MJDA 1BTOA 2DQKA 2KM1A 2QX4A 3M9NB 1XLVA 4BN0A 3H1BA 5HLFA 2ZYWX 3DEZA 3R3JA 5AYVA 5HRUA 4NEQA 5A9TA 1NB7A 3WHPA 2AQ4A 5KYWB 1A2OA 1ZPWX 3G9QA 2RVJA 1E3DA 5JBQA 3QQCD 3NBFA 4ZJPA 1KR4A 3GRAA 4F4HA 4P10A 3UKOA 3J80A 5IKOA 4J16C 3BBLA 2UZ1B 4K59A 1X7YA 2LEPA 1FEEA 4QU5A 4TL7A 2HL6A 1I8TA 3H9JA 4ZPTR 4J7XA 2CLKB 5IANA 6YASA 4LV5B 1FKOA 1HC7A 3LUDA 4PUOA 2Y9MB 1S9DA 1NOIA 3NKLA 1ORVA 3U37A 1H2ZA 5HIKA 2CJFA 4IIGA 4NK5A 3ZNNA 1C1BA 4NMMA 3ZKWB 4BLGA 3IP6A 2EFEB 2BKVA 2WTEA 8ATCB 4X5OA 4B82A 3BDVA 1O89A 3TYTA 5FX2A 5B7GA 1TKCA 5C2JB 2Q8QA 1V41E 5GGXA 2AYBA 3OEHA 1PFYA 5C2CA 2XHCA 1Z73A 3TLBA 1H2BA 4Z8YA 2B83A 1P0FA 2PHZA 2BZ0A 5EHHA 4F4JA 1OH6A 1PAUA 4HPJB 1RAGB 1NPRA 5COQA 3QZUA 5T7BA 4P7JA 4E12A 5EIBC 1C30A 4ZOLA 4TUYA 3UMSA 5EN4A 2VATA 1RXWA 1HRKA 2AC7A 5KNCA 1E9DA 3HXTA 4O3MA 2RU9A 4NPAA 2AI1A 4CIVA 2XCRB 3SJZA 2JG3A 4TTJA 3ET5A 1TL5A 1RI5A 1XMOB 5CLIA 1FIUA 4DCTA 1FERA 1H5NA 2BVNA 3HDGA 4XWWA 3L7CA 1MAAA 2MTBA 2X0DA 3REFA 4HNUA 4FCWA 4C11A 2E4XA 4LDNA 3WDLA 1G7CA 1BKYA 1Q82T 4W99A 1P9QC 3UMCA 4R2KA 2IYRA 2DNPA 2B37A 2OBBA 1H2FA 1QQ7A 1KVKA 2FPRA 2G9ZA 1KBZA 2QMYA 2ATXA 4DB4A 2ID4A 1I1GA 1X5SA 4LOLA 1B74A 5AW1A 4OBBA 5T3YA 3V6KA 1EP1B 1K3TA 1KMQA 3WLAA 2ZJ5A 4NLSA 1T1JA 2BAGA 3MEQA 1P4SA 3A4IA 1SUIA 4D43A 1N2OA 1W4LA 2M7SA 3F67A 3TLXA 2Y05A 3NONA 3HKEA 4F6RA 2BWJA 4JFRA 3WNDA 1BXGA 3QRWA 2DJWA 2W83A 1XTVA 3SAJA 4F6CA 3DYBA 3M0EA 4EQZA 1XNRF 1ULHA 6LDHA 2CMFA 5FHQA 2WTMA 3U1LA 3FZQA 1E77A 4R81A 4ZN6A 1X0FA 2D13A 4H59A 2IK8A 4DR2F 2JGJA 5EQDA 5EA2A 3CNHA 4QUGA 4TZ0A 1RWPB 1TJNA 2IRYA 2JIZD 2A9QA 2UYCA 3AD7C 3GCWA 2LQBA 2O4CA 1YR9A 4C22A 1GZ5A 4ZIRA 5K3AA 5IAJA 3OKPA 4B35A 1KK3A 3ZV4A 1JR6A 1NZ8A 3GK3A 2O5EA 4LIPD 3BXOA 2VHJA 2ZG6A 2FFQA 4RENA 3PSAA 1UXOA 5EHXA 1R6AA 3OICA 3M89A 3PI6A 1CQXA 1ZLXA 2KG1A 4FBMA 4Y6GB 5IM4F 2WB1D 4LY3A 3IAM1 1XMJA 1UA0A 1ZESA 2H31A 2UXBJ 1AT1A 2A0KA 5BYKA 1Z7WA 3IKLA 3QVUA 4AQYJ 5IWAB 4EYSA 2A7QA 2V7UA 1ZC3A 4JEMA 2HFOA 2CNLA 2E18A 5EIWA 1V6SA 3BDIA 4K2JA 5J1EA 1U6FA 4U4AA 2QY9A 1EUCB 1U8TA 5EKDA 1C0PA 3I6YA 1JIHA 5CNMA 1P7YA 4TXLA 1IDN1 3N3AC 3PK0A 3LT4A 3OTOJ 5JD5A 1BCRA 1F6WA 1JFSA 3W5DA 1V45E 4HXFB 3VISA 3NMRA 3F1LA 4Q5VA 4NOJA 1WA5A 3PE4A 2Z5FA 3AFMA 2CWXA 1OYDA 2JFBA 4NYZA 4R9SA 4J9PA 2AG0A 3LCUA 1JHZA 3VPFA 5AVKA 4GRIA 2ZCUA 3TR6A 4U7FA 3TQFA 2DH6A 1VIOA 1T5SA 1O0PA 3ZX4A 2RQ4A 2BTOA 3HO6A 5FV4A 3U17A 1S1WA 1F7UA 5CDHA 2V0CA 4L7QA 4C04A 3CW9A 4NYIR 1RE1A 3P5BP 2FPHX 5FUYA 3BM5A 2ZREA 3MWEA 2X7IA 1WY5A 4I50B 4Z4IA 3KOMA 4A26A 2EW8A 2V7GA 4ALIA 4C6SA 1K2VN 3EEBA 3CDEA 4RW4A 1OXXK 3H90A 4PO9A 2OPSA 3RJTA 2F63A 2FDRA 1RYHA 3ZVLA 3QW2A 4BKMA 1D5WA 1A8SA 1K9VF 5HKOA 1GEHA 3GCGA 1Z0IA 1XWLA 1L4YA 1T0TV 2B0JA 2OYRA 1H0RA 2WHOA 4QJIA 2J48A 1E5LA 5C3MA 2WIBA 5BN5B 4FZVA 2ATIA 2H2WA 3ICOA 3K5OA 4Q05A 4RNFA 1UC4B 5DHQA 2GYUA 4OXNA 2EKQA 4QPNA 2HV8A 3DVRX 1YD7A 2YWHA 2GMHA 2V4UA 2AOUB 3RT9A 2QJWA 4OI2A 1THMA 3KK3B 4RIGA 4EL0A 2AJ8A 4CNZA 2Y8WA 4ABYA 4UBMA 2RNEA 4KVFA 5FR1A 1HQCA 3WZ0A 2ZE7A 5TPWB 1WUUA 4MFBB 2W6OA 2R85A 4LHYA 5AESA 4JGGA 3V4FA 1Y7LA 5NLLA 3LRTA 2PLFA 4QDKA 3NHUA 3O74A 2GNKA 4BZZA 5CCXA 2IKQA 4ZYZA 3AD9C 1MDBA 4Z9BA 5KG6A 1QLWA 3FMFA 3IWLA 2OGZA 3INYA 3D3QA 4B3SF 3O2QB 3L77A 2ZQ5A 4H1VA 1UBGA 2Z56A 3VJRA 1GGJA 4CTJA 2FU5C 4D0GA 1QAMA 3FRYA 1P29A 2WVBA 1RHUA 2J0XA 1Q21A 1ESMA 2UVQA 3EHEA 2IPNA 3C0KA 3WLIA 3OO0A 1REGX 1OXTA 4YB8A 4KWHA 5JSFA 1NL3A 2W9BA 1O96A 3FTQA 2ESRA 4LDQA 3FIJA 1A8PA 1CXZA 4DG1B 4IWNA 2X2OA 2ZSKA 1GFZA 4R3WA 3QFFA 3SCLE 4FOPA 2E0IA 4YRNA 4IYJA 1SB6A 4U2GA 1DTQB 2J3MA 4CEIA 2RIRA 1J6UA 5ITZB 3H5TA 3A31A 2P5YA 2VPWA 5EWMB 1BQ4A 3RANA 2P78A 3VAJA 5HKBA 5DO9A 2ZJ8A 4K0RA 3UQSA 4NYIQ 3FUVA 3M33A 3QWPA 2H4YB 3GU0A 2JFVA 2C7VA 4B9VA 1G7SA 3K0CC 1P9NA 4LYGA 4TMTA 2ISSD 4UVGA 1Z33A 3EUFA 4H6VA 5IMBA 1KZ7B 5HBMB 2O5RA 3TXAA 4L5IA 1RM4A 3R7WA 2XT9A 4D57A 3ZHQA 2HB6A 1TADA 2NUBA 4QQRA 4RIHA 3PIOQ 4ZAGA 4Q1DA 4OLFA 3KHLA 3B6BA 1UPAA 2NUPB 5JJIA 1IJBA 2X86A 4YOEA 3H7HB 4YCSA 2D2VA 2AFIB 1GCIA 1U9CA 4IDPA 4ELVA 2A35A 2GD6A 1IEXA 5A6SB 1YOBA 3ZQ4A 2JAOA 2GFIA 5GVQA 1WXWA 1WC4A 2AYEA 1J06A 4HVLA 4K4YA 3I5CA 5JJ5A 1J2RA 2H2DA 1J1UA 3HBLA 1KLMA 3N39C 4IUYA 1DINA 3S2SA 1DY3A 4YLGA 4UUPA 3QX7A 2KXNB 4AZ0B 5DNUA 3WVNA 3KR2A 4DCNA 3IQGX 1KRWA 2XE6A 4HVTA 4RV4A 2PNJA 3G5LA 3J81U 2WKSA 1FVXA 1Z68A 3GJRA 4ZK2A 1HT3A 3MDFA 1QYXA 2W2TA 1MA3A 1WP9A 1S3GA 1ARZA 3J7TA 2GHRA 4C5BA 3QIAA 1NXSA 1CT9A 1QY7A 2G67A 3CG0A 4ESOA 1FE4A 3BG5A 5AI9A 3DF9A 4GOOD 1TTQB 4NIMA 4QR2A 4IXNA 4MB6A 4O4LA 3QX3A 3RVPA 3QO9A 4Q9NA 1KZ6A 1DTTA 1Y9EA 1GVHA 3BPDA 1EFRD 3ZXSA 4YGYA 1KO8A 1FP6A 3CLSD 2B1RA 4ZVSA 5IG2A 1X1SA 4NI2A 4AURA 5JFTA 2AOWA 4YRGA 2R42A 3SDZA 4C01A 1KKHA 3UV3A 1D6MA 3CEPB 4BHTA 2WKWA 3KZXA 4HZIA 1QF7A 1GQYA 5IABA 1P7ZA 4FE4A 3QEMB 3N5BA 3DGPB 1FDVA 4ZCKA 4OL8A 3DGFC 3ZGZA 2QBYA 5JJLA 4D26A 3A25A 4J0QA 1Y9AA 5CDGA 1E20A 1R0LA 3I1IA 4I67A 2BANA 1C3VA 3M1YA 3G87A 2XCLA 3VDMA 1AF4A 3Q83A 2CVOA 1OI7A 2FVCA 2UUAJ 2Q1SA 3BOSA 2BHTA 3E58A 1NKCA 2ZSHA 4IFBA 3VNRA 3ZDZB 4A8PA 2BACA 3ZH9B 1R18A 1HV8A 3M6MD 1EUYA 1LFDB 1RQXA 1S4FA 1SC1A 4Q9KA 2IXBA 4BO1A 5JFOA 1GPJA 5DM6Q 3AXKA 2ZRQA 5JECA 1W73A 1RC8A 2Y1GA 2LZ0A 1J33A 4HDRA 5BVGA 2ZUSA 2XGJA 1EX1A 3AHEA 1Q74A 1IWGA 2CE2X 2AK3A 2FMUA 4GI2A 5DXFA 3THYA 1QYVA 4FXVA 1CV2A 4MRAA 3ZPXA 2LR0A 2C5BA 4ESEA 3WWDA 4MVYA 5JU6A 4R1UA 1ZGGA 2B1IA 3JRWA 5FL3A 2WYIA 4MUNA 5FPSA 5KFQA 3VUEA 1J2JA 4YDHB 3PW5A 4XX1A 1ZHHA 4MGZR 4ICLA 2VFAA 1UWLA 1QG4A 3SC3A 2CFIA 3WLMA 4R54A 3K8OE 1Z5NA 3M8PA 2KT5A 4PQGA 2BMAA 1S02A 2FR0A 5E6SB 3LXUX 3QKUA 5DJ5A 3NKYA 3WL3A 2OV8A 3QWUA 2RGNC 3U1NA 2CXTA 1Y8ZA 5J5AA 5I47A 1YZUA 3SX0A 3TSAA 3D2BA 4TZKA 3MCZA 2VUIB 2GZAA 3EXFB 3ELHA 5K20B 2BW7A 4IR1A 2BKAA 4N39A 2ATCA 2YZNA 3KP1A 2XCOA 1W0JD 3AV3A 3OJFA 2VUUA 4WWHA 1QP0A 4ZYVA 2U2FA 1OFHA 4LSLA 3UPUA 1XKQA 2VTBA 1XLTC 1E66A 3G96A 2VQFF 3JTPA 1E1RA 4MVJA 5JH7B 4EVRA 1EI9A 4WK3A 5T7LA 3C4QA 3PYMA 4LMAA 1QYDA 2I29A 1NLKL 2V9PA 2RKIA 3FFTA 4HWPA 3WLPA 1DTWA 4ARSA 1H42A 3CVKA 5BT9A 2PLAA 2GM3A 4N5DA 4ZZ3A 5IBRA 1NXIA 2CV0A 5LMUF 4E3WA 2R7OA 3C48A 1VKZA 3FNHA 2M52A 4O2AB 3EC1A 5H80A 3WQSB 4OYOA 3RRYA 3I28A 2ADMA 4CU5A 3ILIA 1OW3B 3AU9A 3RU2A 3CC4S 2E5GA 3VPHA 2VDNB 3MWFA 3C4JA 1T36A 4NJEA 1Z8HA 3IMCA 1FXUA 4KSEB 2X4LA 2IV2X 3W2IA 1FW6A 3KTAB 1JJ4A 1GLGA 1MV8A 1RSZA 4Y2PA 3I58A 4MR9B 1M9NA 2IE8A 2A1UA 4HN2A 2WRMA 3MR7A 2FWNA 1UXHA 3BSAA 4KQHA 2ZYIA 1VSVA 2RHQB 1GCAA 4PX3A 1S99A 5EJ7A 4KRWA 3E3LA 5LWHA 1XQ1A 4PO1A 4TX1A 4UTOA 1OIWA 2GHPA 1JEYA 1PS9A 3KZCA 1YFLA 1S9GB 2XMBA 3LQYA 1JLGB 5JS6A 4R31A 1DV2A 4D8VA 3F5QA 4KKXB 1DCKA 3L4SO 4IH4A 1Z2OX 1Z4JA 3C6MA 2Y1DA 1QQ6A 5FH9A 1RLDA 3REQA 1P6XA 1KZ9A 1OWNA 4TTIA 2VNKA 4WOPA 4BX9A 3G4SS 2REOA 2FSVC 1QTRA 3GYGA 1J9ZA 2V58A 2BCJQ 2E1RA 5IH7A 4C2AA 1DAEA 3OIYA 4HVAA 1QH8A 4AD8A 2YOGA 4TYWA 3UENA 1ULZA 3EUAA 2HVHA 3IHLA 3Q8SB 1UFRA 1NN5A 1ICEA 4YUXA 4Z54A 1KWMA 2WG0A 3WOVA 2OXTA 1LWNA 1FTCA 4B9MA 5GINE 2QU7A 3QG1A 2WBLC 5A62A 3MMAB 4LDJA 4HDCA 3R0ZA 3KJVB 4YP5A 3KQTA 4RJIA 3JV7A 2GZ1A 4XB2A 4F50A 3X0DA 2ZI6A 4J9RA 4A8SA 4TRMA 4MMZB 4CKCA 4M7OA 4CODB 4IQMA 3C3LA 3C1AA 1QC5B 4UVIA 2J46A 3P9XA 1P2BA 2CDRB 3PRVA 1ZGCA 3EYWA 4C7MA 4DDMA 2UZ0A 1JAZA 3X2EA 4G6VB 5IAAA 1PZGA 1EP3B 2NZUG 4QYSA 2AMYA 1YKFA 1R9GA 1T10A 3OR1B 4AN4A 5C32A 2EHDA 5C5DA 2ZOSA 4DQKA 1UPFA 2HQSA 2Q45A 4FBLA 4RU9A 1Q7BA 5A2QU 2UVPA 1XKXA 2JLSA 1EFLA 4PG8A 3U44B 4HH4A 3HFJA 3RCBA 3JSXA 5F21A 1MJFA 4Q3AA 5JXSA 3VQSA 2HQ3A 3PACA 2G9NA 3L7NA 4B9TA 4KMMA 5HVNA 2HPAA 3AKEA 4E5PA 4KNVA 4YJ3A 1FC0A 3HB9A 4FN4A 1U24A 3I4PA 2PH3A 4M54A 3QEOA 3TEJA 2B4VA 5CB4F 1QIFA 1W6RA 2LDBA 2C2MA 2K3KA 3CE8A 3C14A 4V3CA 2HMIB 3BF4A 1JQGA 5HK8A 2R68A 1SHKA 3VYUB 4LYYA 1WDTA 3LPLA 3Q9SA 4XCXA 1U4SA 4JBGA 3OJUA 2XULA 3MFQA 4AZWA 2A33A 1W5AA 2VC0A 3LO5A 4DUZF 2FPXA 2G88A 3A1DA 3NUQA 1DJMA 1QRTA 4YMGA 1AC5A 3WYCA 3TJMA 5BNIA 3DWFA 3EXHB 1BQNB 2W6JD 1ZI9A 4O2LA 4URFA 1SIUA 4IH1A 4V38A 3AJ2A 3EBOA 1IN5A 1V2GA 3TLKA 4JR0A 2BOPA 1WHVA 1UOQA 2PGNA 3ZU3A 5JXJA 3QW4B 2FEOA 5BNFA 4TXNA 5F5LA 1GUBA 2E7VA 1SK8A 1X1AA 4XI9A 5JBIA 2F17A 4FFBA 5H16A 4AUMA 1L5GB 1MIOB 1VLLA 3QVWA 2QSJA 1W85B 3BD6A 1U5BB 1RM0A 4NWBA 5SY9A 1I24A 5FUVA 4YMLA 2VAPA 4NXNJ 5BXQC 2KX7A 5KC8A 3P9YA 4DPKA 2DHGA 2IHZA 2I80A 5H59A 3HJFA 2ZI4A 5JS2A 2HSJA 4KZPA 1E6EA 3O8QA 3R8YA 4L4RA 2G9UA 3GCZA 3KTOA 4X6LA 5K3BA 5I45A 3LT5A 3LUBA 4IS3A 1D04A 3WWCA 2G1PA 4N9QA 3NC0C 3PLNA 3N0VA 1HNXF 4PW0A 3BSOA 2GIFA 4BVLA 2BJEA 1EFAA 4AG6A 1TA9A 1OLXA 2DTXA 4JJGA 1IXRC 4ITRC 3HBAA 2J8SA 2PUWA 4FBTA 3CUYA 2XCAA 5CBPB 3ND5A 4LNHA 2GVZC 4IRMA 4AYWA 3QBVA 1RU1A 3V4VB 3T7JA 3A3PB 2R86A 2HY7A 2XBPA 5KFLA 3I6BA 4O3PA 4K6OA 1CQIB 1NI5A 4HN4B 1TAHA 4ZDWA 4IR7A 4XFJA 1TE2A 4N40A 5BOSB 4AFFA 4UM7A 4HI1A 2B7LA 4COOA 2GEUA 1GMWD 1RTDA 5KTNA 2O66A 4ZPCA 4JKYA 3Q3CA 2OGWA 4FCTA 4P3PA 2WYHA 5JDCC 1OTYA 3UWOA 2CJPA 2OO3A 3KDPA 2QLBB 4RTRA 4QODA 4QU8A 2GB4A 5JHHB 3OVBA 3DT6A 2MKHA 3D8RA 3QOWA 3T3HA 3UN3A 3DDSA 5IM0B 4A4JA 3ADPA 3QF4B 1WZ2A 4TRJA 2F3UA 3RB4A 1FTGA 1FJGJ 4KYTA 4QFMA 1BO6A 3VPDA 1P17A 1JKJA 2BFDB 1GZDA 1WORA 5LU8A 3QMQA 3HKDA 3W64A 3BO2A 4JYCA 4XVHA 4KL8S 2AT1A 1TQ2A 4NLQA 3P9NA 4N9WA 4ZT4A 3RBDA 4TV9A 3AXTA 3UMVA 2DB3A 2B4AA 2M1XA 4NSNA 2OBMA 4B4KA 2O57A 2OCKA 2IEBA 4DIOA 4FPXA 2FFAA 1H2XA 4EPYA 3RS0A 4PQUB 3R5TA 5GM2A 1N57A 4F4ZA 1IZ8A 2VB6A 2ZTLA 1HE2A 1UODA 1NURA 2ZBUA 2DNHA 1DJOA 4EHHA 1KEEA 2JCGA 5KX5F 4RUHA 5CT6A 3R6LB 1Y3KA 1SC4A 3SSNA 2QTWB 2VIHA 3OLCX 3LFTA 4KQWA 5CCEA 2WZQA 3DCYA 1KQGA 4G5HA 1HARA 1W75A 2I3BA 3QEJA 1IY9A 2OQRA 5TPZD 4DLWA 1ECCA 1U7UA 4KXXA 3MEEA 1NPYA 1UKEA 1T5TA 4HO1X 3T5TA 4XWOA 4UE6A 1FS5A 3CLRD 4L0DA 2OV3A 2XB2A 2JFPA 2O07A 4BRWA 1VRUA 4KX5A 4RVGA 1QR6A 721PA 2ZRAA 1RRMA 2HZVA 4YV1A 4GU5A 3PKJA 3N05A 1M1YE 3D2CA 4QOTA 2OP1A 4R8SA 1SURA 5A8WA 4OYIA 4B7AA 2AFVA 4PZPA 5JY1A 2MDAA 4FHZA 3DOOA 2IDZA 4G0OA 4PXAA 2HBQB 1SXHA 3HD2A 2XZPA 4OZJA 1AZWA 1BY9A 1ZC4A 2DP4E 2G83A 3MR6A 2JL9A 1GPAA 2PT7A 1QU2A 4LF4J 1IBLF 4MXDA 4CV2A 1RPJA 2E2WA 3EZ9A 1R74A 2MQOA 4WKOA 3KEOA 1T9TA 4D3SA 1P27B 4MWZA 4IMRA 1J56A 4PGHA 1K8QA 3I0SA 5E4TA 3A6LA 2RUSA 1RLJA 5U47A 3EEOA 4LA4A 5E3RA 4KHRA 5EQFA 1QVFR 1OVMA 4YRQA 2EZ8A 1UMDA 4Y00A 3MZ0A 1K0TA 1WOOA 3T1QA 3VO8A 1YDFA 4CCAA 2Z98A 4R1PA 3WGTA 4C2BA 1DARA 1AQYA 3G8BA 4ZVOB 1VRTA 3P96A 3ZU6A 3SEAA 2PM8A 4NH0A 3OQOA 5CUQA 2BH9A 2W2KA 4WVLA 2H6EA 4FWBA 1V11B 4HRVA 2B56A 3BREA 2GD2A 1GY8A 3MPOA 5K8CA 2KVQE 1D09B 3S1AB 1KHVA 4IUFA 4GF5A 2OAUA 4MDYA 4Q9HA 5K14B 3L8DA 5AJYA 3CH6A 3D7KA 4QNRA 3SNKA 3FDSA 1EE2A 2XUJA 5EQJB 2HRZA 1PZEA 3NAGA 5EX0A 4DV5J 2KWIA 4CGYA 1W35A 3Q3JB 2CPHA 2FR8C 3NNDA 4WADA 1M2VB 2JHAA 2VNJA 2WBMA 1G9SA 1RAAA 3BVPA 3E53A 3NIWA 1QANA 1IY0A 5AD1A 2Q3DA 3DBHA 4DSTA 2O0JA 4JT4A 1UXIA 2YV3A 1WNEA 3PWSA 2DK2A 2PO4A 4QEDA 1Q3KA 1OB5A 1HA3A 3BERA 1CUCA 3HXMA 1MEOA 4LK3A 5DLQC 5ER6A 2ZCVA 1J1IA 5CNIA 4PZEA 1KP2A 3KLHA 2YYZA 1JLHA 5DDQC 4AUEA 4IDHA 3CX6A 4JSTA 1LWCB 4S1WA 2R7RA 3P2IA 3L0PA 4U9RA 2A2ZA 4FVTA 1Y80A 2CMHA 5CH7B 3TZZA 3U16A 3Q6IA 3RYCB 7AT1A 5M2UA 1Z75A 1U31A 2CV1A 4PRFA 2XE8A 2WJ4A 2ZOMA 3D7SB 5DV9A 1YACA 2Z57B 3EVAA 1UT6A 1Z26A 5JAMA 4C1NA 4P4NA 5FWNA 3W5VA 3MGJA 3RROA 4MO2A 1H23A 3RB0A 1YUMA 1SCDA 4F5EA 5CB6A 4QSHA 1T8TA 1F0YA 4GLFA 1RLIA 5KNDA 2CHUA 4RTPA 3MTJA 1Z0UA 3E9NA 1DRUA 4ZA1A 1Z0ZA 2YIMA 3T38A 1ZGBA 5AUPB 3W2WB 1C0IA 2WI8A 1XZBA 2HQGA 2HWWA 1T15A 1Y37A 4DV7J 2AHOA 5IF3A 1P75A 4E5DA 5ARCA 4M1EA 3FKBA 2OA0A 1PYDA 2WSEC 2P5SA 1Q0QA 3W90A 4JU9A 4L5CA 2CY0A 4I5DA 4DM4A 2VJYA 4OTZA 2WQ7A 2DLNA 3WP0A 3LO3A 1D2NA 2B78A 3LZDA 3VDQA 2JIOA 2DT5A 1E2UA 5FCDA 4NU8X 5IC6A 3MJSA 3BGRB 5GJBA 3KKPA 1U3TA 1CJCA 4BB6A 3IGNA 4R8RA 1P19A 1T6XA 2ZATA 2ZE5A 2YFQA 3DXSX 4ZOLF 4TUYF 4LSZA 1VB3A 1X80A 2QL7A 4M1SA 1A04A 4ROSA 3B12A 3SPXA 2BBOA 1DAPA 1HBUA 4DRXB 2AB0A 4B80A 5P8WA 4ZLPA 4RELA 2Y0CA 5KJ6A 5FA5A 4NABA 3ZK8A 4MLPA 3AB2B 3PPWA 1I2MA 1C1XB 4GI5A 3FBCA 5EQTA 4IFYB 1K68A 2PSEA 4ILLA 5C1OA 2O14A 3V8NA 4IDGA 3X1LB 5CFLA 2Z4SA 5CT9A 4QPZA 4ECSA 3K8VA 1X8JA 4H3SA 3PGA1 2MR5A 4GMXA 1C0LA 2Z08A 4F5DA 4MKRA 2Z6UA 2IITA 3WRXC 3PX2A 2ZKIA 1D1UA 2NU8B 4TU8A 1MJHA 3L6UA 4ZQIA 3F6RA 3P3DA 2YWBA 3I2YX 2WVEA 4JLSA 4BP8A 5BN3A 4D5EA 1KXJA 2HHAA 2JIBA 3N2IA 5D7BA 1ZX1A 3GP5A 1TZCA 1YHQS 4O44B 1NXXA 3FGNA 2CCGA 5KCZA 1U0SA 3J81k 1IBKJ 1IR0A 3IRXA 3B2EA 5JNSA 5L40A 4P2GA 2OLWA 5JXHA 3IBTA 3CRMA 4YRMA 1NBWB 1AK9A 4DM3A 3TJ8A 1FVOA 1MN6A 3DE2X 3UD3P 3GMGA 5ALIA 2GO1A 1K6MA 2DAPA 1JUDA 3H6KA 2H4HA 3HCBA 2VBWA 1M90T 3EUWA 3EXIB 3KVVA 3SZRA 1VQKS 3A9TA 4KQJA 1W2IA 4XA8A 3OLZA 5L39A 2R6HA 2ZB3A 2IS1A 3HB4X 2DJIA 1D1SA 3IH5A 5KOIA 4B2YA 1GXSA 4XOIA 1TEHA 5TE9A 2FXIA 3G0IA 2H3EB 1AF7A 1Q44A 3RVRA 2X7XA 3NCHA 2PMEA 1FDNA 4PHTA 2P9HA 3THXA 3MWYW 3ZK7A 1HUQA 4LVUA 2ZRPA 1XBTA 1JECA 3H16A 5AXKA 3T7KA 2OI2A 1WD6A 1E6MA 4ZCIA 1I4WA 3FB1A 4RGVA 2WR8A 2MJLA 1E6YA 1ZL0A 3AOBA 5DYNA 2NXCA 1BOFA 1VE7A 4MZDA 3RF7A 4YQZA 2J9CA 4M5GA 3AVPA 1FP2A 3K70D 3IDQA 3PGKA 4JXJA 5H70A 1PYTA 3MELA 1D6SA 3HP1A 1NIPA 3ZE7A 2A4MA 3E3MA 1C4XA 5A9RA 2PWPA 5C31A 2XSZD 1FFXA 2BC9A 3RUBL 3WBZA 3KOZA 2ANCA 3HKCA 3G86A 4IAOA 4YP0A 2ZYRA 4A2WA 3PTZA 4AX4A 2X6QA 4CFZA 3JQGA 3VHXA 4UVHA 5L9NA 2FW0A 1YJ5A 4J7CA 4ZO4A 2I4RA 5JATA 1SIOA 5BR8F 4IDFA 1TQLA 3OQHA 4QIEA 3ND8A 3QQ5A 3ENZA 5BWNA 1SD5A 2YBDA 3JQ9A 2QMWA 3AF2A 3TKAA 3MWKA 3CDWA 2QZSA 1WSVA 2OYCA 4D4LA 2HF9A 3ER9A 5C1BA 4NZ9A 4W82A 1PL6A 2CJAA 4DWOA 4HDKB 1P91A 3WFJA 5K0SA 4D99A 1JFTA 4AN1A 3W66A 5EKXA 3U49A 5LQUA 5B3JA 2R2AA 3GRKA 2PKQP 1KYVA 3RU0A 1GCUA 1DJNA 4C7XA 5DIZA 2H9IA 3ER6A 2XZOA 2YOHA 1N7IA 3QPBA 2YUTA 4TN2A 3SZMA 5CYGA 4LF7J 2VHWA 4HL9A