4ATNA

Crystal structure of c2498 2'-o-ribose methyltransferase rlmm from escherichia coli
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
357
structure length
356
Chain Sequence
MNKVVLLCRPGFEKECAAEITDKAGQREIFGFARVKENAGYVIYECYQPDDGDKLIRELPFSSLIFARQWFVVGELLQHLPPEDRITPIVGMLQGVVEKGGELRVEVADTNESKELLKFCRKFTVPLRAALRDAGVLANYETPKRPVVHVFFIAPGCYTGYSYSNNNSPFYMGIPRLKFPADAPSRSTLKLEEAFHVFIPADEWDERLANGMWAVDLGACPGGWTYQLVKRNMWVYSVDNGPMAQSLMDTGQVTWLREDGFKFRPTRSNISWMVCDMVEKPAKVAALMAQWLVNGWCRETIFNLKLPMKKRYEEVSHNLAYIQAQLDEHGINAQIQARQLYHDREEVTVHVRRIWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBOSOMAL RNA LARGE SUBUNIT METHYLTRANSFERASE M
publication title Crystal Structure of Rlmm, the 2'O-Ribose Methyltransferase for C2498 of Escherichia Coli 23S Rrna.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 117
structure length 356
sequence length 357
ec nomenclature ec 2.1.1.186: 23S rRNA (cytidine(2498)-2'-O)-methyltransferase.
pdb deposition date 2012-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01728 FtsJ FtsJ-like methyltransferase
A PF18125 RlmM_FDX RlmM ferredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2810 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4atnA01
3.30.2300.20 Alpha Beta 2-Layer Sandwich THUMP fold THUMP fold 4atnA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4atnA03
2G71A 2DPMA 3EVZA 3G7UA 3FTEA 2OPBA 4CKEA 5E1DA 4KWCA 4RV9A 3AXTA 1KPHA 2PY6A 3LBFA 2IH2A 3AXSA 5CVUA 1D2GA 4E2XA 3EGIA 1L3CA 3KHKA 1RI1A 2G72A 3RW9A 1MHTA 4OQEA 5EHIA 5T64A 5FA8A 5K01A 1JG3A 3KR1A 3DH0A 1KXZA 3Q87B 5GIPE 4PYNA 1WS6A 3BWBA 4FT2A 3CBGA 4GUAA 3NVKI 4XUEA 3FPGA 2K4MA 1RI3A 2EJTA 3ER9A 4XUDA 5EG5A 1RI2A 2ZZMA 2CMGA 2AR0A 2FYTA 3HCDA 5K05A 2ZZNA 1XCJA 1R8XA 3GGDA 3HEMA 5K0JA 3EGEA 3EVEA 5DXAA 4PNEA 5LQRA 3OU2A 5LQUA 1X19A 5EOVA 4HH4A 1ZHFA 3CCFA 2AOVA 5FULA 5HIMA 2F8LA 3TFWA 3EVCA 4FR0A 1VP9A 4KVZA 2NYUA 3UJAA 3M6WA 3G8BA 2YQZA 4EKIA 4RTSA 5F2NA 1R18A 2IPXA 2AOUB 3EVGA 3NW9A 1M0EA 1BC5A 2YR0A 3O31A 5D1HA 3UA4A 4YMGA 4YUXA 3TOSA 5HIKA 2NP7A 3NVMB 2CKDA 5K0BA 1VLMA 4ER0A 5CD1A 1VL5A 3NDJA 4O29A 1QAOA 3NDIA 4HG2A 4E70A 3BWMA 3DMGA 4QPPA 4Y2HA 3T7RA 5E9QA 5DX1A 3P2IA 1X1DA 4BP1A 3OPNA 2B9EA 3UZUA 3ER8A 3KQQA 1XDSA 4AUKA 2FK8A 4PCAA 3DOUA 3KR9A 3B5IA 3MCZA 4GEKA 4PIPA 2YXEA 2VDVE 3HCEA 1ZGAA 4LWOA 2AN5A 1Y8CA 2ADMA 2FHPA 3HCBA 3HNRA 3HCFA 4RTMA 2FPOA 3HVJA 3O7WA 3PX2A 1L3IA 3SSOA 2LD4A 5DSXA 4P58A 2PX2A 2Y1WA 4ISCA 4U7TB 5FTWA 1N7JA 3G2PA 4MHTA 3FPEA 5HIJA 2Q41A 1T43A 3FUVA 2JHAA 3C6KA 5FHRA 1RI4A 2WA1A 4RTNA 3DULA 2AOUA 2AVNA 2ZBPA 2P1DA 1FPQA 4M7RA 3KR0A 2UYQA 3I5UA 4FT4A 1YB2A 3P2KA 3ELDA 2AZTA 3A7DA 4RYLA 1BKYA 3DUWA 1QAQA 3Q7EA 4PGGA 4X61A 4CTJA 2ZBRA 2PJDA 3B3JA 1JR4A 4GF5A 5DXJA 5C9ZA 5DM4A 5EMMA 1NE2A 3ORHA 2HWKA 2IH5A 3P9KA 4PYKA 3B3FA 4ER6A 1AQJA 5DT2A 4K6MA 1DCTA 3NMUF 4RVFA 3KQMA 1Z3CA 3MQ2A 2ZIEA 5FUBA 5KQSA 1IM8A 4EMSA 1TW3A 3MAGA 3VYWA 3FTCA 3FZGA 4C04A 4RTRA 2G8NA 2ZVJA 1SQFA 4PINA 3SSNA 1O9GA 3UJDA 3KR2A 2QE6A 5E9WA 3ELYA 4FSDA 4ER3A 3SX0A 5GP1A 2OBFA 5K09A 2PWYA 1NW8A 1R00A 1KPIA 2PBFA 2IH4A 2OZVA 3DXXA 4Y30A 4A6EA 3NJRA 5K0CA 3FRIA 2PXXA 4PIMA 1HMYA 3IYLW 3OZTA 2Z6AA 4RX1A 1D2CA 3GDHA 5G02A 1G38A 1DL5A 1JTEA 3BZBA 4ER5A 3VSEA 4RWZA 3GRVA 1F3LA 4KDRA 3KQOA 3HTXA 3P97A 5DM1A 4EK9A 1R6AA 2HTEA 3OU6A 3SGLA 3CJRA 3M4XA 4BLVA 3BXOA 1H1DA 3PT9A 3QOXA 3TPZA 3LL7A 4GC5A 5KS2A 4QQKA 1VP3A 3LDGA 5JR3A 4RVDA 4UOEA 3KPJA 2NP6A 4X41A 5DX8A 2CL5A 3GRRA 1KPGA 3AWIA 3FPFA 4QQNA 2AS0A 5E8RA 1M6YA 3A4TA 3G8AA 3KQYA 3P9CA 3PFHA 4PCLA 4CKBA 2VS1A 3TKYA 2IFTA 1YF3A 3PFGA 1ZQ9A 1M6EX 2PX8A 3KPWA 4HC4A 5BW4A 2YXDA 3CC8A 3MHTA 1X1BA 2IDKA 5LQKA 5D1NA 2VP3A 2IBTA 1BHJA 4IKPA 1KP9A 1ZKDA 5E2AA 5DTMA 3SM3A 3TM4A 1AV6A 3OZSA 5ICGA 3C3YA 3EGVA 4P7FA 4FP9A 2OY0A 3LKZA 5EIWA 5B1SA 2QRVB 2ZIGA 5EEGA 4GBED 3HCCA 1AF7A 2VDWA 3CJTA 1SUSA 2ZFUA 4GC9A 3UJBA 4E2WA 1NV9A 1L1EA 3R0QA 3UJ8A 5EMLA 1OR8A 2HV9A 4DQ0A 1AQIA 4MWZA 5EC8A 2AOXA 4PYQA 2Z6QA 2OB1A 1QYRA 1NW7A 5LQCA 2P40A 3EVFA 2EFJA 3GWZA 3I58A 3IEIA 5M5BA 5E8JA 4DA4A 2YUIA 4M37A 2FCAA 3OE4A 5EVJA 3UJ9A 5KYGA 4RTJA 3MTIA 4GOMD 3GRUA 3M33A 3LGAA 2QM3A 1JQ3A 3G88A 3NWBA 1UWVA 4LWPA 4BLWA 3KU1A 2O07A 3OZRA 5HEKA 3FTFA 3RIEA 2JHCA 1G8AA 2P7IA 5EPEA 2PT9A 4CKCA 2ZWAA 2PGXA 3LSTA 3UWPA 5U4XA 5BXYA 2O06A 3BGDA 3KQTA 3PVCA 4YMHA 4KW7A 3DR5A 1G8SA 5HFJA 3LCUA 3M6UA 1P1CA 2YXLA 2WA2A 3OU7A 5EQJB 2B25A 1FJXA 1KYWA 3PS9A 3TR6A 2G1PA 4ER7A 2YVLA 4OBXA 1Q0TA 4DMGA 1U2ZA 1RJDA 3T7TA 4H0NA 1NKVA 3F4KA 5ICEA 1ZG3A 2QRVA 3K0BA 3V97A 1VBFA 3ELUA 2AOWA 4QDJA 4R6WA 2N47A 4QPNA 5FA5A 3SXJA 4F84A 1KR5A 5ICFA 5E9JA 1O9HA 4CXMA 4Z2YA 5FHQA 1JQDA 1L9KA 4QVKA 3A7EA 4R8RA 2JH9A 1QAMA 5K0GA 3I9FA 3LHDA 4PONA 3B3GA 5DTQA 2AN4A 2JH8A 2P7HA 5FWDA 1JG2A 4E33A 1XDZA 5CVJA 4IV8A 4EKGA 5LR6A 2Z6UA 2ZIFA 5H02A 2BR5A 3EVAA 2A14A 1WXWA 1MJFA 3CJQA 4HTFB 5GIOE 2OO3A 2C7PA 3EEYA 3OCJA 4RTLA 2HMYB 2P41A 3LBYA 3BWYA 3SVZA 4GOOD 2YX1A 2E5WA 3VC2A 2OYRA 2BM9A 2OXTA 1VE3A 3RODA 3DLIA 5CM2Z 2PWPA 5HOQA 1QANA 2BR4A 1BOOA 2CWWA 2OB2A 5DPMA 3GU3A 3G2MA 5FADA 4E32A 5MHTA 3FUWA 3BGIA 4E31A 3JWGA 3BT7A 2PSSA 4X63A 1SKMA 4YUYA 4KDCA 3IV6A 5K0FA 3GRZA 1KIAA 3M6XA 3P9NA 4EQZA 5GINE 2O57A 3HA7A 4X60A 2P3QA 3FYCA 4POOA 1IXKA 2BR3A 2PXAA 4IV0A 2I7CA 3TLJA 2GLUA 1ORHA 2IBSA 3GIWA 1KYZA 5IKMA 5CUQA 4PYLA 3U81A 2I6GA 3THRA 2FK7A 1XVAA 2JJQA 3R6TA 4PYIA 5EKUA 4HTFA 2BZGA 3JWIA 4HRAA 1IY9A 4FS8A 5FQNA 3S68A 1XXLA 2HNKA 4P7GA 2H00A 1PJZA 4B17A 3LPMA 3PX3A 4DF3A 2UYCA 2AVDA 3PB3A 3UA3A 1HNNA 4XCXA 5BP7A 2UYHA 2OKCA 1NW5A 3G5LA 2ESRA 2B78A 4GQBA 4YV1A 2V74B 3GRYA 1NW6A 2NXNA 2XYQA 1PRYA 3ME5A 5DSTA 4BP3A 4RTKA 4P7KA 4KIGA 2FRXA 1KHHA 4DM3A 3UFBA 2EX4A 2ZSUA 3OFKA 5HILA 5K03A 1WY7A 2PLWA 3M6VA 1YFJA 3MERA 5T6BA 2NXJA 3E7PA 5DRYA 2G70A 2XVMA 1D2HA 1UIRA 2XVAA 5EZSA 5GWXA 4YV2A 5E1MA 3BWCA 3DXYA 1P91A 2ZULA 5CVDA 1V39A 3GCZA 1INLA 5KQRA 4RVHA 4RSRA 4EVIA 2ONZA 4YV0A 3L8DA 4V0RA 5F2OA 5EZQA 4JXJA 1VQ1A 1EQAA 3FRHA 3LKDA 4FGZA 4M38A 3E8SA 3CGGA 4OX9Y 3P71T 3FUTA 5E1OA 2JG3A 3HVIA 4OQDA 3TKAA 4C07A 2V7EA 4OA8A 1FP2A 3IHTA 4V0QA 3E23A 5DLYA 2IIPA 2PV0A 5FQOA 2ZCJA 1ZGJA 5EGSA 8MHTA 1SVUA 1SQGA 1I4WA 3DMFA 2R6ZA 2EJUA 5C1IA 1EJ6A 3TM5A 2ONYA 3BKXA 3WSTA 5EEHA 5KVAA 3O4FA 2AOTB 4DZRA 3EVBA 3MB5A 5DWQA 4E30A 5P8WA 5K0EA 4LECA 5CVVA 4HGZA 5DRTA 3MTEA 5GM2A 3OE5A 1FBNA 2NNWB 4PGHA 5ERGB 4DKJA 1O54A 2YTZA 4RTQA 1RJEA 3DTNA 2I62A 1F38A 5T67A 3R9XB 3EPPA 1I1NA 2PKWA 1NT2A 4GOLD 4PWYA 5EKXA 5EMKA 5K8VA 2BH2A 3P8ZA 3EVDA 4A6DA 5LQJA 4R8SA 3UBTA 3LX6A 1B42A 1JQEA 2H11A 4M36A 3SMQA 3HA5A 3AY0A 3V8VA 1G60A 2QY6A 2XYRA 4OBWA 5EIFA 5LQNA 2C7RA 2ZW9A 4KIFA 3DXZA 3QOWA 4AX8A 1TPYA 3FUUA 1NBIA 2P3LA 4QTTB 5CCBA 3CKKA 4ATNA 3C6MA 4KRGA 5HZMA 4CWAA 1SG9A 3B89A 2C7OA 1NBHA 3A25A 3G5TA 5K0NA 4C06A 5E1BA 4MTLA 3B7PA 5HIIA 5LSAA 4QTUB 1EAMA 2NXCA 5F2KA 4AZTA 2DULA 3GO4A 1G55A 4E2ZA 3EMBA 2AOTA 3HM2A 2C7QA 3MGGA 3EMDA 1P1BA 5BW5A 3NWEA 3GJYA 2PXCA 3DLCA 5LQAA 5C0OE 4AZWA 3H2BA 1R74A 2GAFA 1EG2A 3FTDA 3LDUA 2ZLBA 4C05A 5IH3A 3FPJA 1P39A 4P7JA 1QZZA 1UFKA 4YUVA 4DCGA 9MHTA 1XJ5A 2O0LA 4MQ4A 4WVLA 3ID6C 5GM1A 1I9GA 4BY9E 1XCLA 2GB4A 4QVGA 1YUBA 1ORIA 5DM2A 3GNLA 4R6XA 4BLUA 3BKWA 3QV2A 4RVGA 4C03A 5CCXA 3PTAA 3UJ6A 2GS9A 2R3SA 2P3OA 5DX0A 1X1AA 3KKZA 1YZ3A 4CTKA 2NXEA 4ZTBA 5FCDA 4PYJA 2UYOA 2ZBQA 3G89A 3P9IA 4FZVA 4IWNA 3DP7A 5CVEA 3R24A 3ELWA 1JTFA 3KQWA 1JSZA 3T0IA 3C3PA 3G2OA 4HGYA 3EEOA 1JG4A 1XDUA 3HVKA 2B3TA 1JSXA 3MCTA 4RTPA 3HP7A 3UJCA 4YUZA 3K6RA 4FSXA 3LDFA 4L7VA 1FP1D 2XBMA 2VDUE 3C0KA 3CVOA 3M70A 3GXOA 3NTVA 3FUXA 3KQSA 2BM8A 2KW5A 2IDJA 4G56A 3VC1A 1X1CA 4YUWA 3AJDA 4E2YA 2GA9A 2AN3A 2P35A 4WXHA 3ANXA 1SUIA 5CIYA 4PYMA 3KPYA 2HR1A 1Q0SA 5E2BA 3T7SA 4X1OA 4OA5A 10MHA 3HCAA 3KQVA 3SR4A 2GPYA 3FPHA 3BGVA 3PLAE 3HA3A 2VZ9A 3ERCA 3I64A 3A27A 1EIZA 4F85A 4F86A 1R8YA 3LCVB 2CMHA 5FWAA 5GOZA 3JWHA 2H1RA 1WZNA 1YFLA 7MHTA 1JG1A 1TW2A 1VIDA 2EG5A 2UZ4A 3REOA 2XYVA 4NECA 3TMAA 1RI5A 2PX4A 1N7IA 2GH1A 2QYOA 3G2QA 3KPVA 5DM0A 3E05A 2O05A 3OFJA 5ICCA 4C4AA 2PX5A 1G6Q1 4U7PB 1L3BA 1YZHA 1XTPA 3TRKA 3P2EA 3TQSA 5JUWA 5K0LA 2JHPA 2WK1A 4HSGA 3LECA 3BUSA 1DUSA 2PT6A 2P8JA 4LG1A 3LCCA 4MIKA 4RTOA 2B2CA 1NV8A 3A26A 2PVCA 3THSA 3UJ7A 1RJFA 3D2LA 4R05A 4DCMA 1NW3A 2ZTHA 3R3HA 5EHGA 5EMJA 1VPTA 2IP2A 3HVHA 4AZVA 4C08A 1WXXA 1RJGA 2Y1XA 3FYDA 3JWJA 4GOND 4QDKA 3KQPA 3I53A 3SSMA 2I9KA 1N2XA 4XUCA 4AZSA 3X0DA 1EJ0A 1WG8A 2ZZKA 4PYOA 5DTRA 2ERCA 3KPUA 2ZWVA 3DMHA 2IGTA 2ORED
chains in the Genus database with same CATH superfamily
4GI1A 4M5KA 5ETVA 1JILA 1GYQA 4LTDA 1L3CA 4IWXA 5BNIA 1YJTA 3BPSP 5KFMA 2JK1A 4U2BA 4DQQA 1V3TA 5FDLB 4HNVA 2LA4A 4V1CB 1EE1A 3TQ1A 2P9EA 3WXMA 1SWVA 4D82A 4I6GA 3M8ZA 3ESQA 1FFXB 1DAIA 1U7DA 4G4JA 1RWMA 1PUXA 1ZICA 1XJWA 4YPFA 2CQIA 1C3OB 2RJOA 3O7WA 1P8JA 4LJ4A 4YAIA 3T99A 3PV8A 2L9DA 4L27A 4HNHA 2ZB7A 4KIUA 2KVIA 3LLCA 1ZK3A 4M1KA 1NC1A 4F6RA 2G9OA 3CW2C 4MARA 4LDQA 5JTTA 2V7PA 2OLJA 2FW6A 1JR4A 5EN4A 1FNNA 1RZ3A 4C3KA 1NE2A 4HZGA 1DURA 1RQGA 4CQJA 3WGZA 3L3BA 3FNBA 2X6TA 4B73A 4ANCA 4MHSA 1XXHA 3N3BC 5BN3B 4HGNA 2C1EB 4JB0A 4UEJA 4JV5B 4MI6A 4MWGA 3UXHA 2UXDF 5HVFA 4G0YA 5C4MA 4RX1A 2PVSA 4DV7J 3SKVA 3ADCA 4G85A 1FRMA 3BRWD 1XA3A 4HVZA 1TTPB 4JYBA 4DKXA 3JQDA 1K6JA 3R0ZA 2JB9A 1RHQA 4LHYA 3WQBA 4LF5B 3IXMA 4JWTA 1KP9A 5I4CA 1O08A 1UDWA 5LQMA 4MUFA 1U7PA 2P1RA 2BEWA 3AESA 3IR7A 1OLSB 1YJQA 2ARKA 3JV7A 1ZZEA 3W2VB 2HHCA 3DVLA 1HBMA 1M67A 1W52X 4JV2A 3LBAA 5CBKA 2HK2A 3G88A 3VR4H 1QG2A 2ALZA 2C4KA 4CM9D 2H8GA 2FN8A 4OK3A 3VISA 3M2UB 1BY9A 3UNGC 4MGKR 1DAMA 3D4PA 5EJ8A 1XNQJ 5AW5A 4RU1A 4QDJA 3U4QA 3VAFA 1VMEA 4MJLA 2WFMA 3REFA 4Z4EA 4S12A 5AKJA 3DF9A 5THQA 3F9RA 1ZVMA 3ICPA 3OCCA 1UKVY 2J0WA 3QZUA 2OXTA 1I3MA 5ADZA 3IL2A 3SEAA 3GFVA 3X1ZA 3FEZA 1BXRA 4NHOA 1JIQA 2HG4A 3G2MA 1QK5A 1B00A 3FUWA 1H42A 1BEEA 1G8FA 4EQZA 3WK7A 3GYBA 4C78A 3M8QA 5DLQC 2BFAA 3VZCA 5HKOA 3R5BA 3EY9A 4G9EA 5D3ZA 4XPIA 2NU6B 3GT7A 3D4IA 1YQHA 4YRRA 1VQ4S 3OQNA 3G82A 4HYYA 4B17A 1WVMA 1LFAA 1N5YB 3I5BA 3IKJA 3MM8B 4YK7A 4RXMA 3CT9A 4OYYA 5CG1A 1IL0A 4PFJA 5CT6A 1YVFA 2WSSD 2JEOA 3DLJA 2J6TA 3VVCA 3TLYA 5BR8J 4AK9A 3G23A 3RTBA 2CLCX 3RLFA 4MR9B 4TYWA 3T54A 4KXMA 4FFRA 5BMOA 3GJSA 3MMXA 2OHOA 1KYQA 1GXSB 1PGJA 3W05A 3TK1A 4HH1A 1NBOA 3RTAA 3GI1A 2HPHA 4Q9LA 3B1FA 1MEJA 1I2AA 5BUCA 4I68A 3ZV4A 4Q1EA 4EAQA 2XMDA 2ES4A 4NEZA 1U0HB 5EMKA 2RKBA 4R8SA 5BR4A 4RXUA 4GL2A 3EZLA 3T5TA 3E27A 5J2MA 3OVSA 3JSXA 2Z8QA 3W3AA 4FE3A 1LFWA 4PG4A 1U6IA 2DFKB 1RAHA 1V37A 1SVMA 3DLCA 5LQAA 1HHTP 3C16B 3A8IA 4OFXA 1Y5LA 1UC8A 1UXIA 2FG7C 1E79D 4IIDA 1XCLA 4TZ0A 4G1VA 1SXJC 4RVGA 4K4YA 1E2MA 2KTQA 4WE1B 3SYMA 2H1IA 2XJ4A 2OZLA 1NYLA 4IFVB 4KX5A 2ADFA 2D0DA 3I3SR 4ZTBA 3UUGA 1ZHOA 3R24A 1V95A 3WNVA 2HBYB 3U7QB 2J7UA 4G9GA 5HQJA 4OX9F 2E4UA 5FUYA 5AKYA 5KYWB 1BWSA 3VGJA 1KVSA 4PWWA 2DO4A 2GYVA 1Q7BA 3ONFA 1YJ9S 4RD2A 1H72C 5ELLA 2WOOA 4EO6A 3L0DA 3NAQA 4L73A 4L22A 4DZDA 3EXG1 1MROA 3KOYA 1X39A 4ETIA 4G36A 3TIGA 3WK8A 1E64A 1E6WA 3KQNA 4MAKA 3IB3A 1F51E 4ID3A 3CX7A 3WLSA 2KYRA 4A2WA 5CB4B 3CH5A 4K9LA 2PPLA 2P5TB 1IKWB 5DV9A 4W4MA 1N5SA 3SLRA 5DGTA 4L0QA 3WJ7A 3G7UA 2C2OB 2OQ2A 2X3GA 4WCFC 2I03A 2GUWA 5AT1A 3TJMA 1U9JA 4HO1X 2W6MA 4RQBA 5F0WA 5MLCV 2VDPB 4G5HA 4ZI3A 4K2JA 3C15B 2ZZNA 3KJIA 3FRYA 3OZDA 4I7EA 4N9WA 3UJAA 3U4MA 2NLWA 2FSVA 3ETMA 3PHJA 1KO4A 4EJMA 5KYVA 2I8CA 5KFPA 5EQFA 5D3GB 1JLLB 4QBTA 2I1WA 3OEHA 4K81B 4M8LA 3SVTA 1URRA 1KQ3A 2Y2VA 1NPKA 1YUNA 1Y1SA 5FTJA 1VIVA 1GCAA 2ZKLA 5K20A 5INTA 1JQJC 1FHTA 1DX9A 4D4HA 2YYYA 5LNK6 3FOBA 1ATZA 1CIVA 4LF4B 2X0EA 2P0EA 3IR5B 5EIEA 3TWZA 4CLKA 4LNAA 3STUA 4PC1A 1WSAA 4RO0A 3P6YC 3FBEA 2JI6A 3WBKA 3NMUF 1I6LA 2AGQA 1C4OA 4BB5A 2WD7A 3INGA 2NXUA 2ZVJA 1QVGR 2XUQA 4XVQA 3UJDA 4BMSA 2YFYA 1WKBA 3I4CA 4ER3A 4QR1A 1SZCA 3A9RA 3BMOA 4O2BF 4JV5J 2C2NA 4OM8A 3ZI7A 1Y4SA 2JFXA 4DQXA 2Q4TA 1YXMA 2WUDA 3H9QA 2ABWA 3L82B 3G3EA 3LZCA 3V6KA 2I6XA 3QY9A 5EJ4A 1JR3A 4DBQA 3FLBA 3MRVA 1TQ2A 1KFEB 1V71A 3U7HB 1F17A 1NF9A 2DHEA 3R6GA 3MUFA 2AX3A 4H3VA 4IXTA 5BSMA 5L3QA 1MC4A 4I1SA 3JALB 4ESEA 2E5JA 4TL7A 4K40A 1KWGA 3WTCA 1TKZA 4B34A 3HYRA 1VE9A 3RVNA 1YK0A 1LLUA 1J1IA 3QX9A 3ONDA 3FCSB 2YH1A 2R6DA 3RYCA 2FGJA 5HFJA 3V7WA 2CEKA 2WA2A 2OKGA 1XT6A 1Q0TA 3LW8A 1ZAWA 4PXAA 1KFBB 1X5SA 5KU1A 5KNCD 4Z2YA 4WY8A 1OROA 4MK9A 5K0GA 4HUJA 5CX4A 3GLUA 2VH1A 4WU3A 2O3SA 1I4LD 2YWDA 3Q7QA 3A9WA 2BFBA 3M82A 4Q0MA 5K8UA 3ENVA 4G1PA 5L9NA 2VVTA 1X7VA 2MSNA 1ISPA 1USIA 4O2LA 2MWMA 5EVCA 4ZA1A 2L41A 2R6FA 4QWCA 1ECPA 4NEHB 3GRZA 4YOEA 1KIAA 4Z51A 1V5IB 1G6HA 3DOHA 4F4XA 1YKFA 4E8UA 4USUA 4LMBA 1C4WA 4A48A 4I1PA 4RL1A 4KYIB 1NPYA 2E7WA 3PQFA 4LWZA 2XXJA 2JNWA 4D6XA 1ESEA 4CJXA 4BXOA 1UKAA 3J7ZT 1CG6A 1MOZA 2GN4A 4D9JA 1H4SA 2Y0BA 4P92A 4LJ5A 1VCIA 1PR4A 1BMQA 1WY7A 1P4RA 4G1QB 3PD7A 4Q9AA 4RW4B 4GOKA 3O91A 4FZ5A 1ENPA 3ZJ4A 4CMCA 3TDMA 3CQ9A 1FA9A 4R1QA 5FQOA 3NL0A 1GKYA 3GZ4A 4FOLA 1I0ZA 1I6MA 4NASA 2HJ9A 1N5MA 3F8WA 3W9SA 3PITA 3R6LB 1RABB 1WW8A 3IWLA 1KXJA 1K5DA 3CW8X 1ZD3A 1GT8A 2QMOA 1RLJA 4AJKA 1AQNA 3BK7A 2J09A 1G1MA 4MUGA 5B1DA 4A8TA 3NHAA 4M1SA 3RKUA 3SS9X 2EKZA 3EBLA 5KFSA 2JPDA 4XR4A 1SVKA 4JUDX 3W63A 3ZV3A 3KETA 3BIWA 3SHOA 1G2EA 4OXXA 3A58B 4QVGA 3J7A1 3O9ZA 4ND4A 4DMRA 3E15A 4J37A 1BD3A 2J9RA 5EWLB 2F1JA 1T7PA 4GDFA 4QASA 3CZ4A 3DP7A 3ELWA 3D8RA 2R25B 4DSTA 2OK8A 4F5DA 3O84A 5L40A 2YXBA 2IVMA 1RGVA 4GPD1 1ULUA 3Q6MA 3RRYA 3VV2A 1AT1A 1QHGA 2B1RA 1FP6A 5KCZA 2YHIA 2R96A 3K8OE 4WXMA 4Q16A 3KT3A 1I3LA 4WJKB 3OMXA 4EMDA 1LDGA 4XPEA 2EEPA 2IX3A 4NLOA 2C2DA 2O6HA 4IH6A 2DCUA 3Q2IA 1EWVA 5FWNA 2HQSA 2GHTA 2FWIA 3K0CA 5FUMA 1MJ5A 2EVWX 1YB5A 3ICWA 5KT7A 1IKYA 1WWHA 1M1KT 1T36B 3NXKA 4BS9A 2FU5C 4CM7A 3GT4A 1PNQA 5HVHA 5D84A 1FMFA 5K8IA 3W2IA 1MENA 3E22A 1VGVA 4ARIA 5I3QA 2FGKA 3RSZA 2AJ4A 2SHKA 2KFYA 1ZHFA 1XMOF 1EJBA 1KMHA 5F2NA 2AOUB 2JSXA 2XD9A 3K9LA 1XQ1A 2I29A 4DLVA 2AW0A 1DDOA 1QGZA 2VEOA 3O8WA 2RKOA 1N7JA 3K5OA 3W5JA 5D51S 4LF4J 2IPAB 2PMFA 5C80A 4O4IB 2AZTA 4RENA 2C2EA 5HE8A 2BGMA 1G6KA 2HSDA 4NS4A 2LGJA 3GPLA 1HETA 3V6MA 3U9TA 1ZVKA 2IYWA 4X8LA 4M55A 2HSWA 4ZP6A 2VCYA 3HADA 1N6HA 5KTTA 1B41A 5A05A 2DTJA 4DREA 5EIHA 4DQUA 3BXPA 2G4BA 3RUHA 3LPAA 1CJTB 4N3GA 1OTHA 5WRFA 4FS2A 3I31A 1D9AA 1DOHA 5AI6A 4UHEA 2Y1JA 3FK4A 4ES6A 1DBWA 3BH7B 2Z56A 4OCZA 5D1NA 4MPJA 2I1RA 4ZDKA 1XTTA 4I64A 4C5CA 3EGVA 4ND5A 1QGED 3ZZ0A 2X0JA 2IHJA 3K5MA 3ESRA 4W9NC 1TIBA 4J9LA 2BFDA 3GRUA 3JQEA 3NAIA 3OQIB 1MIOB 4EDHA 1C1YA 2W6JD 2VPTA 4NPHA 2D8MA 5T8KA 1UH5A 1XI2A 4QHSA 4Z86A 2FDNA 3A9CA 1E8MA 5EJFA 4QTYA 2OTJS 3V97A 4JBNA 4PAQA 2YNIA 4XQ0A 5HA5A 4UNSA 4LF7F 4MB6A 3MJEA 1ZESA 1M6VB 4FR5A 2D4HA 3SZ3A 3KXKA 1RZUA 1GK8A 4GYJA 1NO8A 2OPQB 4IINA 1T8RA 3DBRB 1U0OC 5SZKB 3T7JA 1G18A 5TV2A 2DTDA 2HDHA 3KKQA 2J6SA 5E0OA 1U2SA 3KLMX 4CIOA 4X63A 5C5CA 4L6AA 1E1RD 3QEBZ 1T8SA 3FYCA 3R7WB 4D41A 1TZJA 4KO3S 3EPIA 1VKJA 1W1UA 1PWHA 4I50B 2M1ZA 1GL9B 4XYBA 1AK2A 4QU5A 3U81A 1ITZA 3FZQA 4I6YA 3ICCA 1LI7A 4J0JA 4OBBA 4CI0B 3LSYA 2ACWA 1M1GA 3G2KA 1MO4A 3UFBA 2YOGA 2QBYA 4FMDB 2G6BA 2Z5FA 2ZRNA 1UFLA 4JR0A 4OGKA 1ZM2A 5KQRA 1FRFS 2F4FA 4PPNA 3WMEA 4V0RA 2A6MA 1IWPB 1I33A 1CT9A 1RP1A 4AN4A 5CDFA 1V7ZA 1OH5A 1T3GA 4YR0A 4NCNA 1PJSA 1N2GA 5EEHA 1FW6A 2GXQA 5CX1B 1OBVA 2FMTA 4PQGA 4RIFA 2G1UA 3PNYA 2BE7D 5AI9A 1LQ2A 4AX8A 3C8MA 4AN0A 1ZH8A 2VNIA 1QG4A 1M2VA 2XNHA 1AXGA 3HYNA 5B0FA 4LX0A 4QEKA 3HUDA 1C14A 1MAVA 1VI5A 2HXSA 1Z0DA 4NC9A 5DG9A 1F2UA 5CYJA 4U6SA 4YT5A 4P7JA 4JCOA 1E92A 3COYA 2PE5A 2E0IA 2GWHA 2WIFA 4QYTA 4BN5A 2XE6A 1C1BA 3SZ2A 1XBWA 1TCAA 2H2FA 1ICIA 4E3ZA 3O5TB 4LTNA 4ZQEA 2M2BA 2W6ID 3PGJA 4HAZA 2WWVD 2UUPA 3TG2A 5BRJA 2C4MA 2QX7A 5J47A 1HT3A 3KVYA 4B6RA 4O08A 2QLNA 4L2IB 4U00A 3C5HA 2G7ZA 3DL7A 1SZJG 3ANNA 1WB4A 1P18A 1WZEA 5KT4A 5HKLA 5KFYA 2R7SA 4Q3OA 1KYXA 2VF3A 1G1XA 1DAKA 2GH1A 4XARA 1DC4A 3TRKA 1NJIT 2YWXA 3VR3A 4H7FA 1YZTA 3Q86A 2A9FA 2N1MA 2PMKA 4D99A 1B76A 3QMVA 1FYWA 1CVLA 3O9MA 2IPOA 4QXMA 3FEYB 2ZWVA 4JI8B 4RBUA 1V6HA 1WVIA 1LEOA 2JZCA 2D1YA 8ABPA 3ULKA 1FVFA 1N6IA 3KAJA 1BWVA 5FBZA 2GVNA 3MEEB 5GONA 4XUDA 2I78A 1PGZA 5A2GA 5IH7A 5EERA 3DCAA 1UP6A 1X19A 4DN9A 4UREA 2FEPA 1KZ7B 4TTVA 2Z04A 4WJBA 5GZ1A 5DE3A 2IIQA 2YZ7A 4DJDC 2HHHF 3KG2A 3IDOA 3C14C 2CXNA 4GKAA 3E01A 1FYFA 3DL0A 1RPAA 5CZXA 3OMWA 4ED0A 4YRDA 1D1QA 4JT9A 2SNIE 1OV4A 1N6RA 1AV7A 3UMFA 2VJQA 5G0TA 1LQUA 1YDEA 1CZLA 4NRDA 1S8OA 1RP7A 3AC0A 2JVIA 2IQ5A 1BQ3A 4TLLB 2Z9BA 5C8YA 2G4VA 3BCHA 3ES9A 5IJXA 1JKJA 1R27B 4K6MA 5IJZA 3FMVA 4N5LA 1Y4AE 3T35A 3PU6A 4DUPA 1QG0A 5A8RB 2GJIA 3GZNB 2OMEA 4BN0A 1IBMB 4QR0A 4IVNA 2W2PP 3D1HA 1JLCB 2H0QA 2NVOA 2JEJA 5HF8A 3CUSA 3F9IA 4O25A 3DDUA 3P4YA 3DG9A 3PUVA 3QLVA 2N3OA 4FK8A 3RFUA 1G5TA 4KX3A 2YH2A 4N8EA 4DV6F 3AKEA 1XZJA 3CMMA 4MVWA 4RJJA 3GRFA 2EG2A 2IDKA 1W48A 5JCJA 1H0RA 1LJLA 1F1BB 1XNJA 4QBFA 3FOAA 1O1YA 1EBFA 2EGUA 3DNFA 5HUQA 3KUUA 1ZU4A 3SR0A 1E32A 3HSZA 3FROA 4F3RA 1DTQA 5A7GA 3GPBA 3QSYB 1IZ7A 2VIHA 4HLUC 4MMZB 4HSEA 1UEKA 2ZWAA 1LW2B 3NFYA 1U8CB 3RNOA 1MNAA 3ILVA 1YBFA 2C3UA 4IHAA 1X86B 5FAKA 3A8TA 3BIJA 4ZN3A 5J2QB 1ONPA 2BMEA 2BDEA 3IE0A 1YJ8A 3OX1A 2IODA 3CUTA 2GDZA 2AN4A 4MA0A 1IRXA 1KP3A 3T1VA 5D85A 1DZIA 3PCOB 2CXOA 1Z2PX 4LX8A 2LEAA 2DBVO 1U8EA 4OVKA 5ESDA 3RTEA 3OOWA 2A9OA 4DA8A 1OILA 4JLPA 3PDNA 4O02B 5I7FA 1QM5A 2ZITA 1FB5A 1C2TA 3S1AB 4YACA 2LKZA 4CQMA 4LAFA 4I2QA 5C4IA 3AEYA 4K28A 4OLBA 4HFNA 2Y1RI 4BFXA 3HN2A 1UJ5A 4RJTA 1T4DA 4ENQA 1MO2A 1VQ5S 5SYMA 2WUWE 2DIRA 4LR7A 1GGVA 3QBEA 2VTEA 4JXJA 2D0PB 2A2DA 3PPXA 4Z7CA 2GMWA 3GD7A 4EPTA 4FNGA 2QZ9A 5ALUA 1NNDA 1UBRS 4N49A 4S0MA 3X1KA 3UQSA 1PJAA 3T52A 1NK6A 2ORVA 2JLUA 1TIPA 3WYCA 4ASUD 2JRLA 2QSYA 2YUTA 2ZPAA 2YZNA 4I69A 3P8BB 1JHDA 1C3XA 3CCUS 1N5DA 2XRMA 1XOIA 4L16A 3A8JA 2QYCA 4G63A 3NHKA 2IHTA 2QVCA 2I54A 4J5OA 2AQ4A 3DFEA 3NTLA 5LSAA 1Q20A 1S2MA 1XN4A 1L5WA 2AMCB 3EMDA 3RVMA 4KJIA 5FL7D 1EWKA 4PO1A 1P7CA 5KMGA 4HNRA 1YBMA 3LL4A 2WHXA 1L1RA 3QVOA 2Z8ZA 2ZRGA 1J00A 3W6PA 3TF5A 4D46A 1M1HA 4FX5A 4ZAYA 5F7XA 1QFSA 1JE1A 1C1HA 3PTAA 3CF5Q 1CUJA 4DBLE 4LZLA 4FOOA 3IXLA 4YP0A 5KOHB 2FPXA 5LMNB 2Q3BA 4CM8A 2C9MA 4IH1A 3JQBA 1R8HA 1R6BX 2W7TA 2J0QA 4BP8A 4RPKA 3KQSA 4TU8A 4TTIA 1GPDG 5CIYA 3WB0A 1IPEA 1SOVA 4H7DA 3H9CA 2G3YA 4LC0A 4LMPA 4OJYA 2PKYX 4OQPA 2HSEB 1VDMA 1XO1A 1KBRA 4PKDB 2V5UA 1KERA 3R0XA 3RO7A 5EHGA 2IAJA 1CDEA 1OHHA 2R0QC 1GL3A 4JI8J 3UF0A 3LYHA 4I2PB 3IJ5A 3VR2D 2YKAA 4IF6A 2P68A 3GELA 4EYEA 1V3SA 5FNVB 3DFMA 1PFKA 2V7XA 3HNPA 3TECE 3PQCA 1JDZA 4NCGA 2J3QA 4RWWA 4EFAC 4D02A 4RIEA 5J1EA 4J94A 3IAS6 4L8GA 3OWHA 3PDUA 4A8YA 4JB2A 5JO0A 1HG0A 1U5AA 3E8XA 1NY5A 3ZJ5A 3I5AA 3DOIA 2QZPA 1GRVA 3O8NA 2QAJA 4RNMA 2B9EA 2PE8A 4Y65A 4AUKA 4H31A 4NRTA 3UV3A 1BVHA 5FDLA 3A13A 1B1AA 3UB4A 4V1CA 2CVFA 2DHAA 2C98A 3IP0A 4MDEA 2BACA 1FFXA 3D9BA 3RIYA 3W4KA 2RGXA 3KR0A 1G3MA 4I4TF 5LBTA 4OD0A 1GQRA 4YA6A 5KJEA 1QAQA 2AJFE 3ZTQA 2NX2A 3TEHB 2Y1GA 3G2LA 3PGA1 3OSNA 4GLLA 3NS5A 3KQMA 1Z3CA 2EU8A 3NYWA 3MAGA 9GPBA 3UAZA 1C3OA 5JMPA 4CU5A 3HFKA 2ZSEA 3B2EA 1ROFA 4NLPA 4MIWA 2OHIA 1IBMJ 5C2JB 5FOSA 1AQUA 3EDQB 2GCEA 2OA0A 3N8KA 1Z36A 5AJZA 2YJ6A 2II6A 5E9AA 1EFRD 2HNZB 4O3QA 3TVDA 3ZH9B 1R9MA 5JI2E 1K3TA 5A5GA 4KWEA 3NKLA 4X41A 4EYGA 2QUJA 1FBTA 3N2IA 1OI3A 3WS7A 4NEQA 4Y6QA 3X1MA 2YXDA 3CGIA 2BCEA 5BN3A 3N9UC 1YL5A 3I9MA 3UT6A 1IE3A 1GFZA 4RK1A 3S8SA 2PK3A 4EFMA 3MFQA 2XTZA 2FJBB 2XNCA 3JD1A 3WSWA 4CT0A 2WAAA 1YLXA 3OE4A 3NV9A 4MQFB 5KJCA 4EKYA 1A9RA 4V19J 1BQNB 2CG4A 1FE8A 5EPEA 3F6PA 2QJ3A 3OU7A 4J0KA 3RRNA 5AVVA 1BEUB 4KYTA 4R7ZA 1OLSA 3AZOA 3HJRA 4URXR 3W2VA 5FTLA 1HQUB 1B8NA 1CY8A 1LDNA 1EHCA 4EHHA 1PBAA 4J07A 1OZGA 3WA6A 3SQNA 1G8JA 4JJIA 4D6YA 1YE5A 4CIDA 1HDYA 3MELA 2RT3A 1RYNA 4NV3A 3UY4A 3M2UA 2OAP1 3VC2A 4EHDA 2CXSA 4PZAA 3KZNA 2R48A 2CDNA 3RCBA 1QMGA 4CLYA 5B58T 4UJ5A 3GE9A 2AZMA 2Z30B 4A4DA 1P60A 3SBXA 4BEWA 4TROA 3UB3A 1NU4A 1NK4A 4G81A 1E4VA 1WQ4A 2VBWA 2XEDA 4XDGA 1Y7PA 3HMJG 1AK1A 3TFOA 4Q34A 1L6IA 2I3AA 4JNKA 1MX1A 4TTAA 1T9VA 2NNLD 4WFIA 5SUHA 2ZI9A 3LQFA 3STXA 5D3KA 1P44A 2CCKA 4Q45A 1R37A 4D8UA 2RU3A 1OXMA 4BFVA 2VHZA 2BSQA 3K0SA 2NU6A 3MCVA 2YNMA 1XD8A 5ARBA 1DC3A 5D4LA 1NDPA 8MHTA 3RVQA 3S6JA 1IVZA 2AN1A 5FNZA 3WLAA 1N5YA 3L79A 2OXEA 3MM8A 4U9IS 3ZZNA 2Q43A 3EUWA 3LJKA 3UENA 4QBKA 4M0UA 1CEYA 4IR1A 4QBGB 1GAXA 1VK8A 3A31A 2QMUB 1PNVA 4MR9A 4OJTA 3FMOB 2XYRA 3D7MA 3ZHYA 5EP1A 3NTUA 3EX7B 1GXSA 4ATNA 1VL8A 1P8AA 1YGPA 3QJJA 1DIGA 1P19A 1Y48E 3V4PB 4ID5B 1GUZA 2YYSA 2GJ4A 4WZZA 4RMIA 4YAUA 3T38A 1ACMB 4GYKA 1N8SA 4K5SA 4O4HB 4OZ0A 1NVXQ 2AYXA 4U1RA 1RZVA 3AB2B 4J9OA 2GMHA 1QF6A 1QP7A 5LMNJ 5KIAA 1HNWB 3IOEA 3QFTA 3W5VA 2QJTA 2LQ8A 1L7RA 4USWA 4JEUA 4HX5A 2JD0A 3ZXXA 1YJXA 4GRAA 4WBSA 4R81A 4TLBA 4REQB 4YT4A 1T4BA 4ZVPB 4UOZA 1D6SA 5E2BA 2CJBA 2DH8A 3ZR4B 1RKQA 1VHIA 2CIMA 3ZE0B 4AW9A 4L5CA 2ZJBA 4UZFA 2EK1A 4ZI2A 4WE1A 2JFZA 4J9MA 4IFVA 4C4AA 1E3SA 4Q9KA 2POKA 1P45A 3DVAB 2ATVA 2GI4A 4YJ3F 3U7QA 4NLYA 4WLFA 5EHXA 3OWXA 5KYWA 1UP4A 4UM9B 3ZHCA 5CDTA 4AXIA 2X6QA 2QC3A 3BSOA 4MRRA 2W37A 3L05A 4GLBA 2KXHA 1R0YA 3BYZA 4AY5A 3RFCA 1VQKS 4ZIRB 1W46A 1C50A 4FYWB 2WUGA 4ALNA 2QVXX 3NONA 4H0FA 5JAZA 4MQ6A 4FGSA 2UU9J 3T9BA 5TS2A 1YRHA 3KJXA 3TOXA 3MCUA 5FFNA 5CB4A 3AUUA 2ZAIA 4B4WA 4CCWA 2VT7A 1PUJA 1IKWA 2V45A 1LNSA 5DVZA 2CXUA 4TYMA 2RGNC 1H73A 1F5AA 2C2OA 2EKDA 3FDSA 1KO1A 2C0QA 2ZSIA 2DWOA 4TLCA 3A2KA 4PC2A 3T5DA 1P9QC 4ZMSA 1KHTA 3FJOA 3M34A 2CNWD 3C15A 3HNRA 5ITSA 2B5OA 2QD2A 2FIUA 4MRSA 5EIBC 3JZIA 2VN8A 2UYQA 4YGXB 4MYSA 5D3GA 1JLLA 3MWLA 4ZCIA 5DM4A 2A1IA 1PUIA 2FQYA 2GZ2A 3JQAA 2HGSA 1L1FA 4C7KA 4RPJA 2I66A 3MMPA 2BI4A 1U6KA 2VDNB 4DV5F 3NJRA 3KG1A 1U99A 4BV3A 1S77D 3IR5A 5EHZA 1LW7A 1JH8A 2YCLA 1RC8A 3GPIA 5IVIA 3WKDA 4OYAA 2WHRA 1KKHA 3KQHA 1LVGA 3LQRA 1XTSA 4O4LF 3BEGB 3E51A 1UWBA 2FPKA 5CZVA 3L8YA 3DDIA 5B3AA 3S99A 3KSBC 4X3PA 4FYHA 3DMYA 1SUSA 3LGHA 3IHWA 2KZMA 3WC0A 3OOHA 1DAHA 4ZHSA 5KNDH 1Z7BA 2X1GA 1AFJA 4OQLA 1FYDA 1O0SA 3MWFA 5C7PA 1UKYA 1JYSA 2JH3A 1J7KA 3LAMA 3KHLA 2ZSDA 3CDBA 4N5SA 2YS7A 5K4HA 4IDPA 2ZB8A 3ZO7A 4H6WA 4RBNA 2J48A 4BQQA 3EZNA 2B3DA 1L5MA 2FYXA 1PYTA 3BJYA 3GY0A 3C6YA 4NBWA 3JALA 1PT8A 1VSVA 3CTPA 4RJIA 4IOCQ 4DC0A 3ZWOA 4L5AA 3GPCA 1ZSYA 1FJHA 1JXQA 4FINA 4DG1B 2MQPA 2FE1A 5IK2A 3WNCA 4V0NA 3RS9A 2XQVA 2IV3A 1O94D 3LXRA 2VHGA 1GKKA 4CKZA 1Z7EA 4ZJPA 1THTA 3RTVA 4I1OA 3MHPA 2ABYA 1MT3A 1SC9A 3N6NA 2M0GB 1SVOA 5HKAA 1U3UA 1KO8A 4DS3A 1MQSA 4CVNA 2JATA 4HRAA 4PRLA 5JSQA 5DLPA 3S68A 2Z1MA 1UBOS 2QRMA 4B4VA 4YRTA 1YVUA 3PJFA 5CLJA 1UPFA 1OW3B 2WHEA 5JRJA 3NIWA 2PPVA 3I6IA 1M2NA 4ZYZA 1C7EA 1CQPA 3GJ4A 1CDDA 1V5IA 5CG2A 4YMWA 2FMFA 4EVIA 1DFGA 1BD4A 3BF8A 3UV6A 4NPCA 3HULA 3UC9A 1SC3B 1N25A 2N82B 1FUUA 5F8IA 2B0GA 3AJ1A 3JTEA 3THXB 4ZV9A 3IHTA 5J40A 4BFCA 1ZGJA 1Z8NA 1LDYA 1H4QA 3P3DA 4XEHA 4NONA 3K5NA 1YS7A 3ENWA 3KNAA 2FPHX 3N8HA 2UP1A 5TGDA 1X38A 4FIDA 3UCGA 4F56A 3MMCB 1XK7A 4RW4A 2H11A 1T6ZA 2O5RA 5CFLA 5D0HA 1H9BA 3ISVA 4XB1A 1S4QA 3C3BA 4F96A 3U44B 1NBIA 5BWOA 3WMWA 3J80A 3B89A 4IMRA 5K0NA 4FI3C 2YWCA 3MTQA 3R6LA 1RABA 1LW0B 3O8LA 1UZMA 4K5QA 2R1VB 1A9XB 4ZVUA 2HYIB 4DCGA 1YA4A 2CJQA 2Y77A 4E5SA 3IBCB 2C04A 3ZXYA 1PD1A 2AEJA 2H7YA 5ALQA 4COOA 5AI8A 4WKNA 3CD6S 3O4IA 5JHHB 1CS4C 2VODA 1QZTA 4HB2A 1Y33E 3OY2A 2QTCA 1MB4A 3SBOA 3QPDA 3H4BA 4Y6IA 2WB1D 3SR4A 3OJCA 5CPFA 2CDQA 1KEWA 2H1RA 1DT5A 3I62A 2GJKA 1EP2B 3RQSA 5EWLA 4KLCA 4B3XA 3E05A 1FTQA 1L3BA 3WKBA 2R97A 5HSGA 1HQEB 5A3QA 3L0YA 5B0CA 3JQFA 1FXWF 4G1MB 4I5GA 4RK0A 3DS8A 4URZR 5C5EA 4Y3UA 2WJIA 4QXAA 1P5ZB 1ZUNB 4AG3A 3A2LA 6ABPA 2VA2A 5A4FS 2JCXA 3GSDA 4NDZA 4XGRA 4RWEA 1YR7A 1E7WA 1SL2A 4BTEA 4RH0A 5CNJA 4AG5A 3DH0A 1KXZA 3OQHA 4R0VA 3ZTPA 2IYLD 1E1DA 1Q16B 2QD5A 2OUIA 2W9BB 2IY5B 4O63O 5FOTA 5K05A 2B8PA 4LOLA 4KMMA 1UBSB 3UJNA 4I9NA 5M2RA 1JECA 4FLMA 1N52B 2VC2B 1NFRA 3RVOA 3DLKB 3JYTB 1XZKA 3NDJA 1I6KA 2LECA 4Q4HB 1T36A 2NZXA 3IP1A 1KD1T 2HA4A 1Z35A 4BLTA 2NO0A 3OPNA 2J8ZA 4UTGA 4QLAA 4KVFA 3HXLA 1U8FO 1ZA2B 4U8HA 3WIBA 4E03A 4O3FA 1JLMA 4NU6A 3DBVO 2DXEA 2JGIA 4OGGA 5JNLA 2AOUA 1IXSB 2J4DA 2FW0A 5B55A 4BPRA 4IH9A 1KI6A 2JLVA 4Y1FA 2Q5HA 4GRDA 1E59A 5HKKA 2XE4A 3I28A 3V6HA 2V6MA 3CEAA 4H3SA 2KSQA 4FJ2A 4AQYB 3FFWA 1CJUC 5LZ5A 3Q15C 4O4IA 2VJNA 3MJCA 3UWOA 4L0CA 1R6AA 1M5TA 4DA6A 2GO8A 5A6SB 1LLQA 4ESHA 4PZUA 3GRRA 3T7AA 2ZUUA 3VZPA 4DHEA 1XIQA 2MXYA 1SK8A 3DOOA 2O8FB 2RE1A 2Z58B 1FYVA 1EX8A 3CWCA 3GT3A 3TAXA 1J2UA 1NBME 4F4JA 4TLAA 1MEEA 1K7YA 2WF7A 5JNWA 4DA0A 4ND1A 1R0AB 2CFRA 1HZZA 1EVYA 4ZOLB 2EDCA 2BGTA 2GPJA 1ZH6A 3B8EA 3T9FA 1MX3A 2GFHA 4UAGA 3ZHUA 3BH7A 1JJ4A 5U4XA 1FVQA 4Z0NA 2XZDB 3LP2B 2AXPA 4M8KA 1TK3A 3BK1A 1LK5A 3QT7A 1F8XA 5CP8A 1UPUA 2J7KA 2VOOA 3MGJA 1VQMS 4FDUA 1E2KA 2XLCA 2ZE7A 3R7AA 4F9GA 4JYCA 5GTDA 1CRQA 4YQYA 2OFGX 2POQX 1J39A 4UW9A 3ZD9A 3OQIA 1CRPA 1MIOA 4ES2A 2R8RA 3BZQA 2PZKA 1UC9A 5CTJA 5F8HA 3E9YA 3J7YI 1G5IA 5EZYF 1L5QA 5CNIA 1M6VA 3ZTTA 2P3QA 1J8MF 1WQ1R 2GLUA 2OPQA 1PJ2A 2BZGA 2B4UA 3DBRA 1ISIA 4BU0A 4EPRA 3QUAA 1G0NA 3CIZA 2YC2C 3V1YA 2I4NA 4AECA 5HBGA 2EFOA 2Q8QA 4KBYA 2ILZA 4JV1A 3R7WA 1VB3A 1C7ZA 1ZD5A 4I50A 3QPIA 1RYEA 5DT9A 2GPAA 2P2NA 3IAAA 5LDDC 1SVUA 1KDVA 5EJ6A 3AG6A 2NV2B 1TC2A 4HLBA 2PGNA 5J9FA 5KYYB 2CQ1A 3CDAA 1BO6A 3UB2A 3PVSA 4ZVNA 3LIPA 1NONA 1Z6QA 1G8MA 1G60A 3VAYA 4HMPA 4WKOA 2J59A 1K7SN 4IIBA 2XGMA 1E2FA 4NI5A 3PICA 2BHRA 2RNEA 3IAHA 2WP0A 1Q14A 3UNXA 1P2UA 3JQBC 5BT8A 5ALEA 1X74A 5CX1A 4YCNA 2ON6A 2B1QA 4EY5A 5LD2B 4LBWA 1HFWA 4BJHB 1YONA 4JI3B 3EDYA 3DD5A 2H48B 2O4CA 4HH3C 1WULS 4BB0A 4YI5A 1YWGO 1O58A 4NLWA 2A33A 4O3RA 2PNFA 2D3O1 1XDUA 3ANYB 3OIUA 4UVGA 4QO7A 5LDGA 3DDWA 4BWGA 3N4WA 2BEFA 2DKFA 3NTVA 1C8VB 1VE7A 1E9CA 1N6KA 4EUHA 1D7OA 2AXNA 4FLEA 3B36A 2G25A 3LCMA 4MIEA 4K4WA 4C4XA 3A27A 1EIZA 4XSVA 1XCPA 3Q8RB 2H6EA 2GHRA 3NEYA 1KO7A 5DM0A 5GMKa 3V8QA 4YASA 3D6UA 2EG9A 2C9OA 5J2TF 4BNKA 4DCMA 4PAMA 1SHTX 1JTVA 4L2IA 1WG8A 4IRUB 5H70A 1DAOA 3MXHP 2FPUA 4FFOA 3PNBA 3U6KA 3MJ4A 4F0MA 4M9CA 3AP1A 1ZR4A 2FB0A 4BRZA 5D0EA 4MV0A 2Z8XA 4FFNA 4BB9A 2QHXA 4K9SA 3D02A 2E1AA 1NQOA 2V94A 2BMAA 4BQPA 1ZAXA 5EZ5A 2BFEB 3DKPA 5HIMA 3C6ZA 4USHA 3MS2A 3AH8A 2HMTA 5AYVA 4ZO7A 1DQ8A 2OGWA 3NHUA 2A5FA 2IU3A 1BN6A 1CLFA 3RKSA 2DVMA 4XYLA 1WZ2A 1PZMA 1IR0A 3MEEA 3X3UA 1JS1X 2F3UA 3JTNA 2CYCA 2WSIA 2RF2B 5KFOA 1QO0A 4EI8A 3TLMA 1QB7A 3HMQA 1XBTA 5J1SB 5MDHA 2QRZA 3QVXA 5IT4A 3CH6A 3RRJA 3W06A 1NATA 4WJZA 1R6VA 1JJCB 2MTLA 3STWA 3CMES 1SR8A 4M99A 3VPHA 2Z57B 3ZE1B 2C4WA 2J0SD 5I9MA 5B3JC 1NRIA 5K09A 2BM1A 4A0FA 2XI2A 5A9SA 1KI4A 4AQYJ 3QT6A 3AJ9A 5A3SA 4ZMMA 3QZ8A 3OC0A 3G9TA 4JXXA 3MBIA 3BCUA 2GTHA 2OHVA 1SJ1A 2HHSA 1QYXA 4BOYA 4K9KA 4EEZA 1R27A 3FGNA 5DTEA 5G0WA 2B1IA 2ZTUA 3WBJA 3LWMA 3WNDA 4HC4A 3N28A 5A8RA 3COVA 5LQKA 4HHJA 3AJ2A 4CW7A 1T2FA 5JYCA 3OSUA 5DCUA 1TL5A 1X5TA 1JLCA 1SBQA 1H0HB 3DOCA 2A94A 1H5NA 1HKUA 5IN4A 3BB1A 2X0DA 1WUUA 4ZEVA 2LEBA 3GUUA 2H92A 1EESA 4RNFA 4G4SO 1EJ2A 4ZT6A 3PFIA 1U1FA 4URYR 5HEKA 2DB3A 4AF6A 2JLCA 5LP6B 3DE3X 4JJGA 1JFVA 2G1PA 1F1BA 3RVPA 1XAHA 4J03A 3K73O 1C0EA 3RG2A 1XLUA 5FBQB 4DPYA 4I8IA 1A5ZA 4UZEA 4JUAA 3I04A 4QOIA 2XMSA 2ZVPX 1D2MA 1ZD4A 4J1SA 3W62A 3JSRA 1CEEA 3QSYA 1TYCA 5AMXA 4EZIA 2OJ3A 4RZRA 1CKEA 3CJSA 2CUYA 4NS1A 1LW2A 5SV2A 2O4UX 3FE2A 1T5BA 4D5EA 3GMDA 3T7EA 3QNUA 4EELA 4ES1A 5CT9A 5LJIA 2NSDA 2PSSA 4X4UA 2CQ4A 5J2QA 2I4TA 4OGFA 4ZVMA 2VHWA 3BMNB 3PGXA 2VKQA 3PFNA 4KEAA 2DBBA 2XUJA 4RJKA 3R6TA 3CC2S 3ZS9A 2PFDA 3S44A 2RHTA 2BA9A 4MV7A 1AHHA 1PJZA 2OCGA 2CV2A 1XAJA 5JCOA 3SEQA 1U7LA 3BXFA 5AXNA 2QLJB 5CVTA 1K8AT 4XRRA 4IOKA 2QT0A 1PRYA 2FPMA 3EUNA 5GWXA 4EPVA 1V39A 1WTFA 4QBUA 1F2VA 1EKXA 2XI4A 3FGZA 3SKYA 1X60A 3FUTA 4WESB 4RNHA 5AJHA 3AGQA 1NBMD 3FN4A 3SJAA 1MXFA 5CVVA 3TLXA 1O54A 3OTDA 3DTNA 2IYXA 5K8VA 5DMXA 2WTXA 4IVPA 2HGNA 2ZDQA 3Q5EA 2XWPA 5T4EA 3K5LA 3LPEA 1JMYA 4P5DA 1C7RA 1N2OA 1Y81A 2A84A 2DUJA 4DHWA 5ETQA 1B2LA 3P9QA 4ZO6A 3ZGZA 3I4HX 2C7OA 4A3SA 2J0UB 4MPTA 4HLCA 3BB5A 2ZCVA 1FNCA 4OZ2A 3X3HA 3SBDA 5GAHU 3UH0A 4DLSA 1CR6A 1NASA 4JI3J 1B70B 2QTFA 3ENKA 1RB0A 1WABA 5I4BA 3OO1A 4QE3A 1BUXA 1F2TB 1LTHR 3AEKB 2P5VA 1P0QA 4OB6A 3WLJA 4M7PA 3QUQA 3DMTA 1SRRA 1R8SA 3GXOA 2A35A 4IRXA 3TQOA 2D62A 4C30A 2GKOA 4R0MA 3CNQP 1AUXA 2RDJA 4FZJA 3GA0A 2HXGA 3GLFE 5KOHA 2G09A 4ILLA 4AD8A 4F1JA 1LX6A 1E1LA 2SKEA 3N07A 3MLEA 4KHZA 4JSTA 1KLNA 4QYIB 3A26A 3G0HA 4P38A 4P2GA 1WXXA 2ZAGA 1GO2A 3RRZA 1HDGO 4X92A 3PC6A 4QYSA 2HQ1A 3R40A 4R84A 1RK8A 4PZCA 2ZDHA 2BRLA 4ZQIA 3SXPA 2D0IA 3BDPA 5LA6F 1S8AA 2HSEA 3ZS8A 4MWDA 2XPCA 3UCZP 4KC5A 2EJTA 2KBEA 4Q24A 4RQUA 2A1BA 1JIHA 1MB2A 3EGEA 1NB7A 5AUOB 4BIIA 4LVNA 4R2WA 5D1HA 4M76B 1GLVA 3QVWA 4E70A 1VGYA 2A9KA 1X1DA 5FNVA 3A1DA 3C7CB 4IUCS 4F3MA 4ENUA 2ZVSA 1G7RA 3UTCA 1YCHA 2CF6A 1I4DD 3V1UA 4CLZA 4H4KA 1NEEA 1W5FA 2DWQA 1ZY2A 4NXNF 1NKCA 1XMJA 3ELBA 2V7GA 2PJDA 1J5EB 3FCOA 1J1ZA 5SY4A 3AWDA 5ESWA 4DQVA 1XPJA 4DPTA 3JVUA 2CUTA 1W59A 4GQAA 2QMQA 1A04A 2MR5A 2CK3A 1YJUA 2MLYA 2XMBA 4JODA 2V6AA 4YONB 1UVNA 3X1WA 3S3TA 2DITA 4YHHF 4JYMA 1FOEB 3SCIE 4NF2A 3N8GA 4YMIA 4HMQA 3JD3A 2ZCUA 5EIAA 4IXMA 1RBOB 3SDSA 1RPTA 4RZ2A 4ICLB 3NKYA 1BVUA 1M7BA 2WJ3A 3PW0A 1U8TA 2GVZC 1VL0A 3UOGA 2MSEB 4X2BA 3EDQA 1I3OB 4D8VA 3THPA 5B4UA 3PHIA 1H0KA 1XRLA 2HNZA 3HK2A 5KDOA 4GG1A 3VKFA 2AUMA 1BAPA 4GKVA 2YWFA 4URSA 5JRDS 1RC0A 3J81U 1OD6A 3GJ7A 3JS9A 3QW4B 4MV9A 4NRUA 3X1XA 2GSWA 2HA6A 5GAEU 4C88A 4HHUA 1Y8ZA 1CC1S 3N6LA 5SICE 4A6XA 4MQFA 3Q0AA 1ZVVA 1BQNA 1IUKA 1BW9B 1P2SA 2VHUA 1UAYA 1REQB 1PSDA 2XZOA 4P4SA 1K44A 5T57A 4KO4S 2CV0A 1I13A 3FI9A 4WFYA 4Z1MD 3PHLA 1JFTA 1JFSA 1HQUA 5IJ9B 2JI7A 1IXKA 1ABFA 1HR0F 3E9MA 4FKBA 2DJIA 3IUEA 4NG5A 5CRIA 4EITA 4C4RA 5EE3A 2EYQA 3PFKA 2CMFA 1R64A 4A8OA 1F48A 4JENA 3TZHA 4CO3A 1QR6A 3CZQA 2VBCA 3OOEA 2VJBA 3AP3A 1NX6A 1JHZA 1GWNA 2Z30A 3E8OA 2PO5A 3SDEB 2IA5A 1P75A 4JUCA 4BHQA 4WNAB 3IPAA 5IV4A 3OXGA 5F2OA 2YFQA 1X1QA 3I1FA 1M90T 2HF2A 4AC9A 2FWMX 3NPMA 1O57A 2HRUA 1W2WB 1TTTA 5IZCC 2DHXA 3GGCA 4ZO8A 1M5OC 3BN4A 1RWQA 1RA6A 4RVNA 4RZ3A 1TM4E 4EFDA 3L4EA 1CK4A 3KVVA 3ZWNA 4FF3A 2NT4A 1LD3A 2Q6CA 2FPIB 1Z2NX 4DV0B 2C7BA 1U8AA 4K2AA 1HHSA 4XIIA 5FJ4A 4C06A 1A9TA 2DGQA 3CLSC 4DM4A 4MULA 2ZRLA 3I56S 1U2TA 4FMBB 3DYVA 1U3VA 2MKJA 3AQ4A 3GUZA 2BRUC 3MD1A 1MJNA 1E7SA 4M0MA 2QMUA 2BABA 2W2NP 1H4VB 1ZN9A 1KVIA 2YW9A 5DGDA 4MGHA 1I7DA 4HK4A 1SIZA 2UUBF 2G1DA 1ZW6A 5LSLA 1RXEA 4ID5A 1X8JA 3MGCA 3VNAA 4GR5A 1FP1D 5JPDA 2R7WA 3C0KA 3H25A 5E7IA 2E29A 5TX7A 4KAFA 1DQPA 1VLLA 4YMSA 4K0KB 4HQ6A 3D1VA 4O4HA 1WDLA 3MURP 3IMEA 2EXUA 3JWHA 4IYJA 5KOJB 4EG8A 5K8NA 1DU4A 4HATA 3PHCA 1XEZA 1L5RA 4EUVA 3COWA 3ICOA 4JS0A 3BCRA 4EO8A 2GK6A 5B36A 3D2LA 1PL7A 4H7KA 3R3HA 4DSJA 1Q0ZA 4PPQA 4ZVPA 1RHMB 3GJTB 5L9XA 1PJTA 1VFJA 3FWZA 2VBZA 4CL8A 4IIGA 1H2VZ 4MS3A 1TU3A 1ZQ1A 3CBGA 3DVAA 5JWHA 4RLHA 3IO5A 2FYTA 1GZ7A 2WP8J 3EUAA 3WWDA 2BMJA 3PQ8A 2VG5B 4MAFA 2I0XA 3OLVA 5IM5A 1TYDE 3HSYA 4YC7A 5F8MA 1PR3A 3LF2A 2PGCA 1HQ2A 1YIDA 4ZIRA 2H7VA 5C1BA 5DX1A 5K8LA 4FYWA 2FE4A 3IDZA 4KO8A 4ES3A 1GUDA 2DHGA 3GJ8A 2OKQA 1Q0UA 2CYBA 2Z6VA 1ULSA 3Q3IA 1H05A 5AUPB 4J49A 2V0NA 2CHGA 2X51A 2VK4A 2GEKA 3MS4A 4IUFA 3EWGA 4Y2QA 2R9VA 1TLTA 4HV4A 2AJDA 4ER8A 3VUFA 2AHRA 4LQCA 5ITHA 4C1NA 2WFAA 5CFMA 1DSSG 2OZPA 1J5EJ 2A5JA 4NLVA 4HEQA 3PQ5A 4TS4A 4YCSA 1RSZA 3MBOA 2IEBA 4Y6GB 2WPNA 3CUUA 1NW8A 3UV7A 5IC5A 4AJPA 3ASYA 3ETJA 1NRJB 1WHYA 4OATA 3AEXA 4BLVA 4ZARA 2E5HA 3CJ8A 1FIUA 2GYWA 3FAKA 4Y2VA 3Q8KA 4GXRA 5EPOA 3BL5A 2RH3A 4TWZA 4ZK6A 1M6EX 4MVJH 2ZIUB 4F0KA 4ZXPA 4XJVA 2I6WA 4P2FA 4KE9A 4RXTA 3R5KA 1ZBQA 4KFRA 3T1HF 4EBDA 2UZ0A 2HX1A 4USVA 3V8BA 3FBCA 3EVFA 2BX6A 1EP3B 2PX3A 2IS2A 1W30A 1PG5B 4B9VA 2F1FA 5EWEA 3V2HA 2CPYA 3DFFA 3TGPA 3C8UA 3ZGVA 4NWBA 4BPBA 4YMLA 3HD2A 1U28A 1P72A 5J63A 4AMGA 1QH0A 2Q2QA 3KQUA 3U60B 3ET5A 4O2AB 2B7CA 4XLTA 1DMRA 1HLDA 4HVAA 1MJFA 5HDQA 4D45A 4C3MA 3R9KA 2VSNA 4J0FA 3K59A 3DLIA 5JW6A 3GVCA 4UOCA 5KFLA 4Y9SA 3KAQA 3N8DA 1UZAA 1ZJ6A 5EKTA 3FB4A 3EOZA 1D7AA 4HX2A 1NB2A 3QKIA 2QT7A 4LYHA 1ZPWX 3KHUA 4DG1A 1WIWA 2P2SA 2JIRA 2XF2A 3ESXA 5ALWA 1MF7A 2RIPA 3GRYA 4MUAA 1GP2A 5ALFA 1KSGA 4HYQA 3ABQB 4ENTA 1U3DA 3K6KA 5BSTA 2JIMA 2ZJ1A 1JJVA 2QXTA 1YVDA 3IGNA 1T9UA 2HI0A 1FRJA 4H1HA 1UA1A 1HI1A 2V7BA 3Q8PB 4W5TA 3S29A 3BHNA 1XFAA 3D0HE 5F8GA 4DV1B 1N1EA 3JQ7B 1OXXK 4WV3A 3LPCA 4BNDB 2GCPA 2TRSB 2PKWA 3N5CA 4ZTUB 2W8BB 4JJ8A 2IHKA 3K0EA 3W3SA 2W4IA 1SC3A 4DV0J 3U3RA 3D7RA 1F5NA 1NQ5A 3THXA 1O6GA 2D5AA 4YN3B 1VQ7S 4UNQA 1KI1A 4CNZA 3MMCA 3BH0A 5K45A 2DGTA 3FTDA 3NHFA 3EF3A 1A5BB 1C4AA 1LA2A 5L3ZA 4BLUA 4K9DA 3I5YA 2DPXA 3N8IA 3U44A 5J2PB 1ZDMA 1G8GA 3G89A 4FZVA 4HBZA 3H1TA 3BSYA 5J4VA 3WHPA 4FHEA 5CXTA 2C96A 2PX6A 4EY4A 4GXNA 1Y11A 1SCKA 3QXSA 1LW0A 2R1VA 2LWIA 3V8EA 3BILA 3OPVA 1XX6A 1A9XA 4K0KJ 10MHA 4BNTA 5KZMB 3IBCA 2V1UA 4CGYA 3B53X 5GOZA 4MMOA 1RYBA 5K6TA 2REBA 2J9EA 4QOHA 3QVMA 1CUXA 1HYHA 5HQ3B 1ZTWA 4JYAF 1FXSA 4TKVB 4X5OA 2V6JA 4BVFA 3H7IA 2CPXA 3LXUX 4NBKA 4RD1A 3U4IA 2IBMA 4DEZA 1AXRA 3RC7A 3X44A 1WG4A 3J80Y 3RBDA 3KELA 3TZZA 3KHKA 3O1HB 2QTGA 4FDTA 4LSNB 4CMBA 3E6AA 3EGXB 4F11A 2FD2A 3S2YA 1LI4A 1HQEA 4BN4A 4GE0A 4R68A 3JZMA 1NK5A 1CJVB 5LQUA 4G6VB 3NNHA 1CUWA 4QU6A 3L9WA 3L7AA 1ZUNA 3EVGA 2ZYGA 1O51A 2R7LA 1FSZA 3UNYA 5A9RA 2P6SA 5AJ3F 2AU0A 3HJBA 2X42A 4Q15A 3CEHA 3G8QA 1JXEA 3DDSA 1KIMA 1Q16A 4CWBA 3Q22A 2W9BA 2H51B 2QQFA 2JGMA 2FLPA 1C8LA 5HRCA 2O2DA 3OT9A 3MD3A 4DR5B 3DLKA 1E3DA 1HTBA 3JYTA 3G82C 3H7HB 4Q4HA 2IZ6A 2YY6A 3L4JA 1QIFA 3ZDYB 2OWEA 3TWOA 4N6NA 3VYWA 4KWIA 1ZA2A 4PINA 1U3CA 4Y2YA 1UW9A 4FYJA 1QUVA 1ST3A 2EFYA 4QXRA 1REVB 4HDRA 5SYAA 2IUEA 1R0SA 4KQMA 4UUOA 3KKEA 4ALIA 2WTNA 2CPEA 4ED8A 1L4NA 5ILQA 5ALZA 1TQ6A 2LCFA 3K16A 4RZHA 2E4YA 2X76A 4LBIA 2J3MA 3HP1A 3H9GA 3LWBA 4RNOA 5I01A 3TLCA 2MZSA 2DH5A 3MPUB 2AJ0A 2GF2A 5F8JA 3SQMA 4DWOA 1MT0A 1VZ2A 3F1KA 5HI7A 3QFSA 4GMFA 2V9CA 3OZXA 3FSEA 5A6SA 1THZA 4AKHA 3Q2TC 3UHOA 5JO9A 1AZLA 3DXBA 3DGPB 1ZS6A 2GILA 4TXHA 3HUUA 4IVQA 3HG7A 2O8FA 2Z58A 1CTQA 4FOSA 1F9EB 1GMUA 3LCUA 5MN5A 2QR3A 1UKZA 4ARBA 2X8JB 4FLFA 3IODA 5ESXA 1C9YA 1FTNA 3PRHA 2WRMA 4YP6A 1R0AA 4MWCA 1E94E 1TV6B 1EWRA 3H5TA 4AF8A 3DXSX 5FWDA 1XCGB 4ZOLA 3NVAA 2CKWA 3BGRB 2ZC3A 2RCNA 1KYTA 2XZDA 4UPDA 5DBIA 3LP2A 4EHNA 2HOQA 1KN6A 5DASA 5FBHA 1B0UA 1Z7WA 4LXIA 2Z5VA 2AZDA 2KL8A 5CDYA 4F7WA 2C31A 4M1MA 2R6R1 1D8AA 4UBKA 3OFHA 2V4MA 2OEPA 1OV6A 3SJUA 5KFUA 1OY8A 1IN5A 4ILMA 3VR6A 1TEZA 3SHWA 4JBHA 4B3JA 1HNZF 2WPDA 3CGWA 5DNDA 4DL5A 3KDOA 1QBKC 2VFUA 3FVYA 3PYFA 4P6VF 1ODSA 3GEBA 3U62A 2DEIA 1C4XA 2XUZA 4BQOA 2XVMA 4QULA 2I38A 1D04A 1HC7A 3OESA 3G9QA 1CY6A 1EQAA 4IJWA 2DGUA 4O3NA 4TYBA 1YRUA 2JG3A 2RCYA 5L45A 1X8KA 1HDEA 2FSVC 4DV1J 3VO2A 1WELA 3FX2A 1TAHA 2IHNA 1U04A 4GI5A 4KAAA 1PGNA 4JLUA 2GEJA 3GHYA 2NZJA 4IAOA 4GXTA 1MNQA 2UU9B 3E0QA 3WIUA 5FBKA 4J9NA 1J23A 5DZSA 1DOAA 4LJ8A 3ENQA 1P4GA 1HNXJ 4RE5A 4KRGA 1WRBA 3LVQE 4ZZ1A 5JDIA 2XNDA 2CQ0A 2J9DE 1SFRA 2Y1LB 4QM7A 2AI1A 2AC7A 3WLOA 1SJRA 5D00A 3T4PA 5JECA 4UBMA 1J8QA 1I8TA 5KYYA 1BGXT 2B7LA 4C05A 1EH5A 1ZAVA 3PJXA 3P2YA 3L07A 2ALYB 3EVWA 4D92A 1SZPA 3ETLA 1YZ3A 1C9EA 4EUFA 3PG9A 3G85A 2UKDA 5AJWA 4HB4A 5U47A 2IIBA 2X9GA 4KQ6A 3HUFA 3BS9A 1CY7A 3DLPX 4G67A 5I8PA 2GPYA 2MIIA 1MAWA 4BNFA 1I51B 2CMHA 5ER6A 3HXPA 3KEOA 1THMA 4XD2A 2H48A 3I32A 5E41A 1GARA 2X8AA 4RCYA 3GCGA 2VT3A 3MJDA 1M83A 1YQEA 4B43A 3PFEA 4MO9A 4DLLA 5C32A 3BKFA 2C1EA 4ENWA 2DNKA 4IRKA 2IBKA 1LXCA 2VYND 3AJ8A 3RW9A 3ILYA 4F12A 2DHDA 2QRHA 4ZGBA 3W77A 3D5EA 4N5HX 1K8QA 3AA9A 1KDYA 2Q8NA 1KFKB 1YRWA 2GZMA 3RM3A 1CUIA 4Z2AA 1X9IA 3VR1A 5AKZA 4P4TA 3IT0A 1NP7A 1VRVA 5EUBA 5A6PA 2CRLA 3QENA 1JQGA 4KE8A 3ZN2A 2QPOA 3OY7A 3TO5A 2LPMA 2ADMA 1VQ8S 2VSFA 5TSDA 13PKA 1N77A 4LOHA 1R7IA 1JJIA 2ZAYA 3QYJA 2JD1A 3QT8A 3H9JA 2BFEA 3G2PA 5ALPA 2DQYA 3C7TA 3A6JA 2JHAA 1LC0A 2R7TA 4DR5J 1QLWA 2FI1A 4WFAQ 3RHTA 4MTPA 2XXBA 2ROPA 1W29A 1UEJA 3IAS9 2N4CA 2LQJA 1MMFB 1HYSB 3DHXA 4PO9A 4H4OB 2HRDA 1O96B 3FNNA 4KB5A 4A1OA 2RF2A 2B34A 2YWJA 4XYEA 3CCZA 2C9DA 4MV6A 2NZWA 1BVRA 3BFKA 4FDFA 3OAAD 1HMYA 3OFND 3PTLA 4EKNB 2EZUA 2G1KA 1JTEA 1NMQA 1A7GE 1SKAA 2VPIA 1TUWA 4CPDA 1YVRA 3URKA 4FJ0A 2J5BA 2JEZA 3R4CA 5ALKA 2QTLA 1JJAA 4I55B 1I2ZA 4B3TF 4EJFA 3PO4A 1WV0A 1G7CB 2W5UA 2ONCA 2GBCA 3CVUA 1L4BA 3BL8A 2B82A 2DUMA 2Z57A 2L2QA 4C6SA 1VFNA 1VIOA 1FX0B 1V4NA 2JI9A 4D0GA 1FRKA 2HQ3A 3UAXA 4QBIA 4MA4A 2AOXA 2J85A 2FZWA 2Z6QA 1OI2A 2CDCA 3B4MA 4C0AC 1BQXA 1TUVA 3JD0A 1G20E 2M52A 1S1XB 2QM3A 3LNTA 1J0BA 3DE6X 4DYDA 1TLFA 3ZE2B 1M5HA 2J0XA 3L4BA 3RKRA 5AESA 4IXDA 3D4JA 2JAWA 1WORA 2ZS9A 3QKWA 4IJUA 2ODTX 5TY0A 1IB0A 3B20A 1T9AA 5GVSA 2J9FB 1Y10A 4DCUA 1RXSA 4TPKA 4MS1B 4MOWA 4ZGWA 4BZZA 5LXRA 3ETOA 2WAXA 3CJQA 4M94A 3QGIA 4I4NA 4EHFA 1ZD9A 5LP6A 1VHLA 4R98A 3WL5A 2AT1B 1U0HA 3V7YA 3WQSB 1DQAA 1VE3A 3S8EA 1M73E 4BAGA 3C3KA 4BGIA 1SL1A 3HU2A 3PJGA 2AMFA 2EERA 1H7XA 1QVVA 4B3SB 2QVYX 2IBSA 2F8MA 1S4MA 1JQAA 1PYOB 3WZLA 1H23A 2BZSA 3C16A 5IT0A 3VPAA 1SPBP 1MJGM 3FM9A 4GSLA 3K0CC 2ESRA 3VYTB 3M3DA 4LV6A 1V3RA 2YNFB 3OIWA 3D5TA 5EJGA 1TZMA 2PT0A 1FDNA 5CJPA 4FI3F 4PO3X 2A3JA 1P9RA 3CS3A 3O8RA 3BMNA 2HBYA 4JI2F 4UCFA 4BMVA 2R8EA 2A5LA 5BSRA 3FRHA 2X4IA 3H5LA 2PR2A 3C6UB 4AS3A 4P84A 1NI3A 3CNLA 1IC6A 3RUBL 2IT1A 4CHGA 1OIAA 3TKLA 3FVVA 5DM70 4TMWA 4UAVA 3TD9A 2WVHA 3UC5A 4FWTA 2WIGA 1CUHA 4HQRA 2B0CA 2DGVA 2YWGA 3U3OA 4D6PA 4P1ZA 1MMNA 1G0OA 3LQKA 2H07A 2QY6A 3G13A 1NKSA 3CSUA 1DAXA 3LANA 2AP6A 3BO3A 4WESA 1TUBB 1ZK2A 2Q45A 1G8YA 4R8KA 2QUHA 4MLZA 3B7PA 4KFBB 3ITKA 1K89A 1G55A 5DDIP 3WP0A 1CZUA 3O4GA 4AJHA 1RWKB 2YY5A 1B0AA 1NSYA 1H3NA 2GCGA 1UFOA 3KB8A 2UAGA 3RD5A 5T7LB 3ZLVA 3B9BA 3EC7A 1E8NA 1O4VA 2EW1A 2VI5A 4CTKA 5D78A 2NQ2C 1BDIA 4RKRA 2J0UA 4B7UA 3PX4A 1AKRA 2JIBA 1EETB 2RK3A 5JMWA 3F7OA 1GTSA 1BHSA 2KW5A 2MGZB 2ST1A 4G89A 3VH4A 3AB8A 4U7WA 3A12A 3EC1A 1HNIB 4CLTA 3F1LA 4X90A 5FOQA 3QT5A 2P9YA 2ATLA 3GLHE 4QODA 1C9NA 1F2TA 2M9KA 3G8CA 3AEKA 1J8YF 4JMPA 3JQ8B 1C3VA 1Q17A 3VFDA 3A37A 1M1NB 1XA4A 1K6EA 4WHMA 3O1IC 1SMKA 5FKJA 2OP5A 2BOPA 2JJ8A 4AZSA 3ODGA 3UO8B 4C8ZA 4P0TA 4NJOA 1R6YA 5T8KC 3PW2A 3QMMA 3X43A 1H7WA 2UUTA 1CRWG 3K94A 3RAPR 1W26A 1FKAF 2J45A 5CCLA 4QYIA 1GFIA 4CMHA 3ONWA 2I55A 1PJ6A 4K6GA 3ETNA 2OEJA 2QTTA 4UJ3A 3B5EA 3HZOA 2CQCA 1PW7A 2FUG1 1MU2B 4BBZA 1VCNA 2D3OR 4RX6A 2VICA 1EDEA 1QAOA 4RVOA 4GLJA 1MW7A 3HFJA 1TB4A 4J76A 3MJFA 4MW7A 2C95A 2A7XA 5B5SA 1L7MA 1S6PB 4FYPA 5FTWA 1XAIA 4WIAA 3OE1A 2CSXA 1I1QB 4KXVA 1G41A 5B30A 4OQYA 1Q19A 1ESNA 1DRWA 3OQOA 2I0FA 1N9KA 2JI8A 2M5YA 3AV0B 1N92A 4Z0PA 2CKMA 3LFTA 4DMZA 5JD4A 1EHYA 1HDZA 4HAVA 1QCZA 1D1UA 2WZDA 4B08A 4ZI7B 3RGIA 2IQIA 1IG3A 4UOEA 2AWOA 3VNSA 1WF3A 1MG5A 2XMKA 4WZBE 2GD6A 1FPMA 2DCLA 4GPAA 2QWXA 1U0LA 3IV7A 2IRXA 3MM6B 4N12A 4LZNA 1JLSA 1NN1A 2C42A 2V69A 1PI3A 3K1JA 3PCRB 1DXHA 3L02A 1RJWA 4ICLA 1PLJA 4WFNQ 5FTMA 4G1QA 1LPSA 3DAHA 3P9PA 4ROTA 2M6SA 2EW8A 4L50A 5ALGA 2WIDA 1T9KA 3B6JA 1G8SA 2NSJA 4A2QA 3TR6A 1QF9A 5CR9A 3ZTRA 2X23A 4PN7A 1TFWA 1APSA 1I3OA 1OFUA 3N74A 2QL7B 1T03B 1ORWA 1V8ZA 5A2QY 4AKTA 4TL8A 4KV9A 2I9SA 1XDZA 3QBCA 3JAKB 4BNYA 3VI3B 5LN1A 4UNRA 2H54B 3ND8A 4JBWA 1IBKB 5AI0A 1DKQA 2XTJA 5AVTA 3L7NA 2CXTA 4TU9A 4HFJA 3TG8A 4CL3A 1X1SA 4YUYA 3ZDBA 3SOZA 5HF5A 1D1SA 3WL7A 1AS2A 3C5WP 2BR3A 4B3SJ 1X8LA 2ICAA 4CIWA 2I6GA 4BLRA 1ZIXA 4ZP1A 1BW9A 1Y3BE 2XVZA 1REQA 4AE5A 5LYJB 4PG6A 2OLKA 2PKXA 3ISJA 4GQBA 3PW4A 1LLFA 1ODJA 1O87A 3AQPA 4QDOA 3BEOA 2JHGA 5IJ9A 4URGA 4H18A 1OC4A 4FHDA 2E6KA 4YV0A 4KXLA 1FMJA 2FW9A 4BO7A 1MX5A 1XALA 3PSHA 4UU1A 5K3CA 5KVVA 5KYNA 1DO2A 1JNXX 2M8HA 1S48A 4M9XA 3RPEA 1GKLA 1GPWB 1KMNA 1AVTA 3TNVA 5KT6A 4P52A 1IUNA 3STTA 3N59A 2F59A 3UN5A 2DNHA 1PNTA 3WP1B 3ZVRA 4B9NA 3SDEA 1VGRA 1SJ9A 1OGIA 2RHMA 2PZGA 4I9HA 4WNAA 1LQTA 3R3TA 1YI1A 3OPXA 1NJ6A 2ZW9A 4CF7A 1CUCA 2P91A 4HD8A 3HRIA 3UJPA 1E69A 5F52A 4BX2A 1VPEA 2PGLA 1US8B 2DF8A 2OBMA 5A0FA 1JJHA 3SQOP 4DUYF 3PRJA 1T4GA 2O5EA 3IPRA 2BKOA 1UFKA 4YXWA 4BEVA 2PZJA 3L9ZA 4TWJA 3T9EA 3R77A 1WETA 2MDTA 4DFDA 2ZE2B 2G9ZA 3K4QA 1TD1A 2BONA 2VQFB 1PT5A 4MI1A 1VBZA 3K70B 3HVKA 2FHOB 4TLMB 4PFQA 4DJEC 2EHDA 5JNUA 3QLVC 4XDHA 5JANA 2EZTA 2HR1A 3MAQA 4TLQA 5IAJA 4ZVLA 2PUCA 4F85A 1AIPA 1F3FA 2X58A 4QOGA 5JIBA 1ECCA 4I9FA 4ECQA 2FR0A 3DDCA 1MO6A 3C5EA 3PRYA 1XN1A 2UVQA 1JIUA 4Q43A 2YV3A 4CG0A 3A36A 4EQ6B 3ICVA 3T8YA 4JVMA 5DYIA 3T3IA 5A4MS 2IHVA 4S0ZA 2FVCA 1V96A 3SJ7A 4B71A 5KOJA 4H9GA 1QCCA 5IP5A 1UM8A 1CJTA 3PEFA 2YY3A 5CH5A 3M6FA 4V3CA 1E20A 4C0XA 1O97C 1YAJA 1OT3A 2ZB4A 1NJFA 1NVBA 1RHMA 3ER6A 3GJTA 4XDCA 1HK7A 5DYYA 3S7RA 3IQFA 4UASA 2HIQA 4OHCA 3HSJA 2EW2A 4CH7A 1W0KD 4HWRA 2XHCA 3OD5A 4RZIA 3CVXA 1EPUA 2HJRA 1WF6A 3D3JA 1H2EA 1YZQA 2QTWB 3FPAA 3GGSA 1GOTA 2VG5A 1W4ZA 3ZZUA 1K9MT 5B4TA 4GWLA 4DT1B 4O1IA 3HN7A 3TOVA 4LF5F 3CH4B 1XMSA 1FJCA 2ZBRA 3UWKA 3L0OA 1W2GA 1Z07A 1AQJA 4I8DA 4DX5A 1HFJA 2PSDA 3NFRA 5J43A 2IGBA 3Q6NA 2A6OA 2PGJA 1W1WA 3ZWMA 3WISA 4OKNA 3ZWAA 2Z6AA 5G02A 4R1PA 5KFNA 2OXFA 3DT8A 5ADWA 4ZVRB 3W9BA 4CNYA 5CJ2A 4YFVA 1Z18A 4Y67A 4HX9A 2WKPA 1F8YA 4GKKF 3L7DA 1DWOA 3DNPA 2I4MA 5K8MA 3G0GA 3JTPA 1DIHA 4Z3KA 1MOQA 3O0DA 3RJZA 2WYUA 4J0DA 1ZMXA 5DCWA 1FLAA 3MD0A 1FVXA 5DK4A 2QV6A 1QDUB 3RAXA 5DHPA 5C35A 5HS6A 5FLEX 1XN9A 3MOIA 3ZD8A 4XZ3A 3ZZOA 3CMQA 1GAJA 2XUFA 2G17A 4B44A 4ZDJA 3TYXA 2VP6A 5BOSB 2HIMA 5BN5B 4C0QC 3HQ4O 3GAMA 3DO6A 2HZ7A 2ZUEA 4OUDB 2GQ0A 4W92B 4FW8A 5FTNA 1FNSA 4EZEA 2P7HA 3TB4A 1YJ5A 4YDRA 1PG5A 2ZM6B 4LJMA 4RUCA 4UT4A 3Q3GE 4W5OA 1RT1B 2GNOA 1IBKJ 1AMNA 3FFTA 2Y71A 1ZJZA 2Q3JA 4Q03A 2AW3A 4X0EA 4LYEA 1LBSA 3W6NA 3W2TA 3ZJUA 2OHGA 1SD1A 1RAJA 1KH2A 4LRTB 2Q6OA 3M6LA 1XNRB 3MYYA 4O2AA 4ZPCA 4K0RA 5I4MA 4MQEB 5ETPA 3L8HA 3T34A 5AK4A 3L7PA 2W90A 2VOEA 4UU0A