4ATNA

Crystal structure of c2498 2'-o-ribose methyltransferase rlmm from escherichia coli
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
357
structure length
356
Chain Sequence
MNKVVLLCRPGFEKECAAEITDKAGQREIFGFARVKENAGYVIYECYQPDDGDKLIRELPFSSLIFARQWFVVGELLQHLPPEDRITPIVGMLQGVVEKGGELRVEVADTNESKELLKFCRKFTVPLRAALRDAGVLANYETPKRPVVHVFFIAPGCYTGYSYSNNNSPFYMGIPRLKFPADAPSRSTLKLEEAFHVFIPADEWDERLANGMWAVDLGACPGGWTYQLVKRNMWVYSVDNGPMAQSLMDTGQVTWLREDGFKFRPTRSNISWMVCDMVEKPAKVAALMAQWLVNGWCRETIFNLKLPMKKRYEEVSHNLAYIQAQLDEHGINAQIQARQLYHDREEVTVHVRRIWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBOSOMAL RNA LARGE SUBUNIT METHYLTRANSFERASE M
publication title Crystal Structure of Rlmm, the 2'O-Ribose Methyltransferase for C2498 of Escherichia Coli 23S Rrna.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 117
structure length 356
sequence length 357
ec nomenclature ec 2.1.1.186: 23S rRNA (cytidine(2498)-2'-O)-methyltransferase.
pdb deposition date 2012-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01728 FtsJ FtsJ-like methyltransferase
A PF18125 RlmM_FDX RlmM ferredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2810 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4atnA01
3.30.2300.20 Alpha Beta 2-Layer Sandwich THUMP fold THUMP fold 4atnA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4atnA03
3C6KA 2PWYA 3SM3A 4PYJA 3NWEA 5FA5A 2BZGA 5DTMA 2OO3A 2IBSA 5GIPE 1EQAA 2Y1XA 3HVHA 2YQZA 4YMHA 4RYLA 4YUZA 3R3HA 2PX5A 2V7EA 2PX4A 3PB3A 4WXHA 1WZNA 4L7VA 4EMSA 1G55A 3P9KA 4AZSA 3B5IA 3SXJA 3K6RA 3CBGA 1X1CA 2ZZKA 4MQ4A 5EKXA 3AY0A 3B89A 1EG2A 3FRIA 5DX1A 3RW9A 1R00A 2QYOA 3FRHA 4KVZA 4V0RA 3ANXA 1DCTA 2I9KA 4QQKA 5EC8A 3PLAE 2YX1A 3GDHA 4GOOD 1YZ3A 1ORHA 5CVUA 4RTSA 1EIZA 5ICCA 2NNWB 3M6UA 1ZGAA 4E32A 3LBYA 1KR5A 4X63A 2GAFA 5FHRA 3LKDA 4QQNA 1UWVA 2XYQA 4DA4A 4R05A 1BHJA 3KQSA 1SG9A 1WY7A 2AZTA 2P7HA 1YB2A 3BKWA 3HCDA 3LDUA 4C08A 3EVAA 3TLJA 2IH5A 4YV1A 2ZTHA 3PS9A 4ER7A 2DPMA 4RVDA 3OZSA 2P35A 5LSAA 4EK9A 4RX1A 3GRUA 4CKCA 3JWGA 3EVGA 4BLVA 1F38A 1NV9A 3G8AA 2GLUA 5H02A 5U4XA 2EJTA 5CM2Z 5DRYA 1DUSA 4ER5A 2VZ9A 5ICFA 5M5BA 1INLA 1KPIA 1PRYA 3SSMA 3LGAA 4QPPA 3KQVA 1P1CA 4DCMA 1VQ1A 4PYQA 5HOQA 5CIYA 5E1OA 1X1AA 5FA8A 5HIJA 2GA9A 2I62A 5T67A 1JQDA 2BM8A 5K0GA 5KVAA 4GQBA 5K09A 2YXEA 4P7JA 4CTJA 1YFLA 2AN3A 4BP3A 1AQIA 2P7IA 3HCEA 5CUQA 2CMHA 2GH1A 4IV8A 2FK8A 3EGIA 3OFJA 4DQ0A 5IKMA 3C0KA 4HH4A 1D2GA 4RV9A 3QV2A 5GOZA 4BLWA 4M7RA 2AOUA 2B9EA 4FZVA 5GWXA 3R9XB 1RJFA 5HFJA 2IDJA 4RTMA 8MHTA 3CVOA 2CMGA 4X61A 3ID6C 3AWIA 5E1MA 3EEYA 1VBFA 4C03A 3ELDA 4FSDA 2UYCA 5E9WA 3HVIA 3PT9A 5EQJB 2OKCA 3FTEA 4GOLD 1T43A 2AS0A 4OBWA 1NW6A 2YUIA 3NTVA 5FWDA 1SQGA 3A7DA 3C6MA 3ELUA 4DM3A 3LCCA 3UJCA 5LQCA 5HEKA 5FTWA 5LQUA 4WVLA 2PX2A 2AN5A 3FUVA 3P9CA 5ERGB 3HNRA 1XTPA 3DP7A 4QTUB 3GRZA 4AZTA 1HNNA 3G89A 4K6MA 5BP7A 2B2CA 5KQRA 3MCTA 4RTQA 3UJ6A 1G38A 3UBTA 1L1EA 5DM4A 3M6WA 1KYWA 4PYIA 5G02A 5HILA 3UWPA 2DULA 2PXAA 2FRXA 3G2OA 4KIGA 4POOA 4AZVA 2BR5A 2ORED 3R0QA 3RODA 3EEOA 3M70A 2JHCA 4E2ZA 1NW8A 5DX8A 3HCAA 4E31A 5CVJA 4YUWA 3M6VA 2C7RA 2BR3A 1ORIA 5JUWA 3M4XA 4E2YA 2H1RA 3GIWA 5EHGA 1NKVA 3FPHA 1XCJA 4OA5A 3UJ7A 1M6EX 3G88A 3R24A 3L8DA 2PKWA 1WXXA 3LPMA 1SKMA 3BGVA 1UFKA 3DLIA 4YMGA 1XXLA 5F2KA 4ISCA 1XCLA 4F86A 2BH2A 2FHPA 2OY0A 1H1DA 3FUWA 3I5UA 1JG4A 3CJTA 4QDJA 2B3TA 5HIKA 5ICEA 5EHIA 3OZRA 2P40A 4OQEA 2VDUE 3P2KA 1AQJA 2PV0A 5DXJA 4YV0A 1KPGA 3BGDA 4Y30A 3TKAA 3MTIA 2IFTA 2P1DA 3U81A 1TPYA 2JHPA 3O4FA 4Y2HA 3ER8A 4OQDA 5BXYA 4UOEA 5LQAA 3EPPA 1FBNA 3DTNA 1F3LA 3GXOA 3HVKA 4LECA 2YXDA 4HTFA 3FTFA 4GBED 1ZGJA 2HMYB 3ELWA 3TFWA 1P1BA 5E9QA 3EGEA 3UJ9A 1X1DA 1FP2A 1NBIA 1N7IA 1XDSA 2OB1A 2Y1WA 3G8BA 4HTFB 3IHTA 2QRVA 3QOWA 4LWOA 3O7WA 3EVCA 3EVEA 2A14A 4GC9A 4CKEA 1NW3A 2P8JA 3EGVA 3P2EA 3BWMA 2ZULA 4MTLA 1O9HA 3ER9A 2OYRA 1FP1D 2ZZNA 2ZIEA 5K01A 2PT9A 2GB4A 1KIAA 1VIDA 3SGLA 2VDVE 3K0BA 3LL7A 3BT7A 2Q41A 1IXKA 1G8AA 2HWKA 1VE3A 4AZWA 5ICGA 1D2CA 4RTJA 4DMGA 3NW9A 3Q7EA 4LWPA 2O07A 4FT4A 3LSTA 5EEGA 3DMGA 4PYLA 5LQJA 2P41A 3UJBA 2NXJA 3KPVA 3OZTA 5DPMA 2Z6QA 1VP9A 2O06A 2IPXA 2OZVA 5K05A 3I64A 4P7KA 2ZCJA 1TW3A 3PVCA 7MHTA 1O54A 2QE6A 2FK7A 3KPYA 3KQYA 5LQKA 2KW5A 1OR8A 5EMMA 3MCZA 5DT2A 5DWQA 1KHHA 4PYMA 5GINE 2FPOA 1JSZA 3FPJA 3NMUF 4PYOA 3T7RA 2R6ZA 4ZTBA 2C7OA 2IDKA 2VDWA 4XCXA 4Z2YA 2BR4A 2O57A 3A27A 1ZG3A 4U7PB 3THSA 3QOXA 5HIMA 4PYNA 1JG1A 3I53A 1RJEA 1YFJA 1U2ZA 5K8VA 3OCJA 5CD1A 10MHA 5K0LA 3TM4A 3UFBA 4XUEA 2Z6UA 2FYTA 3DXZA 5E2BA 2H11A 3GJYA 5K0JA 5LQNA 5HIIA 1VL5A 2AOWA 5FULA 1BKYA 2EJUA 5T64A 1L9KA 2WA2A 1MJFA 4RVGA 1EJ0A 3HTXA 1NV8A 4M37A 4KRGA 1G8SA 5DXAA 2O05A 3I58A 5B1SA 3TQSA 5DSXA 4R8RA 4PINA 2GS9A 3TR6A 5EVJA 4F85A 1XJ5A 4QVKA 3BWCA 3KQMA 3GNLA 4YUXA 2OXTA 3HVJA 2PT6A 4OA8A 3HM2A 5FWAA 3E23A 3T7SA 4E33A 1FJXA 1L3BA 2R3SA 2AOUB 3T7TA 5BW4A 5DTRA 2HR1A 3OFKA 2UYHA 2HTEA 2N47A 3OU2A 3A25A 1N2XA 3EVBA 3WSTA 4AUKA 2OB2A 5GP1A 5DX0A 3A26A 1NBHA 2ZIGA 3FPFA 4E2XA 3HA5A 4B17A 1WG8A 4PIPA 3DMFA 3KKZA 4GEKA 3FUXA 3TPZA 1N7JA 9MHTA 5T6BA 3FYDA 4O29A 3CJQA 2PGXA 4U7TB 5K03A 3CKKA 2CWWA 3B7PA 4KIFA 4GOMD 2PVCA 4G56A 1XVAA 1IM8A 1YF3A 1QAQA 3JWHA 4OX9Y 3HCBA 2G1PA 2XYRA 4A6EA 4GC5A 1VLMA 5E1DA 1TW2A 2IGTA 3OPNA 2QY6A 4DZRA 3DOUA 2ZFUA 3C3YA 3E05A 4IKPA 2FCAA 3O31A 4R6XA 5EMKA 1SVUA 3RIEA 2PLWA 3THRA 3TRKA 4YV2A 3KR1A 3VYWA 1RJDA 3KQQA 5C1IA 5EEHA 5GM1A 4PGHA 1RI4A 4EQZA 1ZHFA 3VSEA 2JJQA 3BWYA 3I9FA 3G2QA 4ER3A 4KWCA 3UA3A 1G60A 3T0IA 5DLYA 3JWJA 4PNEA 3AJDA 5D1HA 3S68A 3C3PA 3DMHA 3HP7A 5JR3A 4P7GA 2JH8A 3DH0A 4H0NA 3EVFA 1JG2A 2PBFA 3TM5A 2I7CA 3KQWA 1SUIA 1R8XA 1O9GA 3KPUA 2NXNA 1KPHA 2C7QA 4C04A 2PSSA 2ADMA 2PXCA 2WK1A 3OU6A 3GRYA 4DKJA 3B3GA 3MERA 1Z3CA 2NXCA 2YXLA 5K0FA 2G70A 2G72A 4V0QA 5DM1A 1QYRA 3FZGA 5LQRA 5CVDA 2ZBRA 3KPJA 1I9GA 5F2NA 1EJ6A 1PJZA 1P91A 3GWZA 3NVMB 3GRRA 3P97A 5C9ZA 2NYUA 4EKGA 5FHQA 3KU1A 4ER6A 5MHTA 1X19A 2QRVB 3IYLW 4IWNA 1M0EA 5DSTA 2P3OA 5EKUA 3GU3A 5BW5A 4PYKA 3LBFA 2UYOA 3KR2A 3NWBA 3BWBA 4QTTB 3DULA 2XBMA 4PCAA 4CXMA 3DUWA 2ZIFA 4RTPA 2ZZMA 2E5WA 5EG5A 3H2BA 3P71T 2AOVA 1ZQ9A 3HCFA 3G7UA 4KDRA 5LR6A 2ESRA 3NDIA 5EOVA 3EVDA 1NW5A 4YUVA 1FPQA 2IH4A 5EZQA 2XYVA 3P8ZA 2P3LA 1B42A 1JQEA 3FPGA 3SMQA 1JSXA 5FQNA 5K0EA 2NP6A 1RI2A 3JWIA 2WA1A 5E8JA 3BZBA 5IH3A 4RVFA 3PTAA 3LDFA 1XDUA 2VS1A 2AOTA 2YTZA 3DXYA 2OPBA 2ERCA 3FTCA 4P58A 3UJAA 4LG1A 4P7FA 1X1BA 5E2AA 5EZSA 1L3CA 4MWZA 2AOTB 4QVGA 3ERCA 3UA4A 4CWAA 3LX6A 3CCFA 4XUCA 3SX0A 2BM9A 3F4KA 3FUTA 1HMYA 3HA3A 4RVHA 4E2WA 4X41A 1D2HA 1JG3A 2LD4A 4ER0A 5HZMA 5K0BA 1M6YA 1NE2A 2EFJA 3AXSA 4X60A 1UIRA 3FYCA 4DCGA 2GPYA 3CJRA 3CC8A 4HGYA 5GM2A 3KQOA 2AN4A 2ZBPA 3PX3A 1I4WA 1EAMA 3UZUA 5CVVA 5FUBA 4PCLA 2JH9A 4FGZA 5DRTA 4FP9A 4C05A 2CKDA 2IIPA 3UJ8A 3UJDA 3ELYA 1Q0SA 3KPWA 4FR0A 2IP2A 2ONZA 4C06A 2V74B 1RI5A 4CKBA 5CVEA 2UYQA 4E30A 3MTEA 3R6TA 3LCVB 4RWZA 5EIFA 1SQFA 3OE4A 1IY9A 2VP3A 4HC4A 4QPNA 1G6Q1 1I1NA 3HCCA 5FCDA 5KS2A 2CL5A 3OU7A 5GIOE 1Q0TA 3P9IA 4GUAA 3BUSA 5EPEA 2XVAA 3HEMA 4KW7A 1P39A 2ZLBA 3OE5A 1KP9A 2G71A 4R8SA 1BC5A 3VC2A 2OBFA 3D2LA 3LDGA 1WXWA 4MIKA 4PGGA 3E7PA 3MQ2A 3GRVA 3FUUA 3G5LA 3SSOA 4BP1A 1XDZA 2ZVJA 4M36A 2B25A 4HG2A 4OBXA 4EKIA 3NVKI 1JR4A 1NT2A 1BOOA 1Y8CA 3A7EA 3KR9A 5K0CA 4ATNA 1RJGA 3LKZA 4FSXA 3G2MA 4R6WA 3DLCA 2AOXA 3LHDA 4KDCA 1JTFA 1ZKDA 1RI1A 2ONYA 3LCUA 3SR4A 4DF3A 2EX4A 3AXTA 3SSNA 2XVMA 3LECA 4HGZA 3GCZA 4FS8A 2G8NA 1L3IA 4RTOA 1KYZA 3BGIA 5E8RA 5DM2A 3FTDA 4BLUA 1R74A 5CCBA 3G5TA 5E9JA 3M33A 1QZZA 3MB5A 1R8YA 2UZ4A 2PXXA 2ZWVA 5FQOA 4FT2A 3TKYA 5KQSA 4A6DA 1JQ3A 2EG5A 2PWPA 2NP7A 3PFHA 3PX2A 5P8WA 4C4AA 1V39A 2PY6A 3PFGA 2C7PA 1NW7A 2IH2A 3GGDA 3MGGA 2JHAA 4M38A 1YZHA 5EIWA 1QANA 2PX8A 1MHTA 2JG3A 1R18A 3ME5A 3VC1A 4RTNA 2H00A 3NJRA 2O0LA 1WS6A 3EMDA 3FPEA 3IV6A 2ZBQA 2ZWAA 3IEIA 3KR0A 4HRAA 4PWYA 5DM0A 4AX8A 2AVNA 4HSGA 4PIMA 2K4MA 1VPTA 3DXXA 3X0DA 3P2IA 4JXJA 4GF5A 4GOND 3EVZA 3B3JA 1YUBA 3BXOA 3KQTA 4IV0A 5K0NA 4YUYA 3ORHA 3Q87B 5F2OA 3TMAA 3KHKA 2Z6AA 2IBTA 4E70A 3MHTA 3KQPA 4NECA 4RTLA 4MHTA 3M6XA 1KXZA 1AV6A 1R6AA 4RTRA 2I6GA 3E8SA 3TOSA 3DR5A 3BKXA 1RI3A 4F84A 3GO4A 2YVLA 3CGGA 1AF7A 3B3FA 3EMBA 3P9NA 2B78A 3A4TA 4C07A 2ZSUA 5FADA 2AVDA 2F8LA 2P3QA 2QM3A 2YR0A 4EVIA 1JTEA 4PONA 4RTKA 5EMJA 3REOA 4BY9E 1SUSA 2ZW9A 4X1OA 2HNKA 5D1NA 1DL5A 3NDJA 2PJDA 5EMLA 3MAGA 1QAMA 5C0OE 1VP3A 4RSRA 5KYGA 2NXEA 1QAOA 3HA7A 4CTKA 5CCXA 3SVZA 5EGSA 3V8VA 2HV9A 5DTQA 5E1BA 4QDKA 4XUDA 3V97A 2AR0A 3G2PA
chains in the Genus database with same CATH superfamily
4UMDA 2P2GA 2NNLD 4H7DA 4UEOA 2BZGA 4PIVA 2PUGA 1O8BA 5B0AA 2Q8PA 2XUKA 1GZ7A 1IJEB 2XVXA 4KYIB 2BI7A 2IU4A 3WRVA 4CRJA 4BP8A 5D0EA 1AU9A 4CTOA 2B20A 2FFQA 5JD6A 4USHA 4B3GA 3RC1A 2DPJA 4L08A 4NAUA 2XO7A 1N48A 2GAOA 1E2GA 5EHNA 2B4AA 1S1WB 1KQKA 1V11A 3L49A 4LF7F 5CIYA 1XRSB 2IHYA 2AC4A 1MD9A 4RXMA 4WNAA 5KMGB 2ZRLA 3IRXB 4CMAA 3OTHA 4RXUA 4KAAA 3LC1O 4IYRA 3O82A 3O73A 4KVGA 2GF2A 1UL3A 3OTDA 4IOBA 2YOHA 4USKA 4FVMA 3B9PA 4DM3A 2XAAA 4JLWA 2DXEA 3FUVA 4BYMA 3QKSA 4B3MB 4Q82A 1H66A 1ZM3A 1OV6A 3MMAA 4D25A 4EGAA 2HX1A 2PXAA 3SIRA 1BQ4A 5A6SB 4QUIA 1T9HA 3TSWA 1I4OA 1WPRA 4YO8A 4O2BF 4B82A 1CFZA 3VVUA 1H23A 1RBQA 4EZIA 3L4BC 4EHHA 1LI4A 1JWWA 1UMCA 4OQEA 3WKDA 4DBQA 2REQA 5AVTA 5IDVA 3VV2A 5JZBA 4ZC8A 3ZTYA 2YWEA 2Q9CA 2HVHA 4MULA 2HMYB 2RIPA 2PMZD 2IVFA 3ZCXA 2GAJA 3OD1A 3HGTA 2XT0A 4CG1A 2W6NA 1NW4A 3B9QA 2DGTA 4DU8A 4H7HA 1XO1A 3QWPA 2F3SA 1K1EA 2GHQA 2O06A 5I8ZA 3L7OA 2B51A 1EG7A 2P91A 3NQ41 1H1TA 4MWEA 1RPJA 2PSJA 3RNLA 3EIWA 4FEAA 4LRSB 4Y1GA 1E96A 4UOGA 3ULKA 3DBRB 2VG7A 3D3WB 2J4DA 3RFUA 4LE1A 2AA3A 1UK8A 1YVUA 1K4YA 1NSKL 4UHHA 4FFMA 4B74A 1OU0A 4DTIA 2HTEA 3O5TB 2O2DA 4BX8A 1MO3A 3HR4A 1FS4A 1HW8A 4WKRA 5EP4A 3OL7A 1DPFA 5M2UA 1D9XA 3TVTA 3QU4A 3PFCA 4WK2B 4JI4B 3Q2SC 2FN3A 2J0WA 3OJWA 3NT4A 3T1HB 5ARBA 2O5EA 1WM1A 3WX8A 4A8JC 3THYB 2CK3D 2GVNA 1U0FA 2IITA 3QP9A 1C8KA 4HHUA 4I1SA 1KH1A 3DMHA 3S8SA 2ZH2A 2ID7A 3MM5A 2B8PA 4JV5J 3KAQA 1OAOA 1EXWA 3PHJA 1NKCA 2HJHA 3IBFA 1G5QA 4LMAA 1WOMA 2KLBA 1JHAA 4U02A 2NYUA 2ANBA 1PBAA 1FI4A 1FD2A 3C39A 1HBUB 4QARA 2ZYRA 4PR3A 3PJFA 4JI1J 3CRMA 3LIIA 1SCNE 3VR3A 3VU8A 5IVIA 3K5PA 2ZUVA 4G0NA 2AMJA 3LDFA 4YJGB 4IILA 1IUNA 4RZRA 5K0ZA 3A05A 1WC1A 4CQNA 5AJYA 4ANCA 2WP0A 4CPDA 2J07A 2RKBA 3IR5B 3C41J 3D1VA 2QN9A 1I4WA 1EIWA 3E0QA 3SDZA 4CDNA 4O3PA 1GGEA 4D4GA 4IRUB 2M32A 1ZPVA 2YINC 3RQIA 2XA9A 3MTEA 3EA4A 2YWXA 2OZLB 2I33A 1I1NA 1WMAA 1LRJA 1DT5A 1G2EA 3LK6A 1QRSA 4U0KA 2FJ0A 3K1ZA 4DQQA 4GWGA 4OV6A 1FDIA 2JZNA 3FSXA 4QT0A 2COLA 4PLCA 1H2TZ 2TYSB 3P5BA 4WIQA 3V34A 2VG5B 1SVLA 4RHUA 4NI2A 2G0AA 3REGA 1DKNA 1KEKA 1Z7EA 1M1NA 5AP9A 1ONBA 3S99A 2XE4A 2J67A 3BN3A 4ED9A 3OZ7A 3VR5A 3LP0B 2ZUFA 3SVTA 1VJCA 1VLYA 4YAFA 2BP7A 2ORIA 3C3CA 3OT5A 1F8XA 3H4MA 3V7WA 1XVLA 4BO1A 1RI3A 1I1HA 3SJUA 2X0NA 5DYTA 1EP2B 3P9NA 4PZAA 5FI3A 1N8RT 3GP9A 4MGIR 2AJDA 1XNRJ 3NOOA 4M1EA 4C01A 3K0HA 1BQXA 4V03A 5KYGA 2JAUA 2Q62A 3HA7A 2XKBA 3O2IA 5CCXA 3NL0A 1FO1A 4FDAA 4X97A 3A3NA 2QAGC 4DQLA 1GGHA 2NZXA 4B0PA 5HM8A 1QRUA 2WI8A 4KH0A 3QUSA 3P19A 1CCWA 3G1WA 3Q4GA 3P9KA 4AY2A 2G1HA 4J9PA 4RTQA 1HM5A 5CDYA 3WRYC 4MVJI 4NZPA 1Y1TA 2IUTA 2O52A 2B0GA 2IZOA 3RBZA 1O95D 1DAPA 3TUZC 1E4OA 5FOVA 4AN4A 1E1KA 4NOHA 3NYRA 4CKCB 1KYQA 3ZIAD 1Q22A 4FJ1A 2OIHA 3W6ZA 1E98A 4GR4A 3RTEA 4YCLA 1BFKA 1H2BA 1BE0A 3KZ1E 1DLOA 4YREA 1SC3B 2CQCA 3WXBA 2R42A 3ZNNA 4KK4A 2YWCA 5K0SA 3WNBA 3B6BA 3K15A 3AFOA 1HLWA 4UW9A 5J43A 3D9QX 4A0FA 1Q0UA 2AL7A 3EXFA 3UWPA 5A4KA 1OSCA 5CU7A 4USWA 1IWPB 4EB8A 4E31A 3JSRA 2Z1NA 1YS2X 1ORIA 1ZX1A 2K2QB 3EYWA 2QV7A 4ER8A 4WKBA 2ZNZA 3GZJA 1WZCA 5E3JA 4ZEXA 2GIQA 3A3KA 1UFKA 5DCWA 3VA7A 3OCXA 2FWAA 1AY0A 3T06B 1G1XA 2NZUG 1PGOA 3H5SA 1MAUA 1CC8A 2X2EA 1E89A 1HWKA 4EYHB 2ZRMA 2IOFA 1XAIA 5KOHB 5DGCA 4NAVA 2RKWA 3I9V1 3N9UC 2ZC4A 1CC7A 1DXHA 4A8OA 4FQ7A 3O90A 2EEYA 1UJBA 3BT7A 4JT8A 2X22A 3CNBA 1A6LA 2GXUA 3FGNA 4MUJA 2BZSA 3W3AA 3VI3B 5LQJA 3HUTA 3NNAA 2Z5FA 4YQEA 4W9NC 4F12A 5AVVA 1LTHR 4TRMA 2QJFA 4RPHA 1G17A 5JZMA 1MQSA 1Q0QA 2FPLA 3OLZA 4XUEA 4HAOA 2V2KA 1Q0ZA 2LECA 1VHQA 2H65A 1TYBE 4V0SA 3GHYA 2W1BA 3HB5X 5KFUA 1DXOA 3KLGA 4YVFA 2GEDA 2VNIA 3T7TA 4IIJA 5CXTA 2HF8A 4WECA 4ZPJA 1HUQA 3CW2A 4DCUA 3JZDA 2OCAA 1Z47A 1STOA 1VQ9S 2ZPTX 1U80A 3DE0X 4PQAA 3UN1A 5EIAA 2R7KA 5FOUA 4QPDA 4PLVA 2QV0A 1X3SA 3C3YA 1U7ZA 5KFGA 2O1XA 2V4UA 1XRQA 4YCBA 4HQFA 1HNZB 3CS3A 2RBKA 4P4NA 2JDIA 3GLTA 3JQ8B 1YR6A 4TLLB 3T3GA 1M0SA 3RT7A 3UANA 4C2AA 4P0TA 3JAMY 1VCMA 2O2HA 1MC5A 1RXVA 4G86A 3SCKE 2R1TB 3KOUA 2PPLA 3K0FA 1HBMB 3F67A 5BT8A 5F5LA 2PMDA 5CXUA 1NBMA 4EA8A 4FYHA 4WU2A 1NXOA 4C0LA 2A0KA 4CIDA 2QPOA 3QO9A 3MM9A 4KFTA 4M94A 1IULA 4IDAA 3M4NA 2ZAYA 1X9HA 3LOUA 1NVFA 5TPZD 2OILA 2FMUA 2OVFA 3O4RA 3QLVA 3GP3A 4C6TB 1FX4A 2RJNA 4ER0A 4RYDA 1XJ0A 3WIOA 2OMLA 4DIOA 4Z5XA 2QMUA 3T34A 2BJDA 3SC6A 3DW3X 4NHOA 1U11A 3IKLA 4IG0B 3L7MA 3BXXA 1FJGF 2XEDA 5AJ3F 1GNQA 3R6TA 2YKGA 2DH8A 3R1HA 1T2VA 4RK4A 2DLDA 4P3PA 3H05A 2A6PA 3IXQA 1M34A 4NMWA 3KB6A 2F2TA 4DR1F 5ENZA 4LF2A 2G28A 1UVKA 2VHJA 4J4TA 4ESEA 1E0SA 3ILVA 4BWGA 2BTQB 1QH9A 4HMOA 1QPZA 1Y7HA 1NVVR 3JAKB 5I5GA 1KHTA 4Y9TA 3UH1A 3M8PB 2WTNA 5BSEA 3T4XA 3BJYA 5KQSA 1YKGA 2QE7D 1RD4A 3V9PA 3LAKA 4MYUA 4AO7A 1CRLA 2NVOA 1O95C 4MI9A 4O1IA 1X3LA 1QRTA 2BMDA 3CN9A 4K4YA 1GM5A 4DBLC 5EJ7A 2X5JO 4C22A 4YI3A 1R3UA 3H9EO 3V9AA 3MM4A 4CU2A 1AKUA 5KOJA 2E5FA 1SJFA 1F1JA 4RSRA 4HNTA 3UFXA 4L3NA 3T7AA 2G1JA 2QENA 4IDEA 5L51A 4JLBA 1FU8A 4BGIA 3AA9A 1DBVO 1E2BA 1XMQJ 3GLKA 2CXEA 3W4JA 5GONF 5IP5A 3SFGA 4KFBB 5AQEA 3DLBA 2VEOA 4K6KA 1S1XA 2OFOA 4L9AA 5J2TF 4A8MP 5TXGA 3EZ2A 3PXUA 5CQGA 2BKXA 3IMKA 3HO1A 1JLEB 5BSFA 1Y81A 3RU2A 4ER5A 4JKIA 1BS2A 3PFBA 4M1YA 1SFRA 4NX9A 3UD5A 3V81B 2ZI6A 2R68A 4WXPA 3CUEF 4OLHA 5JANA 1JMVA 3FEXB 1U0JA 3KNGA 5KOWA 2YDYA 2VP5A 1NVMB 4XDYA 4B3JA 5IM4A 1TFRA 3U3ZA 2GM3A 3C6MA 1CHDA 3ELUA 3QJPA 4UHCA 1JQBA 3MPWA 4GU5A 5JSFA 1AN0A 1Q92A 4NDZA 1L1EA 1T6NA 2P0EA 4GPIB 3LZCA 3PUZA 2X2PA 1VDMA 2C5HA 1Y1LA 2QI9F 3N4WA 1TIKA 4HEA9 4OXQA 4TTAA 3K5MA 1QAJA 4GWLA 4D4KA 1N4DA 2QSYA 4N6GA 3TQHA 5BSRA 4DV2J 1YS4A 3W1WA 1HY3A 3TMKA 2VASA 4KO1S 5JMTA 3QT6A 2IS6A 5EPUA 3IBYA 5ILQA 3JRWA 1I2MA 1VL6A 2TECE 3WGMA 4CFSA 4PPGA 2GLTA 2QX7A 3JWEA 1FBTA 2GJ9A 2BIFA 3VSBA 1PYTA 1YUNA 1AFJA 3IKVA 4TMWA 1U3GA 3H5OA 2P41A 4UHJA 5NULA 5FL3A 1L3KA 2WT9A 3W34A 5AKKA 1P6TA 1JX6A 4IDCA 4PZ9A 1XL0A 4CTMA 3UKJA 4PYNA 3I2KA 4G1MB 1VFNA 1PD0A 3CSDA 3LY9A 3FSRA 3IELA 5CBPB 3I58A 1SCKA 2J0UA 1BFDA 3FJ1A 4YUXA 2IOYA 5CEJA 5B36A 1UFRA 2N47A 5E3IA 3H9BA 2O2SA 1PDVA 1VECA 2H2WA 3ONDA 4LPKA 4MCJA 1VBNA 1P9NA 4YI5A 5DJBA 3CUWA 1Z15A 1WCIB 3VR5H 3UW1A 5E95A 2H1WA 3M1LA 1UBSB 4PGHA 3VM6A 4ITUA 2QLTA 4EA9A 2XZTB 3ND5A 1LTKA 4P73A 3EEBA 1YZ6A 3E3OA 4P7GA 4DY6A 1DKLA 3CE6A 4NSNA 5CYPA 4TTJA 2W9BA 3HY3A 1XI2A 4O4JB 3SWWA 5A4DA 1W25A 3TR5A 3M1YA 1YZLA 4HT7A 1JB9A 2KT3A 3CF5Q 1KFJB 3C3BA 4CTAA 3VAAA 2B99A 1ECFA 3J81k 2WUDA 2ZIFA 1J22A 3PSHA 2QGZA 1K8YB 2W2QP 3LNCA 5C3UA 2I4OA 3N05A 2OXRA 1P6QA 1U8UA 4C76A 1G5HA 1J7KA 1H98A 1B0PA 2OAQ1 3AEYA 3MTGA 3GNTA 1KY2A 3OQ1A 3K9WA 3D4IA 4EB6B 3IGNA 4HGYA 1II8B 3S7TA 3HXQA 1P29A 4ZVMA 1F2VA 4BB6A 3T61A 2I1WA 3BL5A 2EFGA 1C1DB 1EXNA 1NVTA 3PFEA 4E30A 5AM0A 2YNGA 2I6TA 3RJTA 1G1MA 4UC0A 1QLJA 1H2ZA 1RHRA 2FLNA 4WKCA 1NXVA 1SNYA 4RWEA 1R4MB 2EP7A 1GL7A 3LX8A 3GT3A 3WHLA 2BOPA 1CF9A 1KQGA 3IQFA 4H7IA 3BCRA 2HHAA 1CJKB 2CYCA 1L5YA 1O94D 8ABPA 1XYYA 2WYUA 2SCUB 1IYZA 3P32A 3ASZA 1WXHA 1DTQB 4B3RJ 2G2YA 2QROA 3E9MA 1G18A 4E8UA 1TQLA 2ZBQA 2IC3B 3TLKA 3S2SA 2XUAA 3GIMA 4H3HB 4INPA 1VPTA 4USJC 4DX7A 1K86A 2PV7A 1U26A 1TO6A 3DM9B 1U98A 1V35A 4ZITA 1I4EB 4K46A 2PU5A 3HCXA 4JI8J 3J7AC 1IHYA 1CBUA 5IOLA 4XCQA 3R0VA 4BYGA 4GMKA 5C0OE 1GCIA 3HD1A 3U1MA 1WE2A 1Y10A 2XTAA 1G8JA 3UMBA 2BANA 4O4LF 2Y1XA 5HKAA 4E94A 3ZEIA 1W26A 4B6EA 4FWIB 1GXSB 4AY4A 1RU1A 3W9JA 1C7JA 3CPHA 3S2UA 1WF2A 1EVKA 2W0MA 1V5GA 1EXMA 3DKIA 4L07A 3SC2A 1WY7A 1CNFA 2AYYA 2HHWA 4IF6A 2W6JD 3I1FA 2DFPA 4RX1A 5ED0A 1IN8A 1NVWQ 5AUOB 2X2OA 1UVMA 5IXSA 2AGQA 1VJQA 3W5UA 3QJGA 2XVYA 4CRWB 2E5JA 2CYBA 4MKGA 3BA6A 5KWVA 2GO8A 1NM5C 1CUXA 5E1MA 4DC1A 1ECPA 3CTPA 3KKKA 3MQFA 3QBJA 2KM8C 1CUSA 1QO9A 5J1SB 1E1CB 4ILKA 4LF5F 1COZA 2PX2A 3OIFA 3GRZA 4FPRA 4BBAA 1JKFA 2I65A 2YYYA 3LU1A 1J09A 2E6UX 2ALYB 3A9VA 2WTFA 1ECLA 4V3BA 4B31A 3VO9A 4M5DB 2E1CA 2PRZA 2E1MC 1PT7A 5K4AA 5CDHA 3PKYA 3EIOA 4EYGA 3BL8A 4XTTA 4MNTA 5CG1A 3HKWA 1RWXB 1NMSA 3IPLA 5KFLA 5BW5A 2PLFA 4DB2A 4A7PA 4RHEA 1FVHA 1JLBA 4DIKA 2C8VA 1V8ZA 2C2NA 2V3WA 2HSEA 3MRXA 3Q40A 2EJCA 1HQYE 5CCEA 3ZY5A 3DEZA 4KNWA 5IAJA 5HF9A 5DW0A 3AI2A 1HBNB 4FXDA 5HDBB 3UBMA 1OFUX 4HFNA 2LEBA 1B4DA 4NU6A 3ZBPA 4BB0A 2KQUA 1CUVA 2HBYB 2QUHA 3G2LA 3U02A 2DNPA 4Y98A 4EGJA 1K75A 3ZG6A 5AI5A 5E2BA 3E51A 4OX9F 3E15A 2GEUA 4QC2A 3S40A 4CT9A 1KNXA 2HGMA 4QCLA 1KOHA 4O3OA 4UKDA 1NRWA 3WBBA 1PT8A 1SUPA 2OGSA 1U24A 4RGBA 2CUYA 1LU9A 2XMWA 3A10A 1Y4ZB 3NT2A 3T15A 2ZC3A 4MS3A 1N0HA 1N2IA 3WMXA 2YJTD 4DARA 4KO3S 4DT1A 3JWHA 4GC5A 1NXTA 1GG9A 3OPNA 4COKA 3BOSA 1K9VF 3TEGA 3NHWA 1CJTC 1D9AA 2BJ9A 2HGNA 2Q8NA 3L8ZA 3PWZA 1PLKA 1QZXA 3VUEA 1KEUA 3C2PA 4C3LA 2VDRB 4IDBA 2QL6A 5G0RB 3IBTA 3N59A 5HIAA 1OREA 2GOYA 4OPMA 4F5EA 8AT1B 1Z88A 3CCWA 3LW5C 4P83A 5KVQA 2DH7A 4HOYA 1T4BA 3AUAA 5IYZB 2B4VA 4ZOLA 2J6SA 1LQUA 3TUJC 2O5RA 3SF8A 4ZN3A 5E5NA 3USZA 4WXOA 2GEVA 1RBYA 1NW5A 4M5JA 4DG9A 2AN1A 1W1UA 2XYVA 1XAJA 4D9IA 3TIGA 2EKYA 2W11A 2CV1A 2G8LA 2E9SA 4RW8A 1AXGA 2OP5A 2AHOA 2BT4A 4ETZA 4PO3X 3M8QA 3MMCB 3IIEA 2C97A 3SX0A 2XMCA 2Z57A 3N5FA 5D3MB 1UFWA 3BREA 2Q99A 4UCWA 2NU8B 3DDKA 3O6VA 3UZUA 3R5HA 3BB4A 2VF5X 4YFYA 1WC0A 4L6V3 5LMZA 3TE7A 1W88B 1ZCJA 1V37A 2PHZA 3W3SA 4QHSA 1YA6A 4GUAA 5E38A 4NFLA 1PGQA 2PO7A 1L7XA 3ZWMA 4IH5A 4BZPA 1S2OA 3W05A 3RRMA 3NTOA 3B2NA 4KDCA 4DF3A 4I14A 1ELOA 2F43A 5HDQA 4BU1A 4XXHA 3HWX1 3DNCA 3C5EA 1WUUA 2OBNA 3DC7A 2FDNA 1VRWA 1R0WA 3UT6A 2HK8A 4HZGA 3D0RA 3Q89A 2B7CA 2C88A 1NE7A 2CY0A 4OYLA 4P4GA 1DIHA 4Y9DA 1UOOA 3VAGA 1MSWD 3VWSA 4PIMA 4CH0S 2ZS8A 5IT9U 4BRSA 5JNRA 3NATA 1FP6A 4MS1B 1CKEA 4I56A 2BFEA 4ECTA 1NY6A 1M72A 2PO5A 1D2AA 1XT6A 1SH3A 5LSOA 4OAOA 1DJ0A 1O5OA 1DV1A 3H2UB 1GEEA 4BFVA 4ZVQB 1PX0A 2J9XB 1ZQ1A 3ZXXA 3AW8A 3VDXA 1Z39A 3ONWA 4UMFA 4F11A 3I3OA 1O6ZA 4JX8A 4ROSA 3A3PB 2XMJA 1NMZA 1WZNA 3CEPB 2H4WA 1R00A 4FHCA 4QQKA 3R8CA 1YZ3A 1KK2A 4ASUA 4MYHA 3PGVA 2DRDA 1WI6A 2AI1A 3JSBA 2VPZB 2ODTX 3NIWA 4WKOA 2O48X 4M0UA 1PF7E 5TS2A 2WWHA 1E3LA 3SSMA 3WYGA 1UAWA 2B1JA 1SU4A 1A7GE 3O92A 5A7GA 3CLHA 1C9KA 2CMHA 2IGBA 4C21A 2Y0PA 3PFWO 3BDEA 1ENZA 5GWXA 4RHCA 4JI3J 3RJMA 3KLVA 2ZB4A 1B4SA 4QRIA 1ZPDA 2XSZA 3DLKB 5ERGB 3EAQA 1MC8A 4OB8A 1V16A 4YAKA 3OW2R 3CRZA 1OO0B 3K7RA 4UJ3A 1FEHA 1VGQA 1IBLB 1XZDA 4M3NA 3D7MA 3WADA 5CD4A 4NNOA 5LT5A 2J3JA 1MFZA 4R1NA 3UT5B 3I9V6 3V1TC 2ZAGA 3DR3A 1JIIA 2IM1A 3R6LB 1QTIA 4I36A 2VICA 2W58A 1R3DA 4R98A 1BDHA 5ER6A 4ZVTB 1EGAA 4WXWA 2WVAA 2CNOB 3ZDEA 2ZI3A 3FTFA 4ZI7F 1P1BA 4WY8A 1ZLYA 2VYVD 2OB1A 2QRVA 4URYR 3W5CA 1YZUA 1AQUA 3KK0A 4B6RA 4FYWA 5DBOA 2FJVA 2Z2YA 1GRNA 1VC2A 1KR4A 3Q7EA 3NCPA 4NE2A 1XQ1A 1ZYQA 2HFUA 5M7EA 4CR7A 4R5PA 2FPOA 1T1RA 5IV3A 3G59A 1EHYA 2JCYA 1IHUA 5ALOA 1V1RA 4NFHA 3J7YI 1JJIA 2RILA 4UEWA 4JB8B 1SUDA 2QMQA 2ZVSA 2Q0XA 5A3RA 1WW3A 4M0LA 3TR6A 2GQQA 2J6CA 3L3BA 5SYAA 2X1VA 2KXFA 2V9PA 4ZXFA 1DPGA 1QO0A 3LVRE 3LNTA 5DTRA 2DH9A 2VQ3A 4WK6A 4JENA 2ZIGA 5JD5A 3QNWB 2HLHA 3LVFO 3FCSB 3GEHA 4BC7A 3HY4A 4UHFA 1HKUA 4C2BA 4D44A 4FFVA 2Y2UA 1F2HA 3Q5DA 1YZKA 3T1YF 4BKRA 2W8ZA 4MV9A 1H2YA 3ENAA 1H8HA 3RTBA 4CM7A 5DS7A 4F4XA 1LWEB 1A96A 5JS7A 3TVDA 1QQ5A 5CA5A 4LF4J 4FYXB 2J3MA 5AI4A 3OD2A 1J8MF 2G9OA 2YFYA 2HRRA 2DFDA 3OPMA 4UHDA 3A13A 2Q9UA 3VGPA 3MRTA 3TUPA 3FVRA 5EZYA 3GFGA 4B71A 1U0LA 3VQSA 4YP1A 4M5GA 1UAGA 1EVEA 3TD6A 1M2EA 2KTQA 3CPEA 1FYWA 1XB2A 2ZZMA 4LV8B 4LEIA 1IKXA 3FSIA 1T95A 4TWZA 3KZXA 4RDXA 5SY6A 5D8HB 1Q1ZA 4A8HA 2V6AA 3U1NA 3IAHA 3PNPA 4OH1A 3EULA 3KXDA 1RHUA 2HT6A 2J85A 2CVPA 3LI2A 4L0QA 4KR3A 2R7VA 4QEZA 4E2WA 1N6OA 2AYXA 2HCBA 1A9OA 4IINA 1JJFA 4GX2A 2QL7B 3DOJA 4DCGA 1PC4A 1KEEB 2C4TA 4W4TA 3PTLA 3R8FA 3CF6R 4Q6BA 1PYDA 3QT5A 3UJDA 4I4TB 2IKQA 3WTBA 5CB8A 1Y5RA 4NCGB 3HB4X 4G24A 4QDZA 5HX7A 2UP1A 2GVZB 2UV8A 4MIYA 2QLBB 3A6JA 4EMUA 3LE8A 3MMBB 1RYDA 3HH8A 5J2NA 3G5LA 4QXMA 4GDMA 3KR9A 3FZYA 3RFFA 2ZRFA 4UCFA 4MS4B 3SSQA 5DH9A 4ZLJA 2VA8A 3OSPA 4IW3B 4HDGA 3DL2A 2YY3A 1U8XX 4DR7J 2BEUA 2BCJQ 1Z29A 2JC0A 1V41E 1JLAA 5DNYB 1CQJA 1I5OB 2Q3FA 5KT5A 5H68A 1RMTA 3L6BA 5H59A 4DPXA 1GZ3A 5F9FA 4KE9A 4CMEC 1AA1B 1ZIYA 1W5FA 3ORHA 3L5OA 1JQKA 2XZOA 4LFBB 4KX3A 4C2TA 1FMJA 1Y8QB 4ENPA 1FQOA 4DV6F 1GAQA 4UMEA 1JU4A 3R6GB 3WNCA 4X62J 3UHOA 3SM3A 1U3CA 2PA8D 1C0PA 3ABZA 3U4GA 1GPMA 3FOCA 1XCMA 2BJ1A 3IAXA 5ETTA 4M0PA 3I5BA 3FKSD 3TRGA 3WL3A 1JT2A 3AINA 1MIOB 1UXIA 1YONA 3CHYA 3EDRA 4TLDA 1G8HA 2C5BA 4URFA 3GJTA 3I72A 4Q1EA 3ZDAA 4V38A 3DE5X 3L93A 2X3GA 2Z30B 1Y48E 3K9BA 4G4JA 1THTA 2VC0A 3T3FA 3C5CA 3OEHA 4DBZA 1TUBB 2XY6A 2POKA 3MLEA 2GH1A 3FRZA 1OZFA 3CX3A 2AMCB 4O44B 3MD3A 3Q0EA 1CT9A 2OSVA 2AOUA 3MBOA 5H3LA 3M30B 3OMLA 3JQ9C 4IV5A 1KVKA 1T43A 3BL6A 5DBGA 3QAUA 4ZAVA 2X4DA 1E1QD 2XTNA 4NG5A 1GAWA 4YUWA 1N33F 4N40A 3ONNA 2Z3VA 4C4SA 3O38A 1JEDA 1G2PA 3NMAA 4OUDB 2RGCA 4GS5A 3WS7A 5EUCA 4LRXA 1ICEA 1KERA 3HB9A 4U7DA 4KSCA 3C14A 2H1SA 2R6JA 4M1ZA 3QFWA 5AICA 2XCIA 5JWOA 4EG5A 4MUNA 3FWYA 2C77A 2QIPA 4JR2A 4DV7B 1MX9A 4GI7A 3WGOA 5HLFA 2XT6A 4B44A 3HHLA 1QNLA 4TXLA 5CA0F 1R4NB 5DMXA 1G8AA 2ODEA 3R5GA 3GFBA 3BK2A 1FDSA 2KYRA 2NYHA 2IU3A 4UUNA 2ROPA 2IUSA 2P4EA 2VOOA 1R5NA 4G0VA 5HAOA 4JLDA 2QE6A 1P8JA 1BQNB 4B3SB 5EMMA 5HNKA 4D3XA 4DWOA 2CCKA 3I53A 2Q3DA 1PZXA 4FX2A 4H4MA 5K0LA 4DJBA 2Y0BB 2ODBA 1HLDA 1DQAA 8ATCA 4EFNA 1A7UA 1GYPA 3NCQA 5B1SA 4PABA 4NZYA 1V6SA 3EPIA 1ICIA 4RUAA 1YTUA 4E5DA 1U7UA 2HSJA 3P4UA 3QLUA 5HBRA 4TTQA 2MQPA 4PZLA 2Q5EA 2PGIA 4YYEA 4C48A 4QPCA 2BEWA 3MZ0A 3WNVA 1VBKA 3D5TA 3U48A 4EI7A 4DUTA 4U6NA 1RQ2A 1A76A 4KWCA 2ZPAA 4MR9B 3JWJA 5JJLA 3ZW8A 5AIBA 3P26A 2RU9A 3IAM9 4RPKA 4CQMD 3KPUA 1M90T 3AHPA 3DT9A 3GYGA 2Q4EA 4YB8A 5CVDA 4G8DA 2BBTA 4DV0J 1YL7A 4Y18A 1UBHS 4V1CA 1BHO1 3GRRA 2W2PP 2XYPA 4F04B 2VUSA 4B4OA 1KP3A 1AGXA 3NBPB 3T5TA 1DLIA 1V5EA 3B9BA 2EW8A 1BGXT 3AFHA 1EUDB 3OQJA 4TTTS 3DMJA 1LTQA 4N8OA 3T7CA 3DFUA 3ZE6A 2JEIA 2KZZA 4MWBA 1GSOA 3F44A 2E9RX 2UUAF 1J49A 5KAPA 1IZ8A 4GX0A 4H16A 4PCVA 2ECKA 1S4MA 2RGEA 4QUHA 4COOA 1MU0A 3FBCA 1V3SA 4J9SA 2XQGA 3H2YA 4LYJA 2FPMA 1TE2A 1GXUA 4RHFA 1TA0A 1IOLA 3BYZA 4FP9A 3WGNA 4FYVA 4CIWA 4QGAA 4MRRA 5MAOA 1XN1A 4RPCA 1GKUB 2DJWA 3ZZUA 4MSUA 4USVA 3UWSA 4ML3A 4RKEA 1NOIA 3ZCVA 4R8SA 3MOJB 1R10A 2HDOA 4EWLA 4MGKR 3B1VA 4Y2CA 1XE3A 5LWHA 3LFUA 4JL5A 2HA7A 1KOJA 4GKKB 3MELA 5CD4H 1AZWA 4H7KA 1N5QA 1KJQA 3TKYA 2OHHA 1I4TD 4DR4B 1ZMXA 3CZPA 1Z4PX 1E9DA 1C7FA 3EC1A 4HQ0A 3VPCA 3KEQA 2JZOA 1QX4A 3WXMA 1HBOA 1HDEA 2JHGA 3OFND 3SS8A 1KBRA 5F1OA 3ECSA 4DZTA 4ALLA 5A04A 4EAAA 2XXJA 5C1DA 2MYNA 4QU5A 3U44B 4J0KA 4PSDA 5H1YA 4X3OA 3QIVA 3WQHA 3M4YA 3Q0IA 3TVZA 2FC9A 2C7BA 4CIVA 4NICA 5HMMA 3O8NA 4FHDA 1ODTC 1GUBA 3NETA 3QI2A 1Z06A 1ZGZA 3KNAA 4Y28C 3HLYA 3N0RA 5FUMA 2ZDGA 4R3UC 3GHHA 1IDOA 3ZTQA 1Y4SA 3BHMA 3IILA 1EP1B 3Q3JB 1X7ZB 2LKDA 2ZTHA 1JZSA 4JP5A 4BLVA 5DRYA 4KBYA 3HSSA 5CYQB 3ZZNA 4BNMA 1HEYA 2NOAA 3FMPB 5FA8A 5C5EA 4QXQA 1WORA 2ISSD 3WOVA 5LIRA 5IKMA 4OIMA 2J7KA 3QAEA 5A7HA 1RI7A 2JANA 5KX5A 5JPDA 4OYRA 3FH0A 2C83A 2LU2A 4Q9IA 2XQKA 4XQGA 4XIFA 1F6DA 4P1ZA 2GNKA 2W6ZA 3I2YX 4AJKA 1E94E 3UTCA 2DKFA 3V4OA 5IEBA 1UA1A 1OQAA 3WFZA 5IULC 1H6CA 1M2NA 2B6NA 3DUFB 1JS1X 1NEEA 3ETEA 3LGHA 3DVQX 4PFQA 1Z63A 2ZAMA 4YCSA 1PLLA 4LRWA 5HP1A 1F4VA 4DIFA 2B8WA 3OP1A 2VDUE 2P1DA 5G4KB 4EBEA 3QI7A 4IX9A 4L3OA 3VTIA 4X1IA 2HHTA 1XA0A 3MTBA 3P45A 2RHLA 1QM9A 4WESB 4QJIA 4Z4IA 2L0XA 4MTLA 5L9XA 5DTJA 4REQA 2X0JA 2QU7A 1ZICA 1UF9A 2O23A 4JOQA 3R5JB 2QVLA 2FPSA 2K1RA 1KDZA 2Z6QA 2R60A 4M99A 4M55A 5BNFA 4MMYB 2HB6A 3CNQP 4NEHB 3ROTA 4OGGA 3QWFA 1R6VA 2HS4A 3J81Y 3BQ0A 3WIEA 3AQ4A 5K8UA 4RDCA 1NAHA 2N3LA 1JLGA 3HC7A 5I5EA 1SK8A 2WHEA 3S2EA 4E3WA 4JHXA 4JKOA 4QM7A 1TF2A 2EKDA 3EM1A 2YHUA 3T7SA 2ZUSA 1FJXA 2VR1A 3IESA 4LQ9A 2ZTLA 3EZOA 4YB7A 3OBIA 5HCUA 1WC5A 3AKEA 5CJ2A 2CWKA 5DG9A 1J00A 2PE5A 1WNFA 4TRJA 4HNAB 1YF3A 2DGSA 3NAQA 1P27B 5A3SA 4KK3A 3VC1A 1S9EA 5SZHB 3IWNC 3GJXC 1MWQA 2D5CA 1Z0ZA 3L7BA 5C7IO 1Y1RA 4NJMA 2WU1A 2KH9A 3QRPA 2FSIA 3BIXA 3HSGA 2VAXA 4RU2A 4ERNA 3BAZA 4DQRA 2ZYAA 1MMNA 1T3ZA 5ENVA 1AKQA 3SMZA 1E7YA 4OGLA 3C19A 1NI3A 4TTSA 1NVDA 1G2QA 1B8UA 1KJWA 2M52A 2YJZA 2JVKA 4NPOA 2PRKA 1XZQA 4BNJA 3I5XA 2IJNA 2QORA 3OP4A 3QVSA 2Q6TA 4D9GA 1TL4A 2PCJA 1V9SA 5LM7E 1JVSA 3MAAB 4RIHA 1Z4LA 1RCFA 1AF4A 2YJNA 3QXHA 4PLZA 4PM4A 4PX2A 2WSSA 1IQZA 5DRTA 4FGZA 2HHPA 3L8CA 1SRQA 2GMHA 2ONZA 2M5YA 2HT1A 1SURA 2UYQA 5KJ6A 2IDLA 3FHJA 2JFFA 2FHJA 2XA2A 1ES9A 1UZMA 4KW7A 2AEJA 1L7DA 3MR3A 1K7SN 2BI8A 3BJZA 4IH7A 3MHPA 4HDNB 2B25A 4IWXA 1IVNA 2CKWA 1FC0A 4KTQA 3BULA 3UWMA 1AW0A 3E3XA 3FBBA 1RA6A 1E1NA 2Y6UA 4PS0A 3V00A 3KVRA 1FK9A 2LIPA 2J6IA 3E18A 2O3DA 4G89A 3E53A 2FWPA 4IJKA 4NFSA 4JI6B 1U0SA 3DLTA 4FLEA 3Q7SA 3IKMB 3EXEA 1QIIA 1Y8AA 4Q1FA 2P0AA 1FNBA 3PKZA 1WHVA 2M2IA 3PE4A 3K1AA 4G6ZA 3B1FA 3K8VA 1DWQA 1M83A 1Z45A 1WEZA 1EJBA 3HWWA 2D2EA 2JX2A 3USCS 4KBIA 5CFRA 4J8PA 1YR9A 1RIIA 3N7AA 4L8YA 2YWBA 4UHEA 3R5AA 1QSSA 5FOSA 4LXIA 1M3SA 4FF4A 1IWAA 1U6FA 3C4VA 1F3FA 1IXZA 4GGMX 3IVGA 4ZCQA 4S24A 3KSDO 1RRPA 4S1WA 1TTPB 1NU6A 1QDUB 1T15A 4KC0A 4G1EB 3JQKA 1X4CA 2N42A 4UEQA 3GX1A 4MTCA 5JQGB 4RX6A 1E1LA 4QQBA 1N0WA 3JTEA 2OO5C 5DHFA 4DUYF 1NUAA 1AN9A 4Q39A 1SHJA 1Q6YA 3F2VA 1JLQA 4NPCA 5T67A 1XQWA 4P7JA 1B8OA 2ETXA 4WE1A 5AVUA 3QV2A 4R68A 4AY3A 2NSBA 5JCOA 4TU7A 1Q3TA 1PV1A 1S2DA 5E4YA 2HFKA 3TLZA 2DGUA 4P22A 3GR6A 1WMFA 1JHYA 5EE1A 4MLDA 3MWJA 1G21A 3PYXA 2AB0A 3UWDA 2OZEA 1DAGA 1Q50A 4JD5A 4UVGA 1ZAYA 2IOQA 4JKYA 3PCXA 2SHKA 2ZK7A 1J6UA 1Q1GA 2Z9DA 1A0OA 3B5JA 3CCCA 4ALMA 2XWQA 4IDHA 1IAVA 5FOWA 1T8PA 3UG7A 3PK0A 2CNNB 3DWGA 4FGJA 2CLKB 3KJIA 1E2MA 1KNZA 3H0KA 2NO9A 1CEZA 3ADAC 1I94F 1KAOA 2QVYX 4KH1A 3RS3A 4RE6A 1CJKC 3PCTA 4EHKA 4G0WA 1J4AA 2JGMA 2NM0A 2QA4S 1TM5E 3AHHA 1M54A 1GVNB 5JAPA 4EGCB 5SZIA 1DQNA 1PJ4A 2NXJA 5F2EA 2VTBA 1XN9A 1NDKA 1QHGA 1DRJA 3W2IA 1PG2A 1TK8A 5KNCD 1CR4A 3SYZA 3COVA 2C4KA 2U2FA 3VGVA 4XWYA 1MN6A 2O14A 1M5UA 1NKBA 4A1OA 4A27A 4C0QC 2QYHA 4PTZA 1P3JA 4PGAA 5BR7A 5BNZA 2J3KA 2R62A 1F0KA 1U7WA 1UOQA 2V7QA 5EVJA 4P71A 3TAQA 3MWGA 3UXHA 3JY6A 1ZETA 3OQIA 3RUHA 4KO4S 1RYNA 2Q9BA 2FFHA 2B82A 4RH3A 1EBBA 3POTB 1IBRA 3C3JA 2EBWA 4NZNA 1YJ5A 1RYZA 3ETJA 1EWTA 4JI0B 4US0R 1NNUA 4QTYA 4Y0AA 4ZAYA 2PLAA 4R1OA 4RKFA 1PEYA 4TYMA 4GD3Q 3LC0A 2V7XA 5T7LA 4EUHA 3L7IA 4N65A 3EZFA 2AP6A 3Q0AA 1U2TA 2EGUA 1WSBA 3REQB 3MTKA 4EGQA 1SJ4P 4RJ2A 5FORA 3B82A 1YIDA 2HQIA 3U4DA 2ZIZA 1G63A 1SXJA 1R15A 3U56A 5H9FJ 3JSXA 4CVNA 1TT5A 1QFYA 2HU5A 2GKSA 2ESRA 5JAIA 1J1ZA 3VYTB 4EYOA 4GGPA 5ELXA 3RWMB 5DIFA 2EKZA 3GJSB 2RRNA 2GO9A 2PUEA 6PFKA 2GESA 1JQLB 4JS0A 2ZJ6A 3R7WB 2N1MA 4NWBA 3WZ2A 4JBHA 5LL6P 3KK1A 2QBYB 1RE0A 4LBVA 5LVAA 4P8RA 1GK8A 2QN8A 4ND3A 1WHTA 1EVYA 4G26A 4R9RA 5KVCA 2O8CB 4DYVA 1KKUA 1QYVA 1VLZA 3ZU2A 3V4PB 5B3LA 3IDFA 5DN6A 1LNZA 3GJQA 3R7LA 2YNIA 1TI7A 4PRZA 3ED1A 4OHUA 4KQIA 5LJIA 4AZ3A 2GZOA 4ND1A 4X3CA 2O0HA 5D4OA 4CHTA 4HY3A 3LRTA 4JYAB 1Y9OA 3GROA 2HWXA 2PN1A 4ZHSA 4ZAFA 2IRUA 1XBTA 1PQWA 5HROA 1M2KA 4PKDB 3P27A 2YWGA 3Q7IA 1FRJA 2K7ZA 3IIIA 4GBMA 1JHPA 2HNKA 1UPUA 3NDJA 4FYYA 3HJFA 3DOIA 1SC6A 1GTL1 5M2QA 1HNZJ 3E9RA 4IKEA 2Z4SA 3EH1A 2HN9A 2Q5QA 1AO3A 2Q2OA 1N52B 2B6HA 3OXLA 1U7DA 4DANA 4OYPA 5FNVF 2Y0CA 4XD7D 2IYRA 2VCHA 1B7GO 1YB2A 1HDRA 1W5BA 3QHAA 2INGX 3SHVA 2CXOA 3TLJA 4G0ZA 3ZU5A 4RH0A 1OLSB 4UAGA 5E7QA 3C15A 5DG8A 2NUAA 3G8AA 1WU7A 2WINI 2ZDQA 1FX0A 2BTOA 1P74A 3O8QB 2DGOA 1AM4D 5KDOA 1IG3A 1R6BX 2QRMA 1GPH1 1P75A 4KAJA 1UXJA 2BY4A 3S44A 2Q6KA 3IOYA 3DQZA 4BTEA 3R9XB 4G5XA 2KXHA 4KXFB 1GG5A 5A2GA 2I6FA 3DLEA 3HSKA 3KNZA 5CITA 3QG5A 3J7ZT 1TAUA 4WK4B 1VJRA 3JQFA 1HPZA 1U81A 1RCTE 1XMOF 3BHIA 3R7FA 4JU9A 5DX8A 4OKIA 3DVRX 1NF2A 3P2JA 4RM2A 4YN3B 1Q1BA 1JEYB 1XTIA 1DQZA 2R2AA 4J0FA 4AFNA 4AXIA 3FE2A 3P5TL 4YV0A 2XWBF 3DOCA 4X95A 3KDNA 1U7LA 2H9YA 1FU4A 3E7XA 4JQSA 5DGDA 5BNIA 1JXAA 4OHRA 4GC9A 5BYJA 3MUTP 4UDYX 2PWZA 3DONA 1VSTA 3GIIA 4H3VA 2QSUA 2OV1A 2RHGB 3U3KA 3JASA 1M76A 1J1IA 1JKMA 4Z3DA 2GV1A 3MCZA 4MEJA 5CXXA 4EW6A 4Y1RA 2E87A 3LO8A 1T0IA 4BV2A 4UAUA 2DPXA 1YFJA 1FA9A 1CPYA 3IGFA 3TM4A 2RB5A 3THXB 5FULA 4ZJQA 1S4EA 1ITPA 1B8NA 4OYAA 5DSXA 1P9WA 4O2AB 3G1UA 2B4KA 2CL7X 2JS7A 4ERXA 4C3OB 2P5UA 3OU2A 4HAZA 5GP1A 4WJBA 1YQUA 1N2ZA 4MW9A 3DMFA 2YFHA 2UUWA 4PHTA 2RHOA 1DXQA 3RK0A 2FPUA 4M83A 2IBMA 2MSTA 2ZSHA 1VQ8S 1U2GA 5E9AA 3GVHA 5DYIA 5A05A 2WM2A 1HD1A 1GSHA 5C51B 4EVSA 3ZYZA 4L72A 3C3PA 1KTQA 2HGSA 2NZ2A 3TB6A 4DPOA 4JXXA 5C42B 5DM6Q 1J8DA 1KSJA 3V8QA 4PN3A 3AVOA 4QWMA 1MW9X 1I2DA 5C4MA 2BZ1A 1P91A 2HMUA 1UW9A 2O5DA 3SBDA 1FSSA 3L5KA 2D3UA 3BPSP 1FTRA 4FS1A 3KETA 3UFCX 4M0CA 4GKAA 1Y34E 3Q12A 3LJKA 2CHEA 1QC5B 4LJ8A 3M7IA 1N1MA 2BGLA 4B3CA 6REQB 1NI4A 3ZOKA 3UJAA 2D54A 2GYWA 4UM5A 1ONPA 3Q1KA 5EN4A 2K8GA 1XDBA 4ANEA 4OB6A 2HRYA 1UM8A 4GH5A 5COBA 2OP0A 2HCRA 4JJ8A 1VRVA 3RREA 4IF4A 4LSLB 2HSDA 2QUZA 1L6IA 4TV8B 4IDFA 1OT5A 1ST3A 1EQ0A 2QTVA 4ECZA 3LDGA 4RMIA 4EZ9A 1XJCA 1GTEA 5AXNA 2FNAA 5B53A 2HMTA 3VMMA 3PR3A 3A7EA 3LYUA 3AHIA 3DLCA 4OJNA 1LPAB 1G6KA 4IDKA 4M60A 1N77A 3CNQS 4CKXA 4QOHA 2EIXA 1WTCA 5CCBA 5JRJA 2KRRA 2ZM6F 3UGTA 1YOBA 1NUTA 4ENWA 4ZTZB 2GRAA 1OFGA 4CMKA 3K3PA 4GG1A 2MKHA 3FR7A 3FNGA 4TUYF 3TLMA 5EJ9A 4E4YA 4XWTA 3H5AA 2RGWA 2BJ7A 1I14A 4NDNE 5CHYA 5JARA 1X4GA 4BNDA 4C5CA 3MJ4A 3D1HA 1VLLA 4WLFA 2F8LA 1Z12A 2LQ9A 4BFXA 4QOSA 2DHSA 1W2GA 1MVOA 4KE8A 1HT2E 2IC5A 5EGYA 2VA2A 3BILA 4X4QA 4WP9A 2ZI7A 1GMWD 1PK8A 3DE3X 4J03A 1ZWKA 1UANA 3HVHA 1U5BB 4OVKA 4DEVA 2ERYA 5J2MB 3OJSA 1W4BA 4NHEA 2BMBA 3K59A 3TAMB 2C9DA 1LWFA 1PNOA 2YMPA 2Y9MB 3M89A 2P75A 2QQ0A 3B3QA 4ZYWA 4OFXA 3ZE1B 5GY7A 2LWIA 4ZCRA 2WU4A 1Q57A 3SZRA 2G0IA 3N58A 3EIEA 1Y7LA 4UTOA 2FUG9 5GVSA 4BGVA 3KEFA 3VNBA 1O7JA 2YS6A 3HGMA 2P79A 3G6XA 2FHMA 4IMRA 1OZ0A 2OPPB 3O4JA 1VA4A 2NYIA 3FSGA 3FFAA 3ELDA 2O2JA 5CNMA 4OBWA 3CM0A 5A2QU 4HDMB 1U48A 5LQUA 2XCTB 3HMKA 1LV7A 5KFMA 1E4VA 3G9CA 4NS1A 1ZSNA 3G79A 1XLVA 1LNQA 1F6WA 1PWHA 2FY8A 4U9IS 4MYRA 2HQSA 2H54A 2V6GA 1ODJA 4R8MA 4KPYA 1XXLA 2OFPA 3F97A 5F8MA 1W44A 1JAIA 1OSNA 4WEQA 3TPFA 1IXYA 2ZAIA 4Q3BA 5DXJA 3HKDA 3GLUA 1TQHA 3RIMA 2BEJA 2XXAA 2FRVA 2O8VA 1SVDA 1PR0A 2YQ1A 3R6DA 1S4QA 4MX8A 4ARVA 3G71S 4UXJA 1MB2A 2GBGA 2X8BA 3HWSA 2CDBA 3ZTWA 4BMNA 3PUXA 4DNXA 4AUMA 1UFVA 3NBQA 2YIVX 2AZ1A 3UJBA 4ZOEA 1ZAKA 2XY5A 2JNWA 5JRZA 3IEXA 4DAOA 2OAEA 5CYGA 5E7MA 3G0CA 1GL3A 4BQPA 4MQBA 3KUDA 3QUQA 4CLFA 1EFVA 2XEXA 1CK4A 3Q83A 5BRAA 4U8YA 1V1MA 1EVQA 1TVRA 3I01A 4C0BA 4FR2A 2F3UA 2EBFX 3GT4A 4LZZA 2OJ3A 4WWSA 3L01A 4BCDA 5SY9A 1ISSA 2A5DA 3ILYA 4HAVA 1MV8A 3GPCA 2HMWA 1CLUA 3HZOA 4ILRA 4E5VA 3CT9A 4IMPA 3HU3A 1QHHB 5J59A 3ZV5A 1QQ6A 2VJVA 4CF5A 5JNVA 1GXTA 2X23A 2PWBA 2CHUA 4DJEC 3BEGB 4C0HA 3OFVA 4FF2A 2QWXA 4N7JA 1E8NA 1HT1E 2NAPA 4ZJZA 1XZGA 4EF4A 2Z2LA 2EKBA 1IY8A 3LFTA 4MWTA 1CQIA 1E9CA 4TOIA 3B38A 1QUEA 4X44A 3HKEB 4MQUA 4ED7A 4DLSA 3CSSA 3UH0A 3N6RA 5LZ2A 3ICQB 4TNOA 1XQVA 3ZHZA 3BG5A 1KC8T 2VV5A 3E2IA 3OZCA 1KSGA 3VH1A 3FPGA 3W3AH 1Z35A 2CUZA 3H0EA 3R41A 1M1GA 1M0WA 1M6VB 3UA4A 2XOKA 5EJFA 4Z0HO 1E3WA 2ERRA 3HCWA 3FGVA 1OHHD 2GRJA 2FMIA 3JATA 1UT8A 2K87A 4MJ3A 3KOAA 3T5HA 3WGQA 1RDRA 4EG4A 1HQKA 1J2RA 1BEEA 4LWZA 3CFYA 2DQSA 4DIUA 4YT4A 5ALUA 3J80Y 4OO3A 5EDWA 2XTJA 1YQHA 2W43A 1MROB 2FWBA 3N7TA 2VRWA 3HA2A 5LQSA 1UEVA 3IEVA 3TA0A 2AJLI 2XMGA 1WXWA 2HIGA 3HV2A 1YI8A 3NIDB 2R4FA 1EDEA 3U7QA 3DVSX 5KKNB 2RKIA 3L7LA 1WLSA 3WC0A 2FTRA 1K97A 4KHPB 2MMCA 1S9GA 1MG0A 2HFSA 4DR5B 5ADWA 4L22A 1FOEB 3C3KA 4MUFA 3G8YA 1JI3A 3N87A 5IFLA 4QIWD 3FNQA 4O8CA 1FESA 4U0JA 3ESYA 1T1SA 5FT9A 1NYTA 4ZYYA 3B6MA 1XTJA 5K0NA 3MMSA 1RAJA 1O9BA 3BH7B 1IEQA 2JJ2D 2RCNA 5LBIA 3PNSA 4FHGA 5EIEA 2HHHB 2BF7A 5L8VA 4L0MA 3H86A 3VYVA 2CVZA 1NJWA 1U7XA 1LRLA 4IIFA 2I5PO 1WP9A 1XELA 2EV9A 3HY6A 4QFMA 5KYVA 3PYDA 4YS2A 1VHTA 3CRNA 1WWKA 4I6YA 3AY6A 3C6TB 1XP5A 1P9RA 1XKLA 2DT9A 5T8KA 4DUZB 1WF0A 2CDNA 5DDPC 5BNTA 1KMHA 4X65B 2HV8A 5TQ0A 1FRKA 4I5DA 4PWDA 3LDUA 2AKYA 3DO8A 2BKEA 1DGQA 5CFPA 1KI3A 1NASA 2O8FA 5LBUA 1RT6B 4X7RA 4G0XA 2ZITA 4MQ6A 2WVCA 2L48A 4GXNA 2WONB 2C2MA 1Z08A 4ZCTA 1GV1A 4KMOA 4BCBA 4PUOA 3V1NA 2VLBA 4PC3A 2DRIA 2I4TA 3RHTA 2UUBB 1UPAA 1CQMA 3MURP 1F14A 5HQJA 2WK4A 1QMPA 3HVIA 4ZIRA 1JKHB 2PRJA 1X60A 5FTWA 1IOZA 3KKOA 2OQRA 4WGGA 3IG1A 3IUSA 2IZ7A 1K08A 3DOLB 1W4ZA 1P60A 1ZRMA 2VHUA 4R2MA 4N41A 1VG8A 3VAKA 1JF8A 5K51A 5FIIA 3PRYA 5FI1B 4EJSC 1SJQA 1OASA 3TMYA 3V8NA 3GLSA 5I3QA 1XCLA 1P9OA 3QPCA 1ZH4A 4ZPTR 3L6RA 3K09C 3DTYA 1RTKA 2YOGA 1WUJS 4G6VB 1AHHA 3VISA 4C89A 3MG9A 5B1HA 4B46A 5KOYA 3H5XA 3OFEA 3L6EA 3EPPA 4YRSA 3HFVA 3D2WA 3V7UA 1G5TA 1UC8A 4LWOA 3KHLA 3O4VA 4CKEA 5A8KB 1KZYC 2QIOA 4RJTA 5CA1F 5MN4A 4FCVA 4RKRA 4LUBA 1ZN9A 2Q41A 4WLEA 3A36A 4F8EA 1Q0LA 4AO6A 1AD2A 3LHIA 2VFSA 2FDRA 4KLCA 4GGOA 4U3JB 3WRWA 5J2PA 1HXHA 3T5CA 4M49A 1VCOA 3LUFA 2D7JA 3UENA 4QVIA 2RQMA 1T9WA 2QFIA 4DBVO 3JVUA 5E6RB 4KU4A 1Q84A 5HIIA 4PQUA 1MU2B 4TT8A 1FWKA 3ZZ1A 1OFHA 3RRZA 1GN8A 1DOAA 4L2IA 1XNGA 4RA6B 5JC1A 2CHGA 5A8WA 2QX9A 4WCFB 2NAFA 3T4PA 1PNVA 1E0AA 3I01M 4FI3F 3A1TA 1QRRA 3BK1A 4HI2A 3K7EA 2CBGA 3V4MA 3BBCA 1T3OA 2A8YA 1I7LA 1LQ9A 5C52B 4ND8A 3WSWA 3GLGE 4FQ5A 1ISJA 1YR2A 3AR7A 1H38A 3HDVA 3MWDB 2CC2A 3UMFA 1U1OA 4I1VA 1CJCA 3JRNA 1Q82T 2PDAA 1VQNS 5FRDA 3P9PA 1D09A 4K9MA 1MRSA 1ZPWX 3MR7A 4LSMA 5EE9A 4G0QA 3TM5A 1F5BA 4BFYA 4B3BA 1Y8RA 4IWYA 4ZZ1A 2RGRA 2CXHA 2VH1A 3NWBA 3CZMA 4EPXA 3DEYX 4PQYA 2ZE2A 5LOVA 3IP8A 3NBAA 5L38A 3BFKA 4IQ0A 4EX7A 1OIXA 1EX1A 5ENDA 1CS4A 3EGDA 3K0EA 1TL1A 2WYWA 4OXKA 2K3KA 1XROA 4I9NA 3QVGB 3CZRA 4JL6A 4KGZB 3ZYCA 1HR0F 2PI5A 5AW3A 3LL4A 4X84A 3FWHA 3B8EA 5D2CA 3CH5A 2C2RA 1TVEA 5M34A 2YCLA 5FB3A 4EH1A 1NKSA 1FEEA 3GGOA 2B36A 1UK7A 2XDYA 4ZT5A 1VQLS 4K0RA 5JT1A 4HDKB 4K1LA 1ADBA 3QSGA 2YHIA 1EH5A 1IQ0A 2YZKA 5EKTA 3GL9A 4M1KA 2WFLA 4BEVA 1ESCA 4BVLA 4AG6A 2VPIA 4O59O 4HSEA 4N6OA 3PFGA 1FT8A 4RD0A 3CO5A 4RHYA 3EMDA 4RC9A 4S0ZA 4QBTA 4DLVA 5HS4A 3GJZA 4XM2A 3Q87B 3M1VA 5I48A 1FVXA 1KXZA 3EZ9A 3EEIA 4IEFB 1I6JA 2QG6A 4MVJM 1FRXA 4MKVA 3MMNA 1VB3A 2ZW9A 3LUHA 1LDBA 3EFHA 1GSAA 5BQ5A 1QGAA 4DVJA 2X7JA 2LYVA 3IV7A 4ZAGA 3GMDA 2OYSA 3FKJA 1PFWA 3P9RA 1FWPA 4YUZA 5I7FA 1HE2A 1S1VA 2LE0A 2XUZA 4DUGD 2WHPA 3GDHA 5IM0B 3M2UB 3NNDA 2N82B 2QP9X 4DCJA 1LPPA 3R3SA 2QRLA 3BMNA 4V2IA 3GK3A 1O58A 1LPMA 4Y6QA 3LA6A 2QTTA 4NLLA 1T9GR 1ZK3A 3OEWA 1DT3A 5EWFA 2UXCF 1IQPA 2GYVA 5FV7A 3GBVA 5FFFA 2Q5CA 5PNTA 2SECE 1SCQA 3PQEA 3GV5B 2IDJA 3PQCA 3D1JA 2AYZA 2EFCB 3WK8A 4O5AA 3QY9A 3PR2B 2J6UA 3PV8A 3RRXA 4S05A 1YITS 3U17A 3L1VA 4CGYA 3TO8A 1NN1A 2X86A 5J5CA 1LFWA 2JEGA 3ESZA 4C7KA 5ALWA 2CL6X 1T34A 5GAGI 2GMLA 4D9CA 2YV3A 3KMSA 1BROA 1U1MA 5DHSA 1KI6A 3PYEA 4HEA1 1ZIOA 2HA0A 3CJTA 5IZCC 3D6TB 4IJ6A 2P40A 2Q3PA 2H5JA 4EHJA 4DSUA 2I99A 1QUPA 5TT1A 1TTTA 3K30A 2YXDA 1RYRA 3ICVA 2V0GA 1N7IA 5IK2D 2C78A 2YKMB 2WNHA 3HN2A 1Q7TA 4JI2B 4CO2A 1JIXA 3I1JA 2F63A 4JCCA 4J9NA 4JBCA 5LDGA 2EW9A 3C3MA 4HNQA 4BEWA 5BYQA 5BV7A 4G1QB 3ISZA 4NCHA 1TC2A 2P9JA 2JD0A 4YJ3A 2OHOA 4NU5A 4Y2TA 4CM5A 3CCSS 3DOFA 4R16A 2H63A 4Q5IA 5CFLA 3UKDA 3KCNA 3IRWP 3P9YA 2V68A 4C4PA 2F17A 2GFFA 3WQSB 3KYBA 3H97A 3PPWA 4Q3NA 4A8JA 2MSCB 1MN9A 4L3WA 4BRWA 4DIBA 1KO8A 4LT6A 4JNKA 1JEJA 1VL5A 1LXCA 5B30A 4X71A 1K66A 2JAXA 3NVAA 2ADFA 3MT0A 2AFHA 3N9IA 4E33A 2I38A 5EHZA 1N32F 2QLFB 1GJRA 3PD7A 3C6UA 1GQ2A 2HMIB 1PUXA 3FX2A 1E5VA 2Z0GA 5DX0A 4EABA 1QS0A 2KO1A 4YMVA 1WG8A 2BD0A 3AL2A 3LQVA 1SIWA 4GLFA 2CEAA 1TVKB 1N5RA 2XC9A 4PPQA 4AJ4A 4DZRA 1E1MA 1TP7A 2HIYA 1KK3A 2WBRA 3G0DA 3O2SB 3G9XA 3LF2A 4YV2A 4KDEA 2ASJA 1OI7A 1OLUB 3RH0A 3GUCA 3JD3A 4LF8B 1VXOA 4K0KB 3CIFA 4HDOB 4YOEA 4NYPA 2UXBJ 1Z0JA 4RW9B 3OU6A 2ZQYA 1QTMA 2ERXA 5K0FA 4MITA 1V9CA 2BV3A 4CLLA 4I69A 4GYKA 3RJ5A 3EXCX 1QSLA 1UCNA 3KU1A 3SDEB 3H0CA 4DPMA 4BBJA 1Z0IA 5B1IA 3M6LA 2DPYA 1FTNA 1T0TV 4Q3CA 2FW7A 3BZBA 1Q7GA 3PWKA 4B6FA 4DRXA 4YMLA 5AXLA 2OPBA 5HE8A 1YRUA 4AC9A 4AJ9A 3H9JA 4FMCB 3LSYA 2GF9A 2RB7A 1L5OA 4Z7CA 3I9LA 2ZIUB 5GJBA 2IODA 2LA6A 5BR8F 1XTUA 3D3QA 1JHMA 5ALZA 4G81A 3TBHA 4DV7J 4UXIA 3SYMA 4JH0A 2QIFA 1ZBTA 1MGPA 4GXQA 4WI1A 2XUDA 5EUQB 1IG0A 1GHTA 1TV6B 4HC4A 4F26A 5GIOE 3WDOA 1KYXA 4OP2A 3OETA 1ARZA 3NAGA 4EQ6A 1X4DA 4I0WA 2JLVA 3SX2A 1PBUA 1B16A 2BFBA 2WSIA 4X66B 4B3SJ 4D79A 2H1IA 4R6WA 3SYLA 4A6PA 5BW6B 4NP6A 4Z3OA 1T0UA 5C25B 1RT1A 4LYHA 1M66A 2CFTA 2X3YA 4MW1A 3LT2A 2H00A 2QDXA 2ZWAA 3HXLA 5CK4A 4BKMA 4MQEB 3EVZA 5A8RA 2G9UA 5ALQA 3CGIA 3BMXA 3PPYA 1R8PA 1QE3A 4NBRA 1FUEA 2OESA 5DBEX 4RD3A 2ASLA 3BD6A 2ROGA 3QY0A 3ENWA 9ATCB 4MB2A 5KSWB 3LTEA 4B9LA 4MJLA 1WUHS 3K4PA 5J4KA 3PCOB 3A9RA 1IBMJ 2E7VA 1USKA 4CM3A 3P5SA 3PY8A 4HH3C 3THRA 2JWNA 1T5OA 5IVHA 3L4SO 4NLXA 4DV4B 2P5TB 4K50A 3DM5A 2NNWB 3ZXSA 4QQNA 5DHTA 4AFFA 2P7HA 1ISFA 2E5LJ 2P35A 3TE6A 2EG9A 5CDGA 1F38A 4BP9A 4FFNA 5BO5A 4H6VA 1CY2A 3QUBA 1PV4A 1PCXA 5JAHA 3Q11A 5IVDA 5ETLA 3T9EA 2UV8G 3PEYA 2UDPA 4HH4A 4PRFA 4OQJA 2YV2A 1ZNYA 4MHSA 3C8HA 3LHFA 3AEUA 2G9VA 3TEJA 3A1DA 4IDPA 2WFAA 5I3ZA 4NPAA 2UYCA 5DM60 2FFBA 3D0QA 1SQGA 2OTCA 4RXTA 3PHCA 5FBLB 3MF5A 3MK31 1JMTA 3ZZZA 3FQLA 1M1XB 1GLGA 4HYYA 3U61B 3R2DJ 3PRDA 4FX5A 1Y4UA 5MF6A 1KBQA 3H9GA 2C31A 4F67A 4P7VA 4W9NA 3K0AA 4JJ4A 2X3UA 3EW9A 3E01A 4DMZA 2CK3A 3DE4X 1IBKJ 1D6JA 3GLFE 5F1KA 4B35A 3QBCA 2PD3A 3NFYA 3EWNA 1E61A 2C1EB 2VD3A 1XD2A 2JHPA 2QDKA 2RHCA 3O3OB 1MR3F 3CXUA 3QF4A 1Z5PA 2QF7A 4GKKJ 4Z0NA 3I4PA 1E5QA 4HYTA 4QTZA 2G76A 1F0XA 3OWOA 3C6QA 3M3DA 2AD5A 3EGVA 1C0IA 4DR4J 4TY8B 1LSJA 3A70A 2QTZA 1XTRA 1ZVKA 2QL5A 4II2A 3ET6B 3RUDA 3YASA 3ZD8A 1RABA 1YJQA 4NMHA 4UUMA 2IPXA 2O8EB 4WRRA 4D2IA 3OIDA 3M9NB 2VPQA 4OJYA 2VF3A 1X7WA 3MCWA 3F5FA 4KE7A 4ZQCB 3PJEA 1TA4A 1SOMA 1EJ0A 1KJJA 2JGJA 1QIFA 5JSUA 3WMFA 1JI0A 3LLVA 3HM2A 1LK5A 2YRFA 3ZXUB 5JLJA 4ACAA 2QTLA 5TRTA 2JCSA 4KHZA 1L5MA 1PN3A 2GCOA 2Y77A 3KG4A 4UNPA 3QXJA 1EM8B 5K2MA 5IEJA 4K5SA 3K96A 1RBOB 4NARA 3KLEA 1VXRA 3TJAA 1VKJA 4LHXA 2PT7A 1PW5A 3FWNA 5INTA 1ML3A 4HS9A 2YWHA 4M8LA 1NSPA 3DFKA 3HYTA 1IR0A 2HLDD 3BIJA 3L8MA 2EVWX 3UQYS 4MMZB 1FFWA 1ZD1A 3E35A 1FMCA 1G6OA 2FF7A 2VJPA 4QAJA 1ZCZA 3F7NA 3RDPA 4MKXA 1NDUA 5CR9A 2WTMA 4C7JA 1JR3D 1SGWA 4FLMA 4MKZA 4DRYA 4U2CA 1FTWA 3R23A 4Q4HB 3UDVA 3PQ4A 3ZD6A 1I36A 1Q17A 1VJ1A 3QYJA 5HK8A 4YMWA 3EJMA 3MUFA 2VXOA 4OIXA 5FBHA 1ENOA 1SA0B 3QUCA 4AKTA 2WG0A 1FIUA 2HBZB 4B3OA 1XKTA 4PEVA 3ZWQA 3CRVA 1FDOA 3UNYA 4OHKA 1SAYA 2O7RA 4GECA 3WV5A 3DA8A 3RAFC 4Q34A 1Q0SA 1CQPA 1TFWA 2QQFA 3ZI0A 2XLKA 2XG8A 4WP8A 4Z53A 3LCVB 4EGFA 3ZIAA 1E2DA 4KMRA 1P80A 1EK0A 3PQ8A 3QU7A 2F4VF 1CR1A 2H7VA 4M36A 2C28A 3RS4A 4MPDA 1QB7A 5HWSA 4F0HA 1TCAA 3RAEC 5JTUA 5CB4A 3PHIA 1Q2UA 4WACA 4OSOA 2ZQZA 2BGTA 4WZZA 4HKTA 1I32A 4CI0B 1WDDA 1QCDA 3JARB 2DSTA 1VFPA 3B2EA 3CW9A 1KS9A 3LPEA 2UVRA 1BU5A 5KBYA 3CUSA 2NYAA 4F46A 4KPUB 2YYSA 1RHQA 3L46A 4ZO6A 1WCXA 2Z83A 5AK3A 5JH7A 2IUYA 1DTTA 1CPZA 3ZK8A 1HL7A 5HBMA 1R8QA 4FFBB 5EWMB 1QJHA 5LLTA 4CT5A 5E33A 3BO2A 3GVPA 2NU7B 3AEQA 1H2XA 2FPPB 4DW8A 4AL4A 3PC3A 3A9TA 4O4GA 1G291 4L74A 1PEAA 5AXDA 1ACLA 4HL9A 1EB8A 2RD5C 2ABWA 1LS6A 3ISTA 3R76A 1VG0B 3B5IA 3HXPA 3KLFA 1N2SA 4YQFA 4W8OA 3WLOA 2CFSA 1JG7A 1XTZA 2HNZB 4FXPA 4MMOA 2DPMA 3G0GA 1SVSA 1PI3A 3W2VB 2AJFE 1UKVY 5CM2Z 4RPGA 1B15A 4W1SA 1BG6A 1JLKA 3F98A 2IY7A 3CTRA 3DL0A 5AT1A 2I2WA 2JIPA 1K5HA 2KWIA 3NT5A 4NE9A 8MHTA 4OGKA 1ADGA 4BFLA 3ZUGA 1L4UA 3HFKA 2GEJA 5LMUB 1DCKA 4YHBA 3RUIA 2AN5A 3TWOA 1X8JA 1TMOA 3E22A 2QMOA 1MQAA 1T03B 5C8DA 5DM4A 3CR7A 2ATCB 1ND6A 5IXYA 2OCGA 3HT3A 3L82B 2YNMA 4QUAA 3N6MA 2R6AA 3K4QA 3V8BA 4WADA 2PKEA 2RRAA 1F12A 1ZJ5A 4V02A 1T8SA 2PUTA 1RRCA 5DVZA 5J1EA 4D9KA 5H83A 2MKJA 3AY3A 3ECAA 1PJCA 3SJZA 2GJIA 1S1UB 4UDNA 3TL6A 1LV5A 3MGAA 3K2QA 3GLGB 2DEJA 2DPIA 4P4TA 1H2AS 4REMA 4X9XA 3WWOA 1XNQB 4IBOA 4B3MJ 4U1RA 4ARSA 1VYTA 2QC3A 4B3TF 4LFCB 1ODIA 3OIGA 1EBFA 2AW5A 2F55A 1JJCB 5BNWA 2CUTA 2ZJ1A 5IJ9B 2AQ4A 3HHEA 2D5LA 2QA1A 3ZWNA 5ICGA 2JFNA 3IE1A 4MB6A 2M98A 4GPD1 3NVDA 4BC9A 5TPZA 4OSPA 4X6XA 1A9NB 4IO1A 2FWMX 1TO1E 2YWJA 1SCAA 2IAJA 1X7YB 2A86A 4U7PB 3HP6A 2NSLA 2A2DA 3G6VA 3AM1A 2FYTA 5FBZA 2BFPA 4CM9D 4Q9LA 1Q1KA 3IUJA 2R6FA 2C96A 4H27A 2DBVO 4RZIA 4BFTA 3AQOA 4PAMA 2F1IA 4IDQA 2MHEA 5KYNA 4NXNB 3PJGA 4NV0A 2VJMA 5IN4A 4AMZA 1FRHA 1NBHA 3VNVA 4HV4A 3TH5A 3AONB 3KDSE 2QD3A 3FZQA 2R00A 1YGYA 4L5CA 4U7TB 3IV9A 3ZBQA 2LLZA 2EWWA 3HCBA 1PKXA 4WJLA 4LZJA 4XGKA 2G5TA 3NTUA 5EE3A 3Q9NA 2EJVA 2JJQA 1AIPA 1CETA 2O3TA 4IIJF 3H2JA 5IJAA 2ZYSA 3GSIA 3VAHA 4GL4A 3WL6A 2QE7A 3L0IB 1RAAA 2AI3A 4YAWA 4EY7A 1A9RA 3ENZA 2QR5A 1N3LA 2POQX 3TVYA 1M5PC 2I76A 4F7DA 2GZ2A 3GOQA 5JS1A 3AHFA 1O77A 4CE6A 1P73A 4JI4J 4U7JA 4ZDIA 2XW6A 3T1HJ 1MH9A 4TU9A 3I9NA 4K4TA 4BGUA 5BSVA 1HKHA 1DBQA 1LY1A 4ZHQB 1MN7A 8LDHA 5EJ6A 1DJNA 4KV7A 1U1GA 4HN2A 2KSQA 4RKQA 3CRRA 3RLIA 3UK1A 4KYTA 2GM4A 3ZZ0A 4O3SA 1RWWA 1M6YA 3ESXA 1AGYA 1RAIA 5E4JA 4UTRA 1A3CA 1K6IA 3RSHA 1E2JA 4AO8A 4LYGA 4QA9A 2DLCX 5EWGA 3Q8YA 2MHNA 2R8XA 2ZBFA 5D3QA 1EP4A 3HSYA 3BQ1A 1L7QA 3EG9B 3VTKA 1HK7A 3TTWA 4W9MC 1UMBB 2O5CA 3I8SA 3PDNA 1MP0A 2QMEA 4PGGA 1NF3A 1V5IB 3MQ2A 4PG8A 4XARA 4EKEA 5TARA 1K4KA 4F9EA 1GDHA 1WVGA 4BLTA 1AO0A 4DV3B 3I0NA 3RLFA 5LYYA 2OORA 3ZOZA 1EUCA 1CR2A 4CN8A 2OUGA 1TZ0A 1UQUA 3M32B 3TZQA 2Z58B 4WZ6A 5ITZB