4ATNA

Crystal structure of c2498 2'-o-ribose methyltransferase rlmm from escherichia coli
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
357
structure length
356
Chain Sequence
MNKVVLLCRPGFEKECAAEITDKAGQREIFGFARVKENAGYVIYECYQPDDGDKLIRELPFSSLIFARQWFVVGELLQHLPPEDRITPIVGMLQGVVEKGGELRVEVADTNESKELLKFCRKFTVPLRAALRDAGVLANYETPKRPVVHVFFIAPGCYTGYSYSNNNSPFYMGIPRLKFPADAPSRSTLKLEEAFHVFIPADEWDERLANGMWAVDLGACPGGWTYQLVKRNMWVYSVDNGPMAQSLMDTGQVTWLREDGFKFRPTRSNISWMVCDMVEKPAKVAALMAQWLVNGWCRETIFNLKLPMKKRYEEVSHNLAYIQAQLDEHGINAQIQARQLYHDREEVTVHVRRIWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords RIBOSOMAL RNA LARGE SUBUNIT METHYLTRANSFERASE M
publication title Crystal Structure of Rlmm, the 2'O-Ribose Methyltransferase for C2498 of Escherichia Coli 23S Rrna.
pubmed doi rcsb
source organism Escherichia coli
total genus 117
structure length 356
sequence length 357
ec nomenclature ec 2.1.1.186: 23S rRNA (cytidine(2498)-2'-O)-methyltransferase.
pdb deposition date 2012-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01728 FtsJ FtsJ-like methyltransferase
A PF18125 RlmM_FDX RlmM ferredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2810 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4atnA01
3.30.2300.20 Alpha Beta 2-Layer Sandwich THUMP fold THUMP fold 4atnA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4atnA03
4HGZA 5GWXA 3EGIA 4A6EA 3DH0A 1ZQ9A 2B2CA 3M6UA 1RI3A 4C06A 5BXYA 4HGYA 3HCEA 4BLVA 3AWIA 3GGDA 5KQSA 4WVLA 1JSXA 1SQGA 2PJDA 3FTEA 2JHAA 2G72A 3BXOA 5DM4A 1T43A 4EMSA 4BY9E 5EKXA 3TRKA 3KQMA 4PYMA 1L9KA 2OYRA 1Z3CA 3HCDA 4YUZA 4KIFA 1Q0SA 3AXSA 4V0RA 3IHTA 1HMYA 2H00A 1YUBA 2NXEA 3HVHA 3NVMB 3R3HA 5EMMA 4Z2YA 2PXXA 4YMHA 4GUAA 1N7JA 1RI2A 3E23A 2Z6UA 5EHGA 2Y1XA 3G7UA 2AVDA 3FTCA 4LECA 4YV2A 2YXDA 2ZLBA 2AN4A 1MJFA 2R6ZA 3FPEA 4KDRA 1QAMA 3T7RA 2VDUE 3A7DA 3BWMA 1UWVA 3EVCA 4QDKA 1SKMA 2IBSA 4X63A 1YZHA 4RWZA 4PINA 2VDWA 3I58A 3GIWA 5ICGA 3MCTA 3REOA 5M5BA 3A25A 1QYRA 1KYWA 3BGDA 1KP9A 2P1DA 2WA2A 3BZBA 4DZRA 5LQUA 1DCTA 3FZGA 4OQEA 1XJ5A 5DSXA 2PXAA 1KR5A 2HWKA 3DOUA 3LDGA 2IGTA 3ORHA 5GINE 3ER9A 2G70A 3SR4A 4ER6A 4AZVA 1YFJA 3G2MA 3B3GA 3UJ7A 5B1SA 3DMHA 5FWAA 5E1OA 2IH2A 2NP6A 2UYHA 1NW5A 3M6WA 3BWBA 5EIWA 3BGVA 5EOVA 1HNNA 2GA9A 5K0LA 1JTFA 4A6DA 5C9ZA 5DTQA 4PIPA 3CCFA 3KQVA 2OO3A 3HP7A 3AY0A 3UFBA 1KPGA 3I53A 4C08A 1VP9A 5GP1A 1L3CA 5CM2Z 3G88A 2JH9A 3HA3A 2AOTB 5E9JA 3C6KA 1VL5A 5DTMA 5BW5A 2BM8A 3ERCA 3C3PA 2G71A 3KQSA 1XCLA 4POOA 4X41A 3I5UA 3GDHA 5ICFA 1G38A 3AXTA 3RODA 5KS2A 3TMAA 3LPMA 3BUSA 4XUEA 4FSDA 5E1DA 1KHHA 3CBGA 2V7EA 2VP3A 4PWYA 5LQNA 4M7RA 3B3FA 5U4XA 2AOUB 5CCBA 2PX2A 1JR4A 3H2BA 2EFJA 4EKGA 4RV9A 3FRHA 4KRGA 5K01A 3R24A 3UBTA 1KYZA 4PGHA 5HIMA 4RTNA 3VSEA 5MHTA 5KQRA 1WG8A 1VLMA 3JWJA 5FHQA 4R6XA 5IKMA 5DSTA 1JSZA 1SVUA 2BH2A 3O7WA 2YR0A 3P2IA 2OB1A 1VQ1A 4R8RA 5EGSA 4P7JA 3G89A 2VZ9A 2NNWB 3HCAA 2VDVE 2CKDA 1JQ3A 3G2OA 2PKWA 3LL7A 5FCDA 5T64A 5EIFA 1N2XA 1RI1A 1RJFA 1L1EA 2AN3A 3KQQA 5E2AA 5LQRA 4U7PB 2AZTA 1ZGAA 3E7PA 4FZVA 1TPYA 3KPUA 4Y2HA 5EEHA 3OCJA 5EZQA 4DF3A 3CKKA 1P39A 1WXXA 3OPNA 4RVHA 2I9KA 4X1OA 2NYUA 3KQWA 1BC5A 2XBMA 3FPJA 1IM8A 2ADMA 1UIRA 3KHKA 4PONA 1XVAA 3KQPA 1NV9A 2I62A 3HCFA 1G60A 1NV8A 1XCJA 4P58A 3FYCA 5F2OA 4KIGA 1X1AA 3GRRA 5DRTA 5K05A 5E2BA 4RTMA 3UA4A 3A7EA 3CC8A 1YB2A 5BW4A 4RVGA 4QQKA 5CVEA 3U81A 3WSTA 5GIOE 4P7GA 1DL5A 5K0CA 5EHIA 4HTFB 2AN5A 4R8SA 5ICEA 2AVNA 5FA8A 2Z6QA 3T0IA 3NMUF 1VBFA 3UJBA 3KPYA 1NW7A 3VC1A 3LKZA 3DXYA 3G8AA 3EMBA 3P8ZA 1N7IA 1VP3A 1NW6A 3O4FA 5E8RA 5FHRA 10MHA 2I7CA 3FYDA 5C0OE 1X19A 2YVLA 3LDFA 1RI5A 3HA7A 1ORIA 3EVFA 2P35A 5DLYA 1QANA 3HVIA 3FPGA 2BR4A 3CJTA 3PFHA 4GC5A 3VYWA 2ZCJA 3MCZA 2C7RA 3SMQA 5ICCA 2I6GA 4YUYA 5K0GA 1TW2A 2PSSA 1P1CA 4K6MA 3EMDA 4WXHA 4ER7A 4PYJA 2FYTA 2ZIEA 1JG4A 5FWDA 2WK1A 5F2NA 1D2GA 3HM2A 3UA3A 5E1MA 4GOND 4NECA 2P7IA 5IH3A 2ZVJA 4HRAA 5FQOA 4M38A 4BP1A 4RSRA 2P3QA 1O9HA 2Q41A 3EVDA 2XYVA 4F85A 3A4TA 5K0BA 4C4AA 3E8SA 2YX1A 5P8WA 3SGLA 5JR3A 5CD1A 2HMYB 2JG3A 3K6RA 3FUXA 2O05A 2B25A 3DXXA 3KQTA 5GIPE 1L3BA 3LSTA 2PBFA 5F2KA 2IH4A 1JQEA 4AUKA 3GRYA 3UJ6A 3DUWA 2CMGA 2AOWA 4F86A 3LECA 4E2XA 3DXZA 5LSAA 3BT7A 3CJRA 3UJ8A 2GB4A 2CMHA 4X61A 2XVMA 4UOEA 3B7PA 3GO4A 4RTRA 3OU7A 2P40A 2XYRA 5DPMA 1SQFA 2UYQA 3IEIA 5CVVA 2A14A 1ZKDA 3UWPA 3M70A 1Q0TA 3OU6A 4OA5A 4GOOD 4CKCA 2OBFA 2QYOA 3GJYA 3P71T 1G55A 4CXMA 2ZBPA 2C7QA 2C7OA 5LQAA 2UYOA 1XDZA 2IDKA 4FS8A 5FUBA 1AV6A 4RX1A 1B42A 3LX6A 4E2YA 2AOXA 3QOWA 1EG2A 3FUUA 1O54A 2HR1A 4BP3A 2NP7A 2KW5A 3KR1A 1U2ZA 5FULA 3P9NA 4LWOA 3DMGA 2XVAA 1NW8A 4OBWA 4B17A 3P9IA 2ZZKA 3D2LA 1PJZA 3FTDA 1R18A 3Q7EA 2ZFUA 4RTJA 4XCXA 1ZGJA 3OFKA 2P3OA 4E70A 2ZIFA 1R8XA 3LCVB 2JHCA 2PWPA 2F8LA 3P2EA 5HFJA 1VE3A 3M6XA 3SXJA 3UJCA 3M6VA 4RTLA 1RJDA 3GWZA 3PT9A 3EEYA 3MGGA 2FPOA 4V0QA 5H02A 5LQCA 5EPEA 4QVKA 5DTRA 2PLWA 5DM0A 4AX8A 4CTJA 1KPIA 5DM2A 3L8DA 4RVFA 3ER8A 5EVJA 2P7HA 5K09A 5K8VA 1YZ3A 2IP2A 4PGGA 4U7TB 3RIEA 1X1CA 4R6WA 2NXNA 5HZMA 2PX8A 4ER0A 2ZWAA 3B89A 3PX3A 4QDJA 2Y1WA 3CVOA 4JXJA 5GM2A 2ZBQA 4OQDA 2DULA 4LG1A 3MB5A 1XXLA 2BM9A 2ZIGA 3NDJA 5HOQA 3CJQA 3HCBA 2ZWVA 4PYLA 3R9XB 3FPFA 2P41A 4QVGA 3SSOA 3SVZA 4KWCA 4MTLA 4RTOA 3F4KA 3K0BA 5G02A 5E1BA 5JUWA 3OZRA 3A26A 5FA5A 2BR3A 2BR5A 3B5IA 2GS9A 2P8JA 3DLIA 2QRVA 2OKCA 4GEKA 4PYKA 4DA4A 1M6EX 3DLCA 5K0EA 5KYGA 5K0NA 2PX5A 4BLWA 5EKUA 1F3LA 2ONZA 3KR2A 3PFGA 1QZZA 1WXWA 2DPMA 4RTQA 1P91A 1R6AA 3OE5A 1G8AA 3P9KA 3DTNA 1I9GA 4E32A 2K4MA 4M37A 3V97A 1I4WA 3EPPA 2YTZA 3G2QA 5DWQA 1D2CA 5DX1A 2ZZMA 2WA1A 8MHTA 2FCAA 3MERA 5EMLA 1BHJA 3ID6C 3UJDA 3KQYA 3HTXA 4E2ZA 4FT2A 1AQJA 4YMGA 1ORHA 2CL5A 3KQOA 3G2PA 4E2WA 3G5LA 1RJEA 4HH4A 4E30A 4IWNA 4GOLD 3KU1A 1QAQA 3ELYA 4GOMD 4HG2A 5ERGB 2E5WA 2QY6A 5K03A 2ZBRA 3HCCA 1VIDA 3NWBA 3ELUA 2ORED 2PT9A 3BKWA 3ELDA 4QTTB 1AF7A 5C1IA 3O31A 5KVAA 1INLA 2QRVB 5LQJA 1JG3A 2IDJA 4GC9A 1PRYA 2ONYA 2GAFA 1WY7A 3FUVA 1R00A 5CVDA 1JQDA 2O57A 4PYNA 5LQKA 3P9CA 4BLUA 2G1PA 2XYQA 4MQ4A 5HIJA 1Y8CA 2LD4A 2PT6A 3S68A 2PVCA 3SX0A 3PB3A 4YUXA 3THSA 3VC2A 4ER5A 5EC8A 4FSXA 3LBFA 2IPXA 4OBXA 2H1RA 5DXJA 3IYLW 5DX8A 3C0KA 3TPZA 5LR6A 5HIIA 3TQSA 3TM4A 2IFTA 5GM1A 4IKPA 3LKDA 5EMJA 4E31A 1X1BA 5FADA 4DM3A 3LDUA 2FK8A 1D2HA 1MHTA 4DMGA 4LWPA 4RYLA 2O06A 1JTEA 4FP9A 4XUDA 2ESRA 2GLUA 3P2KA 4E33A 2OY0A 2ZZNA 4Y30A 3MHTA 4YV1A 4XUCA 5HIKA 4DKJA 7MHTA 4RVDA 5BP7A 4G56A 3P97A 2G8NA 1NE2A 3JWHA 2N47A 4GBED 4X60A 4HSGA 4M36A 4YUVA 2AOTA 2PWYA 3R0QA 3DP7A 1XTPA 4GQBA 4PYIA 5CVJA 5D1NA 4L7VA 1FP1D 5K0JA 2VS1A 3OFJA 4AZWA 1ZG3A 2EJUA 4QPNA 1EJ6A 4PCAA 1M0EA 5CUQA 2PY6A 4P7KA 1WS6A 3EVEA 5EZSA 3SSMA 3NJRA 4EQZA 1I1NA 1M6YA 2UYCA 2IIPA 3ANXA 1IY9A 4ATNA 3PX2A 1ZHFA 4C05A 1DUSA 2EX4A 1L3IA 3I9FA 3JWIA 3BWYA 3HA5A 1FPQA 1EJ0A 2AOUA 2JH8A 3UJ9A 3C3YA 4MHTA 2B9EA 2HTEA 1AQIA 3EVAA 2B3TA 3HVJA 1VPTA 1G6Q1 3B3JA 2QE6A 3TR6A 4DCGA 3DMFA 3A27A 3G5TA 3EEOA 5EQJB 3EVBA 3FUWA 3TFWA 3IV6A 2OB2A 3T7SA 3BGIA 5HILA 4DQ0A 2UZ4A 3DULA 4FT4A 5GOZA 1NKVA 1TW3A 3GU3A 4RTSA 5EMKA 1WZNA 5CCXA 3GRZA 3OU2A 3TM5A 3EVZA 3EVGA 1UFKA 3NVKI 3BWCA 3G8BA 2EJTA 2JHPA 3CGGA 3MTEA 1IXKA 1EIZA 2HV9A 3GRUA 2IH5A 2Z6AA 3NW9A 3ELWA 1XDSA 3LBYA 3OE4A 2CWWA 3EGEA 1FP2A 2YXEA 3T7TA 1JG2A 2YUIA 4KW7A 3NDIA 2H11A 2YQZA 1KXZA 3HEMA 4CWAA 2NXCA 4O29A 3UZUA 4FGZA 1V39A 1SUSA 3AJDA 1RI4A 2NXJA 1NW3A 2AOVA 3JWGA 3EGVA 3M33A 3RW9A 3SM3A 4RTKA 2EG5A 1R8YA 1XDUA 3R6TA 1FBNA 5D1HA 5DT2A 4EK9A 4PYQA 2R3SA 3QV2A 5EEGA 5T67A 4ER3A 3FTFA 9MHTA 3ME5A 2ZTHA 1QAOA 3PS9A 3GXOA 2YXLA 4OX9Y 3OZSA 3DR5A 4PYOA 1RJGA 2BZGA 4CTKA 3KPWA 4PIMA 4KDCA 4F84A 1JG1A 1KIAA 2PXCA 4HTFA 5T6BA 1BOOA 3QOXA 4IV0A 4AZSA 3FUTA 3V8VA 2P3LA 4KVZA 4PNEA 3PLAE 2PGXA 3OZTA 3LGAA 4QPPA 1P1BA 5EG5A 2B78A 5K0FA 2HNKA 2AR0A 2ERCA 4R05A 2GH1A 1BKYA 2PV0A 4FR0A 2ZSUA 3NWEA 1SUIA 5FQNA 4EVIA 4YV0A 3LCCA 4H0NA 4RTPA 2ZW9A 1G8SA 4MWZA 1O9GA 5DXAA 2GPYA 3FPHA 3NTVA 5CVUA 4CKBA 4DCMA 2FRXA 4QTUB 4YUWA 3LCUA 1X1DA 4IV8A 1SG9A 2PX4A 3C6MA 3THRA 4C07A 4GF5A 3TOSA 3TLJA 2FK7A 4CKEA 4ZTBA 3X0DA 3TKAA 2AS0A 5HEKA 4C03A 3GRVA 1NBIA 1NT2A 3HVKA 3KPVA 3PVCA 3UJAA 2C7PA 1FJXA 4PCLA 1EAMA 1NBHA 3TKYA 3KKZA 2O0LA 3I64A 3E05A 2V74B 3GNLA 5CIYA 3KPJA 1H1DA 2ZULA 3BKXA 3MAGA 5E8JA 4C04A 5DX0A 2OZVA 4OA8A 1KPHA 5E9WA 5DRYA 3FRIA 3HNRA 5FTWA 4EKIA 2JJQA 1F38A 1R74A 4AZTA 4QQNA 4P7FA 1YF3A 3GCZA 3LHDA 5DM1A 2OXTA 1EQAA 3M4XA 3Q87B 3SSNA 3MQ2A 1OR8A 2OPBA 3KR9A 3PTAA 2IBTA 3MTIA 2O07A 2QM3A 4HC4A 4ISCA 4MIKA 3KR0A 5E9QA 1YFLA 2FHPA
chains in the Genus database with same CATH superfamily
4NE9C 3R27A 4NV3A 4C06A 3OJCA 3U1MA 3OHMA 4BTLA 2JLRA 4UHKA 2B20A 2SECE 5KG0A 3LVQE 3L49A 1ZCFA 1YB5A 4B8ZA 3ISJA 2ZE2B 5LUBA 1UP6A 5CXXA 4Q2MA 4ILMA 2BJEA 4NNPA 3Q9NA 1L5KA 1UDXA 2ZUCA 4G65A 1QIJA 5EJ8A 1V1RA 4Z0TA 1DKMA 1B14A 4Y00A 5EGNA 2WUEA 5I4BA 3TIVA 3UJ7A 1IBRA 4R9RA 3U4HA 3BRQA 2GMHA 1CY6A 1BHSA 1S6QA 4NPOA 1OFUX 5EJFA 2ZUEA 3CWQA 1D2MA 3TTSA 2V97A 5ICFA 1PK8A 4RPIA 4D9KA 4BJ6A 3HKBB 4PZ9A 5T7LA 1XXHE 4DR1B 2N3LA 1GQSA 1EJ7L 2PMKA 2X0RA 3SJCA 2J6BA 5IWAB 3EC2A 2VDLB 3D3JA 4AD8A 4K05A 5DBIA 2REQA 3EF1A 2COKA 1S79A 4CETA 2VT6A 1N5JA 4OP1A 2ZETA 4MJ7A 5F2EA 1VMKA 2DVMA 1P39A 1O6XA 2K5UA 1V96A 1G20B 1A27A 1HYGA 4Z3KA 4BGDA 5KYXA 1ZAXA 3WSTA 4KR2A 1H8EA 2LWIA 5H9FJ 2XMAA 4HZUB 3ROZA 3H0KA 4FNIA 1KDRA 2W4QA 1NRIA 1FJHA 4TWIA 3NU1A 3TVDA 3F74A 3VALA 4URUR 3ND9A 5CYJA 1DO8A 3F5QA 2E9RX 2CJQA 2DUJA 4HDSB 4C48A 5P8WA 1YL5A 2GJAA 3G17A 3UN2A 5K3BA 4JZKA 1TAGA 3KK1B 1ZGZA 1T0BA 4JC4A 3D3WB 3EWNA 1NJGA 1RFGE 5HZHA 2W37A 1FFBA 1W2HA 2NUUG 1V7QA 4NA3A 4EW1A 5HBMA 3RSLA 2HNAA 3TOVA 3FTDA 3UKJA 5L9AA 3O0TA 2YRWA 3RRFA 1UEVA 2I7XA 4C4PA 3LPDA 3DOOA 3PD1A 2GO1A 3KUKA 4UHHA 1HURA 3QRWA 3KEQA 2QV7A 3BAFA 4G81A 4XIIA 1NA5A 1KI6B 2ZJFA 3N87A 2XQIA 1YB4A 4F3YA 3JU3A 2I1RA 1SOMA 2RKOA 3CRZA 2AZ3A 3NNDA 3S5JA 3UAYA 4OH1A 5A4JA 4ZQHA 5L6MB 3A2NA 3KG4A 2N3OA 2IS6A 2HU7A 1HNXF 4PHTA 1H6BA 4X6XA 4CIOA 4PV7A 1U0LA 1EFRA 1EBUA 2JK0A 3D2WA 1IG3A 5J2PB 4C0LA 1UMKA 1SBHA 3KQHA 4QNNA 4AJKA 1T4CB 2JEJA 1XLTA 2V98A 2AE2A 2WT4A 3HC7A 2JLAA 1VRTA 1V1MB 4AWBA 5I4KA 3H5WA 4RW6B 2VWPA 2O57A 3V2UC 5CEFA 4ECTA 3DBRB 2BKNA 1PJ5A 1YHYA 4ZGGA 4PW0A 3X1DA 3FHTA 1R12A 3C0KA 3KQLA 4N8EA 3IIIA 2RIJA 5KYWA 3AIOA 4RFSA 1VJCA 3TI9A 1VYHA 4IZIA 3TPCA 2DXFA 2HWHA 3DNFA 2QA4S 4WX2B 1NY5A 5D3GB 4PZEA 1DTTB 3A6DA 2B1JA 3AF2A 2CYAA 3UN3A 3CURA 4ZFNA 3I4PA 2NTYC 5CUQA 1JS1X 4RH1A 5H80A 4JH0A 1FTYA 1I3MA 1N34J 5E7JA 3TTVA 1N36B 2WY2D 3HKCA 4C9DA 5AXAA 4DQ0A 4UEKA 2YHIB 5SYNA 2NVBA 1LJLA 1CS0A 4OSEA 3NASA 1GQYA 3IMKA 3BN3A 3W9UA 2AX3A 2IQ5A 4EABA 2RG1A 1XQWA 2E4WA 5DM60 4P10A 3OFSA 4BO0A 4XWKA 4CLOA 3DHNA 4A2WA 4RS3A 3W05A 1YMQA 4YQYA 4M5IA 1XPOA 1YUNA 4FWIB 4AZSA 1TL7A 4JC0A 2IZ5A 3N3BC 1GPLA 1VB5A 2VUIB 3RFCA 1I51B 1K88A 4R1MA 3RHTA 1WNEA 3NCTA 4KXWA 3B8HA 3VH3A 2YRFA 1NLFA 1HTWA 1WMAA 3TMKA 3RBAA 3SN6A 1E3IA 5DYWA 1EX6A 1YBAA 3PL5A 4WTYA 2JA2A 3G0DA 4DSOA 2WUVA 4F36A 4O3QA 1E2IA 4CLEA 2ODEA 4DLBA 3OEEA 5B58C 3VHXB 5B37A 2W2KA 2ZU0C 4P0PB 3FSXA 1TZBA 4GC6A 2VDIA 2CHQA 2OBMA 1C2TA 1JSXA 2G72A 3I9KA 5BOSA 3E84A 3R6LB 2VWHA 4B9VA 1IEWA 2GEJA 3T1HB 3NVMB 1ELOA 2H5LA 1Z6ZA 5A8WB 3WLQA 2Q0QA 2I6QA 2R6ZA 1FFXA 2Q6VA 1D3AA 4EGLA 4W63A 2VF8A 1VCMA 4IEFB 1QYRA 5HK8A 5JTUA 3VTAA 3G6ES 2XC9A 1BKSB 1RE1A 2GK3A 4NZ0A 1BWSA 1EAYC 4KYTA 1J7KA 2WW8A 4R31A 3PY8A 5HE8A 2FSGA 4KU4A 2NTVA 1RWKB 2EJBA 4KAIA 1E3JA 3TO8A 1GLVA 2VATA 4LRTB 4AWAA 1X39A 3UJ3X 3B3FA 2I6UA 4IG9A 3JASA 2ZJYA 3B6BA 1TL4A 2OESA 4B3TF 2BH2A 2AZ4A 3M8PB 2I4IA 2HMTA 1Z8DA 4I8XA 1M2GA 4S1WA 1CBKA 2PD4A 4ZI5A 1US8A 4F3MA 1TJNA 1V9SA 2HHQA 3GIKA 2LKDA 1ILEA 3W9YA 2QLBA 3FCYA 3BB5A 1XN9A 4BUJA 3QMPA 4E3ZA 1QC5B 2MQPA 1GAQA 1ODIA 1A95A 1JDZA 1Z6GA 4R5PA 3WIEA 4DV5J 1XHLA 2CPFA 3QJJA 1KDNA 3TVYA 2NZWA 2WJZB 3K96A 4Y6QA 5A2QY 2G9NA 4OL8A 4IHQA 4TV8A 1C1XA 4ND3A 3EVFA 5LOVF 1GNLA 3A3PB 4JA2A 2BRUA 2NQ8A 2XBUA 1NNLA 3EUNA 1VQ6S 2X6QA 5I7HA 4RC9A 3A4TA 4X2BA 3FLBA 4NBTA 3VR5D 2HK7A 1U1OA 2ZSFA 2QHXA 2R9VA 4D80A 3MWLA 2B98A 4DQSA 1WCIA 3LECA 3QVGB 4BUCA 1UC9A 2CMHA 1SPBS 3ZHQA 4R54A 1YTLA 3GY0A 3G6XA 1J9GA 4Y6OA 4EAAA 3WRWA 2CFOA 2WVDA 2GM9A 4JA0A 1JAIA 5E2IA 3OVMA 5BUQA 1RM5A 3HCOA 4DY6A 3EICA 4IXWA 1B93A 6ABPA 2AFIB 1JAXA 1VSQA 1SK9A 1DLJA 1HGXA 4Z1MA 4B6OA 5I48A 1X38A 1WLSA 1XT6A 4QJIA 3ER8A 1DPGA 3ONVA 2WLTA 2OAP1 5IN4A 2OZEA 4NLTA 1ISPA 1J07A 2QBYA 1W36D 3MM8A 3PI6A 3Q2OA 3SJZA 3OA2A 2GS9A 3USCS 1NVGA 4GRDA 1E79A 3IWXA 2IYSA 1ZSNA 2J5QA 1FCJA 3HVUA 2R8ZA 1XAHA 4EPXA 3IE2A 2GZAA 3E7WA 5BW8A 1ORHA 2CL5A 1UKZA 3VX3A 3DLKB 2WB2A 1HQYE 2QY6A 1WMFA 3HJUA 2ROPA 2PT9A 4QTTB 4RHUA 3VO2A 5KVAA 2TECE 2QZJA 3HI6A 4ZJPA 4KNYA 1QIDA 1J2VA 1VL6A 1KRPA 2EGHA 5A4FS 1WXFA 3TIGA 4XKJA 1PFYA 2E55A 2AE1A 3GH3A 5KQGA 3CGIA 2QU7A 3ZWOA 2EBWA 4RWEA 1L5ZA 3DMYA 1GTSA 2JIMA 2LA6A 1IBLJ 3LBNA 1Z38A 5C5JA 3UAOA 2JGDA 1CEQA 1FBTA 1BJTA 2AXPA 4DEZA 4C2AA 2JASA 3CIZA 2YJZA 4Z51A 4QUJA 1RAEA 4I55A 2JGKA 4B6PA 4NC9A 2R84A 5LZ9A 2D1SA 4RD3A 3AMVA 4ETXA 1VHTA 4FT4A 3ZHOA 1H9AA 2EW8A 4ZARA 4PXEA 3T3IA 3RSFA 4B0PA 5EUBA 3ROQA 5JCOC 4UF4A 3ZGNA 2Y8YA 4I4NA 2UYGA 4TY8B 2O8FA 4IH4A 1XR5A 4PYQA 3FMWA 2V8BA 1S4MA 3F2IA 5A3QA 4MAFA 4RSHA 2XWXA 3VGSA 1C9NA 4U2GA 4F84A 4H6VA 1GZ7A 5B7GA 3NNAA 3K4HA 3TG8A 3N86A 1CE8B 2ZJ7A 1FL9A 3TNDA 4H0NA 3NBAA 1N5YB 4D3XA 2GKSA 3QGMA 1GAXA 4FW9A 3DONA 5EWFA 5J2UB 4IIJB 3MT7A 2W00A 1K73T 3EIEA 3RR7A 5CB4A 4HR2A 2VDMB 2XRYA 4O02B 4Y1FA 1FLDA 1P5ZB 3E35A 1N2IA 5C25B 3IJEB 2TMYA 4TWZA 5H1YA 1SXQA 6CHYA 1T8PA 5TF4A 1DMRA 1T43A 1RP5A 3ICLA 3UKOA 3CUUA 1XAIA 4EJFA 3HU5A 1N7JA 5A8RB 1SJ1A 3O7MA 1M34B 2WZBA 2BZSA 4YAJA 3C6YA 4NCAA 1FMLA 2QP9X 2RB4A 4XIJA 1PYDA 2FLKA 1NSKL 2XI4A 4ZAXA 1W581 1P1KA 2NV6A 4A3SA 3BIJA 2PWAA 4N03A 2DHSA 3UNYA 3K0FA 2E5FA 3KKEA 2OO3A 4RULA 2GZSA 3GYGA 4LI3X 2W6ID 3G88A 4EUHA 3MMXA 4X41A 3OLCX 3BBBA 5GZ6A 4ETIA 2YY3A 1GM5A 3STXA 5K01A 2HUNA 1XRSB 1IWOA 3N0WA 5JALA 3O7WA 2POQX 3VH4A 3Q8RB 4GM0A 3ZHCA 3MQFA 2VG5A 1MAAA 2GKOA 3A3OB 1JU4A 4ZZ2A 3PRBA 3KZNA 5HATA 2YWKA 3GJZA 3I1IA 1N2XA 5L7YA 1ZXLA 1B2LA 3AOCA 1I1QB 3KG0A 3CO5A 1Z36A 2YZKA 1XVAA 3A1UA 2C2BA 1JXLA 1QNFA 4Z9FA 3PIPQ 3H87A 1ZTWA 3VNAA 2I4OA 4QT0A 2PRKA 2QM7A 1RKIA 3IIKA 2OTJS 5KNBH 4NX2A 1I3KA 3NGDA 1L5LA 4C5BA 3UCUP 4W5QA 4AP6A 3HN6A 1WL8A 2ZOMA 3HVRA 4XYLA 5LDGA 2CMDA 4BE7B 2ZUBA 1QFJA 3RSSA 2IMWP 4Q48A 2F9JA 1K5GA 5A6VA 1ZSVA 1VQNS 1ITZA 3SEQA 2ACVA 3PW7A 2G9RA 4CLLA 2B1RA 3BJMA 3JQRA 4KE8A 3AHEA 2QUKA 3H40A 4IRCA 1D7OA 4P3PA 3U80A 3FOWA 1MR3F 3OU6A 1YVFA 5A2QU 1IIBA 1RJWA 2UYOA 4DX6A 2WTNA 4YHHF 4OLPA 4TMXA 5TS3A 4UZSA 2AYXA 5I47A 1T36B 4A8TA 2GF0A 2C99A 2GUWA 4CQNA 2GF9A 4AG5A 2PLWA 5B3JA 4E88A 5DM2A 3ONNA 2HZAA 2F1IA 2BV3A 2AL7A 1FQWA 1FDSA 4FF3A 5E95A 4LN1A 1XR6A 2P9GA 1B7GO 2R62A 5L3VA 3SZLA 2WD8A 3TSZA 1ETUA 3R9XB 2JFOA 1NF9A 4Q82A 2A86A 4IDKB 4IOKA 3TP2A 1KZ4A 4R71A 2DGOA 1Y81A 1IK4A 5EIBD 3HTXA 2AKEA 1A9XA 4L6V3 4M6WA 3R5BA 1TO6A 1M3SA 3UGTA 2VRCD 1AUVA 5C5IA 3RK1A 2Y0EA 5LXRA 2WYWA 2CNKB 2ZIVB 4P0QB 3UWKA 1NXTA 3I0MA 2PUEA 4HACB 2WMDA 5K3DA 4C4TA 4QR1A 1QLNA 4E33A 4NXNF 5B6JA 3OL6A 4OHYA 3KMSA 1EUYA 1Y6JA 3BMQA 4JJKA 1YRAA 5KAMA 1IJEB 3R3UA 1BQNA 3JQAA 1XTPA 4YCMA 1U1DA 2C4HA 3G13A 3M2TA 5JVDF 5AKHA 3UV6A 3OTQA 4ZJOA 2XO7A 4Q1BA 1HWUA 4UU1A 5LL6P 2DCMA 2H59A 4IDEA 1WHYA 4PRYA 2H2AA 4DCUA 2WWWA 1NT4A 4JYMA 1Z18A 1JG2A 1R9MA 5A3VA 2KX7A 5SICE 4DQXA 4LXIA 4PU0A 4HI1A 3R6TA 3D8UA 4HDKA 3DBLB 4IO1A 1JIIA 2YQ1A 4JK3A 4CTKA 1E9FA 3EXHA 1E2UA 3FUTA 3NP5A 3COPA 4AU1A 2DNYA 3N8IA 3Q3JB 4EVIA 1NASA 3DRYA 5AVOA 5DXAA 1JFLA 4ZA1A 4F7DA 2PZMA 4FIZA 2YH1A 3FF1A 4CG1A 2RG7A 4DV0B 2Q3PA 1QV9A 1NZAA 1UWBB 1SC6A 3C16C 5BNWA 2N1BA 2VBZA 3FE2A 2WJIA 3T61A 2XQCA 5A3SA 3UN5A 4DE5A 5IASA 1IHUA 2CPHA 3N7AA 1M1NB 3FOAA 3WLTA 4CDMA 1P0QA 4B1FA 1VKNA 4M0LA 2VIHA 1UKEA 2MR6A 1M7BA 5U4QA 5JD4A 1PDVA 4BFTA 4EA8A 5EE9A 4YDHB 3JY6A 1NHGA 1RW4A 1DE0A 4KLZA 2O6HA 3FSGA 3HVHA 4H1WA 2KL8A 4KNWA 1DV1A 1X1EA 2H16A 3KB1A 3AB7A 4CU5A 1IVZA 4PGAA 3FX2A 3MMNA 1CG2A 1KYWA 4WDQA 3TANA 4B32A 1I4LD 2X15A 5IYZA 4P5DA 1DZIA 3HKDA 5CA1A 5J4YA 3UCEA 3K1AB 1YIOA 2H5JB 5B08A 1L3CA 2GRAA 1TKTB 4QIFA 1PW7A 1T6YA 1L7MA 1RISA 2Y76A 1VI6A 3BMCB 1FJGF 5F9HA 3E01A 4D46A 1MNEA 4TRJA 3VAGA 3NLCA 1YJCA 2C9BA 3I5AA 3PIIA 2DB1A 1U2QA 4X1YB 1OA0A 1V7CA 3OT1A 1YZ6A 4J0JA 4EJ0A 2BY4A 1Y9AA 4AF6A 3M1VA 1I5OB 3FZEA 5HKBA 5FKJA 4U7HA 2IZ1A 3AU9A 3ZZYA 2W0MA 4Y3CA 5IM4A 2JDJA 1GL7A 1T6BY 2R7AA 1GV0A 2JRCA 3NTLA 4LC1A 4D2IA 4ZT5A 3GFTA 5A2GA 1R9NA 2I7CA 1Q3TA 4UHEA 4QU8A 1D09B 4K6MA 4PYJA 4WT7A 4NV1A 3HM2A 4DV7B 4ZXFA 3OZFA 3F49S 5J58A 2XGMA 2GIQA 1GEHA 1T02A 1U1GA 2PMDA 4RIGA 4YRFA 2O2JA 3TUJC 4KO0A 4K40A 2O05A 3LWMA 3SZ2A 1Y7IA 3ZEIA 3TINA 5F98A 1AKWA 4TZ6A 1APBA 4PVDA 4DPKA 1UFLA 3I42A 3V4OA 2YY5A 3LXXA 1ZGCA 4MUKA 1BDHA 2AG8A 2WRZA 4RK5A 1RGVA 4HTIA 1I30A 2LP4A 1I6KA 4OHXA 4YQZA 1RWUA 4MLZA 1JDTA 3O6QA 2VH5R 3KVRA 1AGYA 1DKQA 4IHAA 1NW8A 3NX4A 1P5FA 5LNK6 1ISMA 3PQ3A 4BWVA 1QG6A 1Y5IB 2J41A 5CABA 4LUCA 2XWYA 4Q5IA 1JNXX 1B99A 2QRNA 2BKVA 2X41A 3J81Y 1ZR4A 1QP4A 1ZIOA 1L9XA 4RHXA 2QF7A 2OLKA 2CQ3A 3TXYA 4BDPA 3P9PA 2VDNB 5DK4A 2FEPA 3JD1A 3DEKA 3OD2A 4R4JA 4Q3EA 4K9NA 1EEXB 2Q5IA 3L3BA 5KFLA 5JDIA 4KB5A 1Z2CA 2VDRB 4D45A 1XZLA 1P19A 4HK4A 1J49A 5IJAA 4E4TA 5CT8A 1FUIA 3NTUA 1EGHA 2J9GA 2ZH4A 4ZPXA 1AZSA 3R23A 3L18A 3HJHA 4LVNP 2KM8B 4FYMA 4CNBA 1TM5E 5TT0A 2FSPA 2XYHB 2ZBRA 4M9RA 3JARA 3UK0A 2HGMA 1WY7A 3KOAA 3C14B 2O7VA 1S2MA 2CLKB 1V3ZA 3JVEA 3NYWA 2OO7A 5HIIA 1H38A 1Z33A 4E12A 3MPUB 4AE5A 4A7PA 4PE5B 2GLUA 1X5TA 2QLMA 5ER9A 5KB3A 2NZUG 2GVDA 2SHKA 5CT9A 2C78A 1WEKA 3LUHA 3SP1A 5CYFA 4RLQA 2IDEA 4YAWA 2G1JA 3DBHA 4XGRA 3ZTOA 1NHWA 4AL7A 1YB1A 4J2TA 5DCYA 4NU8X 3I5BA 5E7IA 3KYJB 2CA9A 5CBPA 2COLA 1JKIA 2JVJA 3HCPA 4UOGA 4MLCA 4FF1A 4HQRA 2R7OA 1QO0D 2MY7A 1V8BA 3VR6A 1YBTA 4GPD1 2P11A 3RUEA 1KBRA 4Y2TA 1SC4A 3LWNA 5FWYA 2WJYA 2AOVA 3BCRA 2R3SA 1RP1A 5IF3A 4ZV4A 1T9VA 1JDBB 3PX6A 3C3KA 1IC6A 2PYDA 3JYOA 3EGDA 4PYOA 2ZRFA 4UNQA 2ERRA 4L08A 4JL8A 2EV9A 1UPUA 3QEAZ 5TB5A 3ZR4B 3QQCD 1VA5A 2PV0A 3ET4A 2GMLA 2FP3A 2IM1A 4B2IA 5AXNA 4XDHA 3GCXA 5JSZB 1QMPA 1NRXA 3IA2A 5EJGA 4ICLB 1B6GA 4A0HA 4RUBA 1UQTA 3HSYA 4PTYA 5L3SA 3GNLA 4ER8A 2DHDA 2VN8A 3DZHA 2QV6A 1MROA 1HOXA 1S1VA 2G0IA 4F0JA 2RKIA 3L8CA 4L5AA 2CQCA 2BJDA 3BS4A 2V4RA 3WAGA 1U28C 3M1YA 3U44B 1TUGA 3Q88A 1Z3IX 4I6YA 4B09A 2C5EA 2VQEJ 4G25A 3OKFA 3GLUA 2D00A 2C2WA 4E5SA 3CNQP 1EETB 4XTRA 2I7DA 3QIPA 5LM3A 1S76D 1X7YA 2JLBA 1M6VA 3M5PA 1U0SA 4UM9D 4TQAA 1XG5A 1FESA 5BSHA 3ZGXA 3O4HA 3I61A 1OVGA 3FZGA 4JNKA 2FJXA 1KVTA 1T2CA 5G2OA 1YR2A 3JSMA 5IG2A 1XNGA 1JIUA 1UAGA 2VSFA 3CCFA 3GVPA 4MI1A 1WXQA 1TAHA 2W4CA 3TEMA 2Q5QA 3L3CA 2ODBA 2J09A 1Z0JA 1CJTA 1THMA 1ZPDA 2JS7A 1F8GA 3DZDA 4KITB 4G1PA 1ZXBA 2DHXA 4X94A 3WAJA 5LQNA 1LQ2A 1M0SA 3N5BA 4RIHA 3P9YA 3OOHA 2XQVA 2DERA 1T05A 2PFDA 2Q3FA 1PL0A 3UM9A 2V2QA 1DX6A 2GA8A 4EUVA 4QT4A 3FBBA 2IYNA 2AD5A 3E7PA 3WS7A 3HD2A 4JOQA 1PNQA 5GTDA 4D4IA 2WU3A 4DUYJ 1VQLS 2HNYB 1DEOA 1KMMA 2NZJA 2BF7A 4LUBA 3HDJA 5BN5A 1B64A 3DW3X 5L8RC 3T0IA 4YCLA 5JBIA 1O96B 5AWFC 4KLRA 4BMVA 4D8VA 1XMOF 1BZYA 1CWUA 4R41A 1XPRA 1LUAA 2ZRPA 2VKTA 4Q7QA 1D5WA 3N58A 5DN6D 4JDUA 2ZIEA 1L5HA 1TUWA 4L5BA 3EPHA 3PW0A 2AFVA 1U6FA 1KQOA 5BUZA 1E5LA 4Q3NA 4NZYA 3TF5A 1DJNA 4BS2A 4YQEA 2F63A 1H4QA 4ZZIA 3DXZA 2HHTA 1JDUA 3UJ8A 3MT9A 5HMXA 4DA7A 2O2XA 4ARCA 3WLAA 5ESXA 5E33A 2J6TA 2QL7A 5U1PA 4IVQA 1HDRA 5ALFA 1P2GA 2WKWA 4E2YA 2AOXA 5F7OA 2O5EA 4LYFA 3KSMA 2KYRA 4LSMA 2OXFA 3N2KB 3EUAA 1U11A 2FPKA 4Y0VA 5JCJD 3PZBA 4NOKA 1X5SA 4ELVA 3DVAB 4IQ0A 2Z1NA 3AOEA 4IUDS 3EZLA 2PX8A 2W9BB 3KLGA 1TQ2A 1CVIA 3MJRA 4DKXA 2GLXA 4PQGA 2IRYA 1Q50A 1OY8A 2V3VA 4OZLA 3IDAA 2NUHA 3PKYA 1V11B 2V4JB 3C2PA 3R7WB 4BCCA 2AI1A 3VFDA 3IA7A 4LXUA 2C2EA 1UKUA 1ZH8A 1ZFNA 1KOGA 1XEZA 3QX9A 4DCJB 2KYXA 5TPWA 3J81U 3OJXA 4F8YA 4I9FA 2DJIA 4EHFA 1DUVG 1T34A 1GOTA 2QRVB 4FFSA 3H65A 1KDPA 4IQ4A 4EPVA 3I6MA 3T7DA 4G0ZA 1MIOB 2OPRA 4N01A 4TV9A 2UVVA 5ESRA 3A0RB 5BN4A 3R0JA 4WFXA 5EMJA 3E27A 4GZ3A 4MZDA 2XMRA 2ZVPX 1E0AA 3S2ZA 2WP0A 2Q6BA 2FR8C 2O2SA 4O4HF 4BECA 4L3VA 2IAJA 4MGIR 1CQJB 1I2CA 2RFLA 4H0FA 2RQCA 3MMSA 3G23A 4FXVA 4CO2A 1JLFB 5JFTA 3U4DA 5J4LA 4UBJA 2EHJA 2FVYA 3TGLA 5K0TA 3GRFA 4X4VA 1MEEA 3GG2A 2XNKA 1W88A 3ORQA 1AROP 3EIOA 5CNMA 2IX3A 2W6PA 3QYFA 3L0OA 1KLMB 2J08A 1NB7A 1QCDA 1S9DA 3CZCA 3MGKA 3A1SA 2OCBA 3L7YA 3DWIA 5CJJA 4UTRA 1BS1A 1LX6A 3DR5A 3FNFA 4IOMA 2OEKA 1H7XA 3QE0A 4BLGA 1JL3A 4Q1DA 4PR3A 5ARBA 4FNMA 3NTVA 4YUWA 1O5JA 2CWKA 1L4GA 1Z7WA 2A6OA 4KODA 4LJSA 4P38A 5EHZA 3DKKA 4LXQA 4U7FA 2ZRLA 5E6SB 2J3EA 4JT9A 2F4VF 3RHFA 4CKWB 3T38A 2ZE2A 1OASA 2C7GA 4KEAA 2Q2VA 3HXTA 4JUFA 4TTQA 1JHUA 4ZLNA 2YJ6A 4NEYA 1M1HA 3H5TA 1XRNA 5CTAA 1KO4A 3WGIA 2FHPA 5GONF 2FQXA 4KKXB 4HN2A 5DVZA 3UOGA 4FFOA 4IXTA 4Q0BB 2AX0A 1QRUA 1KTIA 4FSHA 1VS3A 2O0JA 5DF1A 3AXSA 2A7XA 2QSZA 4TYQA 2EZUA 3EFOA 3CDUA 1F06A 1SUAA 3G7UA 3GJRA 2ZTSA 3LHSA 2HFZA 3QU9A 4XWAA 1KERA 5H9VA 3PFWO 2VDWA 1AJEA 3ZWAA 2FDXA 1MA3A 1QE1A 4JLKA 3Q8QB 4I50B 4HAIA 2NP6A 1K7YA 3T5TA 4LMBA 3RS4A 2E48A 1UBFA 3CA8A 2HBZB 1GPUA 3TFOA 3GFGA 2ORWA 3N8HA 2IUSA 1LJUA 3NV7A 1KHHA 1UXJA 3DP9A 1Z83A 4P4SB 3CRW1 4KV7A 3N8GA 3O84A 3HI4A 3BXFA 3NL0A 4XWOA 4QYZJ 4EHIA 1H6KX 6REQB 1VE9A 3OC0A 3EZNA 4LSLB 4RW8B 2MINA 3KETA 2R2RA 1Z82A 3WO1A 3RIGA 1F7VA 1N1GA 1QG2A 4HDSA 1BMFA 2C57A 1T4BA 2AIRB 4YAKA 4BKRA 2RU9A 3K5PA 3GJ8A 4ALKA 2HSDA 5CH7B 4LVNA 2HN9A 3V81A 1FK9B 1EVKA 2C7RA 4RLFA 1NKSA 2R8JA 2AXEA 4M5LA 1B00A 1UJ6A 4RFLA 1XMQJ 4ZANA 1QHEA 1WBJB 3OX1A 2P4HX 1W5EA 3G82C 4P3OA 3D6HA 1YZUA 2B25A 3I04M 2FFQA 2F8EX 4YB1P 4Y2QA 4URVR 2IRWA 2LR0A 2WF6A 2WF9A 4XD7A 2ACKA 1E3LA 3ZWYA 2RKWA 1KMHB 2FUG9 2P5SA 5JSKA 1MX3A 5JJBA 2FF5A 4RL1A 4G41A 5T7BA 4NA1A 1UWLA 4OJYA 5CVCA 3PUVA 3IPYA 4TKLA 2DFVA 3TIIA 1M5PC 4ZEVA 1TUBB 1DX9A 1E5TA 1ESNA 1Q95A 1QK5A 1N4DA 2XJ4A 3VQSA 3D81A 2QY9A 3C3WA 2VK4A 1VZ3A 4ER0A 5HJ2A 3V1TC 4DWIA 1UBLS 4RIIA 2ZYSA 4F4JA 4ECVA 3A26A 4JLDA 4QOTA 4QBGB 5K0NA 1PJSA 3DDCA 1P8AA 4HB0A 4HAWA 5IXYA 4ZPJA 4DV3F 4H4MA 4YAGA 2X3UA 4FT2A 3IOEA 4EG8A 2G2YA 2OBXA 1LJ8A 5D3GA 4BGUA 3SS7X 5LQMA 4TOIA 1A71A 4YP7A 3Q8WA 1KF0A 4DF4A 2XYQA 4LOAA 4E5NA 1U7PA 2B1QA 1PP4A 1RT7B 4TYBA 1UOQA 4DMKA 3CC4S 2CWDA 4A91A 3LK7A 5B4UA 1XO1A 2EC5A 4URFA 2Z2MA 4R98A 2W8BB 3KLBA 3R3TA 4UDOA 3OQ6A 4DKJA 3L7DA 3FMFA 5DKFA 4MWSA 2Z5FA 3CSSA 4J49A 1X14A 5F5LA 2FSVC 1Y63A 1J09A 4TZTA 3TD2A 3RF7A 1XIQA 1T0HB 4G5OA 4A8MP 2Z2ZA 4G0WA 3B1WA 2XLJA 4KHPJ 2YWWA 1GD1O 3ISTA 5EMKA 2JJMA 3LH2S 2R7MA 2X5JO 1TTQB 3A9CA 5KFHA 1JA9A 1AUOA 3I76A 1YQEA 3COYA 4IFYB 1JEDA 2MMYA 4HF7A 1DIAA 5D1HA 2Q6OA 1AA1B 3BK1A 1N4AA 4ZKDA 1CY7A 2BZGA 2HRYA 5AI9A 4YP3A 5FPYA 4E1VA 2QMOA 3VHXA 3PLAE 2X8WA 1FUYB 1NPDA 4GYWA 1K47A 1P4SA 2PDAA 1N56A 5IFKA 1NJXA 4JHXA 4RA6B 5L4SA 2C84A 1UMCA 3WRXA 3RC1A 2B51A 2ZBDA 2WWFA 3OZAA 4IICA 1USUA 4MCJA 1XA3A 5J3JA 4CM8A 2JFZA 2R6CA 4PQRA 4YUAA 5DM1A 5K14A 1BVRA 3TQIA 2DO4A 5D01A 4L8VA 4IO0A 1UBRS 1JI0A 4TN2A 3CLSC 4F96A 4MDFA 5HQ3B 4V24A 2DC1A 5EXDA 3MTJA 3DVQX 3F6SA 1FKAF 1RWKA 1X92A 3FBFA 4X8OA 5BYBA 1GCGA 3G5AA 4EVSA 2CG8A 3BDPA 4A1FA 3OCXA 4J9KA 1Y5NA 1WKLA 3D0RA 3I9OA 2PX0A 2BM0A 5BMOA 3Q3EA 5GAHU 4MA0A 3H6HA 1UWAA 3HADA 1JSLA 2EFGA 1XXHB 5LN1A 4BLTA 3GI1A 3D0GE 3BUSA 1EWTA 1YRBA 1NVTA 3ZCQA 3W1EA 4EITA 4Q3KA 4ZQBA 4MLDA 2RHGB 2Z3VA 3REQA 4PPZA 2EEPA 5KYUB 1JDNA 3QKRA 4GUDA 5REQB 4XYEA 3QKIA 4DOZA 2XNHA 1RAAA 3X1WA 2QSFA 1GRNA 3CC8A 2ZRHA 2VHJA 3G7SA 1Z6XA 3TCNA 4QWEA 3BR8A 3U3DA 1B3RA 4FGKA 2JAHA 1FUKA 4JJZA 1G4UR 2ATIA 2HFOA 2CXXA 4PAMA 1RT3B 1FDBA 5DWDA 3PDNA 2R9LA 1PHPA 4LE0A 3V4SA 2DO0A 3CPHA 4TS1A 3ZU2A 5IFLA 4LF4F 2ZVJA 1HNZF 2ZYAA 1T2UA 2R1VA 3GUYA 2BBOA 3FUXA 2I2FA 1OILA 2RIRA 2Q4OA 3QVVA 3NTQA 2DTXA 5ALPA 5IDYA 2D4AA 2VH1A 3ROFA 1EDOA 4IHJA 2JI7A 1QF7A 4FGJA 3GJYA 4Q4JB 1T6NA 2OK8A 4PZPA 3NB0A 4R8LA 5FUBA 3E53A 4CE6A 3ZCUA 3LZ6A 1Y82A 1ZD9A 1PZGA 1AZWA 1Z2AA 1RHRA 1T9TA 4O6VA 2DGUA 4HS4A 3WL8A 2HQ3A 3GV0A 3I2JA 1G3MA 5EYPB 3PGMA 5IBPA 1NDKA 4PLVA 4II7A 5G4KA 1NO8A 3NT2A 1DLIA 2EP8A 5G4LA 3EEQA 2FLVA 5GM2A 3QWAA 3NHSA 3KSAC 1Z8NA 2G9QA 5DN9A 1N34B 3MPVA 3EF3A 2IE8A 5JUWA 2HHCA 3U1BA 1RZRA 3W1WA 2JLCA 4PANA 2RHJA 3WFIA 1YR3A 4P34A 2J9YB 1Q1NA 3LCJA 3D8BA 2X9NA 3OM1A 4AMUA 1TCBA 1YBFA 1OLOA 4YCAA 2QRPA 2AQHA 4CQJA 1FNNA 5IH7A 4G84A 2C2ZB 2MHNA 4JYAF 3WHKA 1S12A 1WW8A 1J33A 4HAXA 1RWQA 3J80Y 2CNLA 5ES4B 4Q9AA 3DTVB 4F3KA 4M0DA 2B99A 2ZTVA 4P7TA 3U4GA 4QTXA 4BMYA 1BE4A 3RGIA 2HC9A 1U7TA 2GZ2A 2JLUA 4IVNA 3IQZA 5KVSA 3MHTA 2H85A 2DHGA 2OVFA 3D4OA 3OBBA 2DWQA 4UUOA 4P4LA 1WF2A 4DG9A 4D3FA 3IG1A 3H9UA 2QG9B 4TY8A 3VSBA 3KTAB 4LREA 3IP6A 2FHKA 4BRSA 2QTGA 1OY1A 3UQSA 4JHLA 4RKWA 3PTLA 3KK0A 5J59A 3SBDA 3AGQA 3SIXA 3FTPA 1XPJA 1RQGA 4PZCA 3BJRA 2VUHB 2IH5A 4OXYA 1DWUA 3P19A 1K8ZB 3AJDA 4IIJA 4B6JA 4QW9A 1N8RT 3EIHA 3ORFA 4Q9IA 4EJSB 1RWOB 4KGZB 4EO8A 2W2QA 3OT4A 3TJ9A 1HNWJ 2XA2A 5C25A 2EWWA 4IHKA 3ILIA 1MG0A 3OLAA 1EUDA 3WGOA 4HLQB 4MW1A 2BMAA 3ZTQA 4NTZA 1AH2A 1OPXA 1LVGA 3HO6A 2XA1A 2ECPA 4LWQA 1K8XB 2LCWA 2RGCA 4DNXA 1SG0A 3RAMA 5DLGA 4MRNA 3NCRA 5A8RA 4NRUA 5FR1A 5JD5A 3FCAA 1YF3A 4X62F 2AT1A 2HPVA 3V48A 1PEYA 1ZH0A 3KUGA 5AJXA 4WGFA 5EZ5A 3IB3A 2J6HA 2MSNA 3IEXA 2G36A 3PUWA 1B70B 2A9FA 1NVFA 3OZBA 4KGKA 5EKDA 2DT5A 3BXOA 4A8JA 3U7RA 4FXOA 1FTGA 4D3ZA 5L40A 4YMHA 3KUXA 2GJ9A 3L7IA 1QVVA 3SIPB 2ZC4A 3QQPA 4LDRA 4N7MA 4WF9Q 1AGXA 4MDYA 4DV5B 4UAUA 4O3MA 1PKUA 3KJZA 2ZITA 4V19X 1JH8A 4B4UA 5ADZA 3TQEA 3IPRA 3Q1KA 4LA4A 3CDBA 1JVBA 1WVIA 2VF7A 5HP1B 3W8PA 2CLIB 3GZNA 2HNZA 2RVJA 5KNDD 4WXRA 2CNWD 5IZHA 2HK9A 4FDAA 1XVVA 2Q49A 3KLPX 3R8CA 2JLYA 1P6XA 2H7VA 3HKZD 3Q6IA 3VX4A 9RUBA 2XUQA 2W25A 2OQ2A 2R7RA 3CRVA 3KBOA 1H2RS 1NJIT 1KTQA 4U9RA 2NVUB 2FPIA 1NVUQ 1NBEA 4USTA 1EYZA 2BDEA 3FVWA 1JEEA 1X7VA 1SH3A 1ZMTA 4PSCA 3SLRA 4AKSA 4PX2A 4UFOA 1ZGGA 4C6SA 3MMCB 3PHLA 4A36A 4FOPA 2WAAA 4KQIA 4N3GA 4DMUB 2VJOA 2FWIA 2QVXX 3M2PA 5BW4A 3IELA 4MP8A 2Z0MA 4P4NA 2ZXEA 4D3YA 4ZVMA 2QV0A 2DIRA 3L0PA 1VPEA 1V5GA 2BGRA 3KLNA 3L4BA 2BGIA 5J9FA 4M1EA 1D9AA 1NAQA 1ZH6A 4QW8A 1OLXA 1SJFA 1Y4SA 4UW2A 2GZRA 1FMTA 1OH7A 4LZZA 3MWBA 2AJ0A 2DK2A 2OO5A 1RIIA 5IC5A 4FDFA 1M5TA 1T11A 2QX0A 2QT0A 4PHGA 6GPBA 3ESYA 4ZOEA 4KQ6A 3RT9A 3ND6A 5DDIP 3ORSA 4II2A 3EGOA 1C8BA 4FJ2A 3WXMA 3P71T 4LV5B 3JQ7A 3VYTB 1JBQA 2KW5A 3IKMB 4ZVLA 2EOAA 3LWLA 3QIDA 2OHJA 4U8YA 3H2IA 2Q8QA 3CDAA 3KQNA 4E70A 4KBYA 5FIIA 4GBMA 1S6UA 4OXQA 2W24A 1VE1A 4NYZA 2LV8A 1IBLB 3Q12A 3QFSA 5ALLA 1I4OA 5AM0A 1OA1A 5LD2B 4MIYA 2ZRMA 4I46A 1LWEB 4KVAA 2ADBA 4OK5A 4J03A 4C5AA 3C5CA 4AMBA 4WCFB 3FAKA 2BR3A 3P0HA 1MMFB 1H0SA 3QSYA 4KK3A 1LSSA 3VV2A 2XSZA 1YRXA 3ZGLA 2GQCA 1OXBB 1W94A 1C1CA 5HVGA 1M9NA 4P52A 1M1KT 4M37A 4MA5A 2GDJA 3KELA 3HQ4O 3EYZA 1KO1A 4MUIA 3RRBA 3IM9A 4KJXA 5ERGB 3NRCA 1IJEA 3KJVB 2WKSA 1Y8CA 3ZC4A 2ZB3A 2YH0A 3U7QA 1ZUIA 3LSYA 5CURA 2CPXA 2OHVA 2Q0HA 1Y00A 1ZC3A 3SSQA 2H2HA 4IKPA 1R31A 1Y4AE 2P69A 4MKGA 5CA0A 5HQTA 7AT1B 1AURA 1X6VA 1UVNA 3VGPA 1RM4A 5BVHA 5IXUA 1U0HB 3N2ZB 1S1MA 1GXUA 4Q9NA 3BBCA 3J80U 4BBZA 1CQWA 1HDOA 3L6EA 2DJWA 2VG6B 1B43A 3PUKA 1TCAA 4NLOA 4FMCF 4NMMA 4HGRA 4HXGA 5JSFA 1OTXA 3L0IB 5H81A 3GEDA 2BBTA 1RT2A 3TFWA 2GAJA 5A7FA 4MARA 3ZU6A 5AXCA 2NAFA 4MI6A 4PM4A 2ZI7A 2YN0A 2HWXA 1D03A 4GICA 3MAAC 4JGIA 3M8YA 4NZPA 4IMRA 2FJVA 5CDUA 1ZICA 4L8YA 1PKXA 1CB0A 4IQMA 5A9SB 1UWBA 2J5RA 4L4ZA 1RFLA 1RWMB 4IG4A 3LHFA 4K4ZA 1GQOA 4E5VA 4WNAB 1ACMB 4RZQA 5KOYA 5SZTA 3UMFA 1ONNA 4OXNA 4R01A 4UHFA 4XUGB 1W48A 4OB8A 2JEGA 1EM8A 3ZKAA 5B3AA 4CT0A 1AS0A 5HJ5A 5C7IO 4DG1A 1QH9A 5CIYA 1TPZA 2WABA 3PP8A 5A6SA 4NPHA 3ZWQA 1QPGA 2GERA 1ZJ6A 2XODA 4K4TA 2L3MA 3QLVC 1NB2A 2CCGA 1U6KA 1CJUB 4HGZA 4MVWA 4IDQA 1VRQC 4W5OA 3PQFA 2X2PA 1JHYA 2WJJA 4WVLA 4QBHA 1R9JA 4EMSA 2D5IA 4IH5A 4I7FB 3K1AA 2R42A 2D7JA 3IHTA 3LT2A 5ALWA 3OTOF 3D5MA 2JPDA 1JPVA 4MUXA 1UIMA 3KHRA 4HHJA 3LFTA 4EAQA 5M5BA 4DYHA 3BMCA 4AMVA 3MJVA 1PL7A 4UQLA 4WK4B 3ZW7A 5C34B 5IEJA 1PK9A 2QZ4A 4IEIA 3ZD6A 5HROA 1OXMA 4XTCS 3RREA 2C2OB 3P4UA 1VGQA 1BWRA 1I5OA 4PGFA 3AY0A 5AH0A 1GDHA 3Q4GA 5T3UA 2JH9A 2ZBFA 3EWIA 3IAM6 2A5DA 1IG0A 3JTOA 2E5IA 3OJLA 1U9JA 2PZJA 4QBFA 1IPFA 2A3JA 3U1NA 4EHBA 1XNJA 3IIMA 5I7OA 3FRHA 1NXWA 3IJRA 2UZ3A 1I6WA 3UPUA 4KR0B 1R37A 3CIMA 2GJFA 4FFPA 4X1IA 2YR0A 1CERA 2QZSA 1ZLYA 2VZ9A 4N6NA 1ODJA 2JFHA 4NYIR 5G1OA 3TZQA 5F3ZA 3UAVA 3WOHA 3AB2B 5CD4A 2LEAA 2H4WA 3AVQA 1USGA 3IBFA 3A3YA 3M8ZA 1TC1A 5BVGB 3ESAA 4CMCA 2B2NA 2PS9A 1RTIB 1PR3A 1Z2NX 5DQGA 4RANA 5TNXA 3TW8B 4GYKA 4QZVB 1SXJD 2MSWA 5AKIA 4Y2RA 3P9ZA 3LKZA 4HTAA 2XBLA 3TOZA 1TM3E 5C7OO 4EZEA 5ICCA 4FPXA 1JQBA 3JQKA 5IMSA 4MYCA 4DA6A 3LY9A 1DC3A 2C2YA 3FR8A 3F56A 2X5XA 2AC4A 2FW1A 3IMCA 3IP1A 1WQ3A 5GIPE 3VPHA 2MHEA 4OYLA 1X7WB 5FTNA 5AKEA 3WGZA 4WW0A 1T1GA 3X1LB 5AI5A 1BGVA 3PE6A 3GBPA 4IH6A 3HGMA 3PE4A 1Z75A 2UYYA 1W5AA 2QFIA 4TU8A 1ZH2A 2FDRA 3PRYA 2YN2A 1ZX1A 2QM0A 4YAOA 4UUXA 2XMWA 5D15A 4MUNA 1WHTB 3NHPA 4GQIA 1HMVA 2ZKLA 1DAIA 4EFDA 1NE7A 1RPAA 1NPPA 4RY2A 3M7IA 4LJ5A 4BC9A 4F2DA 5JADA 3I6PA 5GADU 2JFGA 2K3IA 2C07A 1XD2B 3H3FA 1SOWA 3NY0A 3DOIA 2HRTA 4BMCA 1P3Y1 3DYAB 1MC8A 2J3MA 4Z9YA 3QBJA 2QB5A 1U25A 4NLVA 1QJ4A 1J8VA 3M89A 4UZEA 4CO5A 1QZZA 3GLGA 5DBHX 1P91A 2JOQA 3I1FA 5F23A 1GADO 4JV1A 4I19A 1NN5A 3UJDA 3FSRA 1A9YA 4H4OA 4DR5F 4LMAA 5FLEX 1OF1A 2ZYIA 1BQXA 1VIDA 1F20A 3LP0B 3L92A 2HNDA 3HT3A 1R00A 1AYEA 2VYNA 3U27A 5H16A 1IBSA 3HL0A 4LF6J 1NXOA 1Q5YA 2YQ0A 1Y3KA 1FY2A 4OX6A 2GTHA 3LP5A 3Q98A 3W1VA 4IL5A 1OREA 3ZJUA 1LBHA 2FQ1A 4DZTA 3I01A 1TZCA 1WSBA 4HDOB 4E03A 4Q0MA 3I5YA 3U9LA 5D1NA 2ZHBA 4QWCA 3O5TB 4BOYA 2NAPA 3T9EA 2PJUA 2Z9CA 3GF4A 2E1MC 2CB0A 1NVMB 3CR3C 4XR4A 3MPYA 3QE4A 3UH0A 4YMEA 3AERB 2PEHA 4Q7AA 2VKQA 3HKEA 1TV6B 4A0QA 1F8UA 5K8JB 4R7GA 4KQKA 2A2ZA 1ENOA 4CJXA 4ICLA 1S8AA 1XELA 2BXJA 2Z8YM 3K9BA 1XLWA 1VKZA 3NGMA 4EL0A 5DM7Q 3KT8A 2GJKA 5IMBA 3P52A 1VISA 2PAFA 1MO3A 3LGMA 4AQYF 3GUCA 2ASYA 2A30A 1AW0A 4ZIWA 4MJKA 4L8WB 1MCZA 3R3JA 5I3UA 3GA7A 3TOSA 1W29A 5DG8A 4OMUA 2BW7A 3FVYA 2DGQA 5EE1A 1K75A 2VJBA 4QU5A 1PJAA 2GHWA 1UBKS 4M5DA 3JATB 2HDOA 3GLIE 1VMBA 1SCQA 2WTEA 4BVAA 1OH6A 4WKYA 2HAIA 3MMBB 2Q6LA 5LT5A 1S0VA 4UFPA 1UW9A 1VIMA 1XKLA 3N2LA 3O4VA 4RM2A 2VTKA 3PYFA 3POTB 2J7PD 1B0TA 5FD8A 1NP3A 4YRJA 4DL0C 3BWMA 1SKMA 2Q79A 4RW7A 2AMJA 2P3SA 2F43B 2UUCF 2IJGX 4DZRA 2G0AA 2DNGA 3MFQA 3WHIA 3KLHB 4FYVB 4LJ6A 4B4OA 1QF9A 3BGVA 4K9SA 3R5FA 2QTVB 1M1ZA 2WSEC 2DH9A 3VZDA 3D7SB 5IANA 5BW5A 3US5A 1ZJ4A 2ASLA 4OGFA 5AVSA 1OYWA 1BRMA 3H2JA 3KUEA 1X3LA 3MLBA 2YHAA 2DQZA 1PT7A 1G4CA 5B0EA 1YH3A 3OF2A 2HGNA 1M2KA 1RJ9A 3MG9A 4GMDA 4X65J 4ZCTA 2ZM6J 4J29A 3KEGA 5E2AA 4KMSA 1Y11A 4TXHA 1DAGA 2ZUDA 1UL1X 1NV9A 4E6EA 2HMSA 4WKGA 4EUSA 3N6XA 1X8KA 1ONOA 3KS9A 3GGOA 1TMOA 1JHQA 2BFPA 3NNHA 3I5MA 2C8KA 3OPYB 1V16A 1CUBA 1NW6A 3O8RA 1JG7A 2IVFA 3LPNA 4WCVA 1ZCJA 1H0HB 3PFHA 2VQFJ 3AHGA 2UKDA 3LVRE 2IHYA 3A04A 5TF0A 2Z04A 1RRPA 5KWSA 1Q0NA 4BHTA 1MT3A 1FIUA 2I66A 4O4LB 2O9JA 3SHFA 3H99A 4D56A 5BT8A 3S1TA 1K7EB 1QGED 4PZAA 2C31A 4NESA 4OGKA 2FRDC 2Z2JA 4XX0B 2P2CB 2PD1A 3PWKA 3EXAA 4P32A 4GOXA 2KG1A 1UPFA 1Z16A 3QXHA 4YJ3B 4C3KA 1CJBA 1QHNA 3AWDA 3DFMA 2W9BA 5A71A 2ZBCA 4K5RA 2ID9A 4PSDA 2RAUA 4WKCA 1O54A 1FFDA 5JAZA 3W63A 3PBKA 4D9HA 3OH8A 1CQXA 1VIXA 4AJNA 2HA6A 4FD3A 2KPOA 3R7WA 4P72A 3D68A 1BE6A 4HN4B 2C5LA 4P83A 3SU8A 5HZMA 4DCJA 3C5VA 4PGMA 1V4NA 1MWZA 4TL7A 1YU9A 3ECCA 2R7QA 1Q3HA 1W4ZA 1XK7A 3OIGA 1SN7A 1XRPA 2ZWIA 3NMRA 4L76A 2MIIA 2QRVA 1WB4A 4L0QA 1ZIXA 3U3KA 5BWBA 3FYHA 1VJDA 2GNPA 1QH1A 4RTQA 1UJMA 2NM0A 2WSMA 5ARDA 3FGPA 3WNZA 1TNDA 3HJBA 1ZNYA 2R6HA 1JGTA 3OR1B 5F77A 2ODTX 1H5UA 1PDWA 4QWBA 2JFUA 1FKOB 5FUWA 2F1JA 1CQJA 4HWTA 3P9CA 2X9GA 1FNOA 4ECUA 4DJJA 3WQQA 3HH8A 1JJ7A 1ZD8A 3IT2A 1JLFA 1TVEA 5LR6A 3K16A 2VJPA 3BBFA 1MAHA 4XUDA 4F2RA 4G5QA 4X60A 2IXFA 1QIHA 4BNJA 3HZZA 2B92A 1Q7TA 2IA6A 2VQEB 4FBUA 4L85A 4JELA 3U1LA 3KZCA 4J0QA 4Y9UA 1EIYB 1TW3A 1OXTA 3MAHA 2JGFA 1R27B 1UFKA 4DUGA 4HLUA 4NCKA 2C61A 1JNYA 3C7CB 1A9TA 4XPZA 1LBSA 2YKNA 1A77A 4ETNA 3W4JA 4NZMA 3DLGA 1MX1A 1IL0A 5JFOA 2JNJA 5JV5A 4R25A 4J9RA 1AA6A 4EO9A 2B1IA 4AL5A 3H5AA 4C7QA 2VKZG 1FDRA 2GH1A 2V8DA 1LPNA 4I4TA 2PUTA 3I31A 3OE7A 4U6QA 4ZA2A 2JLZA 1CF9A 3V2HA 3NLLA 5HP4A 1AG9A 1QVZA 1Y37A 5CK5A 1RWWA 3DMNA 2VHQA 1YS4A 3MAGA 2EFCB 2EKYA 1JKXA 5DP2A 4B8WA 5I45A 1SC1A 1FO1A 4RXTA 2Z2XA 1NTOA 3MCSA 3BCUA 3DRRA 5K2OA 4E22A 1LTKA 2FH5B 4M1QA 3EPIA 3COWA 4QJ4A 3UT0A 2P65A 3CZ5A 1XNRF 1J9ZA 4MYRA 1I24A 3OWHA 4DUYB 1IMOA 4P4GA 1XDDA 4CEIA 1VJRA 3OTDA 4BVGA 4BVLA 3GU0A 3BERA 2DLNA 5HRAA 4NU6A 4I0WB 3BGDA 4KE7A 3RAGA 3DRSB 4MP6A 4P4SA 2HLHA 5TX7A 3IO3A 3W2GA 4OZNA 3ZJ5A 3AHFA 3KAJA 1B23P 2IA0A 4X4NA 1DI0A 4OQMA 2VQDA 1PV1A 6REQA 3GJSB 5BR4A 2PSFA 5CGQB 2JEFA 4RW8A 4B3JA 2HCTA 1BWEA 2ODNA 1XF9A 3IAUA 4RDCA 4FEEA 2XADA 4DC1A 4PWYA 1D07A 1ULZA 2HRDA 1JSRA 3R24A 2HF9A 3ESCA 1ZETA 3D1QA 5FOWA 1DRUA 1BKDR 4B6GA 1KS2A 3A3NB 1N32F 1JJ2R 5DV9A 4UNSA 1R16A 1WG5A 2LXFA 2IXAA 1RAFB 1NI5A 1OB5A 2BUNA 1IM6A 4HRVA 3PX4A 4L2IA 4IV5A 4O4IB 1JLBA 1QHHA 4Z7YA 4CV2A 1ML4A 4RTMA 3OJEA 3CX3A 4D8XA 1QYDA 4NFYA 1I6JA 3SXPA 1DL5A 1SUQB 4HTFB 2WTXA 3NMUF 1VBFA 3H5UA 5I9MA 2XUOA 4MQFA 3EE6A 3RRXA 1RYNA 5CH8A 2P35A 1N8TA 2Y2VA 3N0XA 5IT9A 2HJSA 5E3IA 2MYFA 3E8MA 1L5NA 2HCFA 2HIAA 2F62A 1C9EA 2F00A 1O4WA 2HLNA 4UY85 1M2OB 2F8HA 3VR4A 4LQ4A 4NCGB 2QVCA 1LFPA 3OD5A 4A0RA 2W4DA 4IQGA 5JJCA 2AJ1A 2JHGA 3CN7A 3WNDA 1DO2A 2UUOA 4GMGA 3SXUA 1ZY2A 1Q0TA 4OA5A 4WASA 4IILA 4LJ9A 4I4BA 1LLFA 3K3PA 2JLGA 5C53B 4O3SA 3GFSA 2F3UA 4K1LA 2I3ZA 2XVAA 1PJZA 1WAMA 4BN0A 4QYIA 4RQTA 1SJRA 1VYUA 4NHOA 1T9ZA 2P2GA 4F3CA 2HD4A 1N6IA 4DMRA 3I55S 3OQIB 4KMRA 3KLFB 5CW1A 2FJAB 3TW0A 1Y1LA 1TZ2A 1IDN1 3WLMA 1G8HA 1U65A 3HXPA 3TDMA 1E20A 1WCYA 1BEEA 4P84A 1IZ0A 5K2MA 4U3JB 3PC4A 3R9WA 2QX8A 4ZZ0A 1MRSA 1P3DA 3QNMA 5BYRA 2FMKA 2O2IA 1W85B 5LDDC 4HVZA 1WG1A 3V3TA 8MHTA 1AZLA 5KYNA 1RLMA 3ZCXA 1ZVQA 3CF0A 2PMBA 3BFJA 1G66A 3EQ9A 1CHNA 2H57A 2VDHA 3HFSA 1R0KA 2F3QA 1BQ4A 1ZYQA 3BE4A 1GCAA 1K4YA 1FJ7A 3O8LA 3TAMB 3MI7X 1PGOA 1TK0A 4ED2A 1UZMA 2ADFA 3EW7A 3DOCA 2HVZA 2C96A 1HNVB 3I4CA 4H2DA 3ETHA 4B7CA 3W8DA 1QV6A 1MO6A 2IF0A 2IXDA 4QREA 3T6BA 3QVKA 2GPNA 3AQPA 2AUMA 5JQGB 4X9XA 4HSGA 2W6NA 3AAWB 4ZOLB 1R10A 2GRJA 4L7VA 1GKIA 4YPVA 3ISND 4IFYA 3WQBA 1NM5C 3GDOA 1AKTA 4AJEA 4EQZA 3T1OA 1KH1A 4JT2A 3ZBUA 3P0EA 1C0EA 3ZBTA 4Z7JA 2E4AA 1KWGA 4FUQA 2ZUAA 1C7RA 2OZLA 2JGMA 1T0PA 3IV6A 3MPOA 2Y0SD 3MGAA 5TE9A 4KQHA 5EUQB 4J9NA 3AR2A 1QY7A 2Y77A 3TXXA 1U2CA 3U4MA 4DAOA 2YUIA 1PR2A 2H11A 2FE1A 2J0VA 2FFJA 5G0VA 2O2EA 1TFRA 3FTFA 5DT2A 1T3OA 3ZY4A 4GLOA 2O2CA 1NJWA 4R9NA 1KIAA 1E98A 4W8OA 1Q82T 1U1LA 1VBXA 4JI6F 4B3TJ 2VPXB 1FVOA 5CX1B 1P1BA 1LWFA 2PYZA 5FQNA 1D1SA 3MIIA 4FD2A 3V1YA 2XKKA 5TQJA 4JVOA 2EIXA 1J42A 5HQ3A 2MJUA 2IDMA 3X1ZA 3IXQA 1XNQJ 1OWOA 4HHEA 5IX8A 1E5QA 2D9PA 4HR7A 3LF1A 4DB2A 1V6AA 3A6KA 4LYJA 4XJXA 2B5JA 3LC7O 2O7SA 4KNVA 5IN5A 1LRKA 3HMJG 1Q0SA 2ZE6A 5F1YA 1BEZA 2E5LF 3MMPA 3DM2B 3W3SA 5JEDA 2YS6A 3W5IA 2AYYA 5KFQA 1DRKA 5KSYA 2HWKA 4QUEA 4XYMA 3L7PA 1OSDA 1XMQB 2Q4DA 2FFRA 2PH5A 1VBKA 3P2JA 4CHGA 2PSZA 5TGDA 5KYUA 4L5YA 4QQFA 2ENUA 2DNNA 2CLCX 5KFUA 3AY6A 2EK6A 2XI3A 3G6YA 1A9ZA 2QE7D 2V3CC 4EUKA 1OROA 1NR1A 4RNHA 1VLMA 4O4GA 4OYRA 4A4JA 1HE5A 2OGSA 3EEFA 4R1QA 3BXEA 3CH4B 1RT3A 1CLUA 2WMNB 4EUFA 2XGOA 4PG5A 4HMPA 3EJ6A 3J81k 3EXIA 4TQ9A 1M8PA 4R9VA 4CHTA 5COBA 3BEDA 2WI8A 4CF4A 3G85A 1A2BA 3TSYA 2XT0A 3P8ZA 1RT9A 5IW8A 1QG4A 3O9ZA 4H59A 3AI3A 1HSOA 4N0PA 1KJNA 1REQB 2E4UA 4LDPA 3AU8A 4YRZA 2ZYDA 2VRBA 4LHSA 2Z2IA 5AVZA 2GI4A 2O3SA 2FPPB 1JIJA 3FY4A 2B6AA 4F86A 2DEIA 4S1VA 4Y6RA 2CL6X 1TRKA 3S44A 1CC8A 1CS4C 4B43A 2UUBF 2CDBA 1G3OA 2WYOA 1NI3A 1B16A 4IJQA 4B02A 5KFPA 2FAXA 6AT1B 2BKLA 3PJFA 1PNVA 5D00A 4QU9A 1WXIA 1R8SA 3B2NA 3E7XA 4IJVA 3F4BA 4S1OA 2GAGC 1JPNA 2AW3A 4YT4A 2YJGA 3FCHA 1JE1A 1RLTA 4P36A 1URRA 2RH9B 2RQMA 1IULA 4Q1CA 3ANYB 2NXNA 4DR2F 4FR2A 4QDJA 1HYQA 5EN4A 2CVZA 2RC5A 4J16C 3SVZA 3C24A 4DZDA 3KCQA 2ZWOA 2J0WA 5FLXA 5E1BA 1NI4B 4KHPB 1P4HA 3SVTA 2P8JA 3DTVA 3K1YA 4ED0A 3W3AH 3HYRA 3S2IA 4CO0A 3CBQA 1MO4A 1R6AA 1X5OA 2UU9F 2X7HA 2RIPA 2EARA 5CHYA 4QWAA 2YX4A 4F0KA 1Z17A 4KLNA 4J5OA 2D8MA 1WF3A 1T8EA 4UM5A 4D25A 2FEWB 2PANA 4JR2A 1V3RA 3MS7A 2GQ2A 1CVJA 1SXIA 4O0NA 1AO3A 6FDRA 3PKZA 1MFPA 1JDPA 3IAS6 5KG1A 4LQCA 3N5KA 1SIBE 4IIXA 2X4DA 1CD5A 2Y0DA 2VFSA 4LFCF 5ILQA 4TLAA 4HEA1 5F7JA 4DPMA 1U4SA 1EFVB 4GXRA 2YNIB 2WAYA 2UUTA 1X8JA 3HKBA 1XU4A 2GFQA 5BRNA 3F98A 3UMCA 1RWOA 4KGZA 5DJBA 2TSYB 4MKIA 1XCGB 2HHPA 4G09A 4ETZA 3ZZUA 2YMLA 1QHFA 3C7KA 3NOVA 4F4HA 1ZOTA 4DPUA 4U7CA 1G20A 3FI0A 3KAPA 2BGJA 2A94A 1FDAA 1EQ2A 2AJTA 3C5WP 2Q1YA 4TTSA 3TRFA 2OMOA 3SI8A 2JIZA 4HZUA 1K3FA 3Q5GA 1RA6A 2OCGA 2FR1A 4HB2A 4MRAA 1XL0A 3Q0AA 4ECRA 2AS0A 1BXKA 3QENA 1SURA 5T6MA 5EUCA 1KEPA 4YA6A 2JC3A 4UEJA 1A2KC 3M8KA 5CXTA 3HXLA 1SBQA 2ISCA 1G8GA 1IWAA 1OR8A 3KK1A 2SCUB 1RTDB 4GE3A 4YP6A 3D3WA 4HGYA 4LMRA 2H2WA 3E5RA 1OS5A 4PAGA 1NH8A 4IXNA 4PXAA 2OYRA 3Q83A 3UUEA 1LQUA 4XWYA 4UPVA 1DDIA 3SOPA 3T9DA 3WYBA 1KEWA 3P32A 3W78A 3T3HA 4C4YA 2PL1A 1DFGA 4OV6B 1QKJA 1STOA 1SM4A 3SCZA 4AUEA 3GPDG 4D5GA 5DT9A 1PJCA 1K4KA 4N47A 1YR9A 1KI6A 2FEAA 4BFVA 3BWBA 1P6QA 3F6PA 1ZJ5A 4Y0FA 3FYSA 2ILYA 4DQDA 3CNHA 4AL6A 1CU1A 5LJ3Y 3A1VA 3UO0A 2C5BA 5SYMA 4J07A 2CG4A 1QHGA 3CNNA 3G1UA 2PR7A 2A9QA 3V5RA 4OK6A 2X13A 4FSDA 4QOHA 1P60A 2B4RO 3GNQA 4YTEA 2PX2A 1CUAA 4DPWA 4DL2A 2COEA 1NG9A 2VUTA 5LP6B 2NZ2A 5LYJB 5J2PA 3E2IA 1T4CA 3Q3GE 4O4JB 3GDFA 1V1MA 4TL8A 2W9AA 3PEUA 4OJGA 3D6JA 1N5IA 4NXMF 2I9KA 2D3O1 4XOIA 4RW6A 3HSJA 4YRTA 3E3LA 2OC9A 3DBRA 2GVZB 4PPFA 3R0VA 1I3NA 1XZMA 2G9OA 1K0UA 1KI1A 1Y6ZA 2AN5A 2BZ2A 5J4HA 3E22B 1Y6GA 3M1IA 2J7KA 1E2NA 1DX4A 1FU7A 1UDCA 1QD1A 2JLFA 1CR2A 5A5FA 4R2JA 3D1VA 3WQRA 5J1PA 3HYLA 1DTTA 2RGNC 1EFCA 3HHLD 3PUYA 2FN3A 3UAXA 1L3TA 2DHCA 1NVDA 4JJ7A 3IX7A 2GUGA 3K70B 3PXUA 2HEKA 2CD9A 2BQRA 3QWHA 5GAEU 3H2VE 2YHIA 3QRQA 3P94A 4NXNJ 4QC2A 2HMIB 3M83A 5JXJA 3M9OB 3I9JA 1FI4A 1Z39A 1GVHA 4OB7A 5ILOA 1IKYB 4YREA 4K6GA 4BGIA 1MO5A 1U3CA 3M34A 4ZPCA 4WCFA 1UOPA 1NFRA 4MQUA 4GLBA 2GILA 3AOBA 4X6UA 3RG8A 4QD3A 1L7QA 2KI5A 1I51A 3EEBA 2GR9A 1WOYA 1TKZB 2DHHA 4DIDA 1X8XA 1TQHA 3IURA 2GCFA 4OI4A 3M8WA 5D4NA 1HWLA 1Q7RA 3N2EA 5TARA 3USZA 3P2OA 5CA5A 1SY7A 3UQYS 1A0OB 4V0MA 1EGMB 1MQSA 2GNOA 2ZH3A 5TEWA 5CM9C 2L0XA 2E2WA 1FW6A 1PYGA 4ROSA 3R6LA 4C8YA 3GCDA 4HQ6A 1GTHA 4YH1A 2WM9B 5K03A 4DR7J 3NWBA 4M5MA 4RMHA 3HSSA 5A8WA 3NBPB 3KQKA 1Z4JA 2PMZD 1HNWB 2NYVA 1FXWF 1XSEA 4H60A 2A0XA 2KMLA 2IHR1 3GVIA 1T9HA 1IOZA 1M2WA 1DG9A 1KIMA 5CDFE 1ID1A 3O0DA 4EG5A 3C1OA 1IQTA 3E5HA 4J37A 4DM3A 3CLRD 5KFMA 4HCJA 4CTOA 3A4LA 3KVNA 2FJWA 2GD0A 2R4TA 5C1DA 3T5JA 3ADPA 1U1CA 4BGEA 5EXSA 4B40A 2J3LA 4PICA 2W6CX 2BGTA 3KEFA 5EWEA 2Y1JA 3PHBE 2HTEA 1VFNA 2GEVA 2IRXA 5D51S 3MXHP 2IUYA 3BCSA 2H1IA 4OQLA 3M8PA 1EINA 2ZT8A 2JAPA 3ELWA 1LPMA 5FL7D 2V8OA 3IH5A 3SQDA 5CLJA 4GL4A 2OLJA 4CI0B 1QC5A 4MJXA 1FJGJ 2JW5A 2BJHA 4FHDA 4N77A 4I7EA 4PIMA 1YQQA 3C1AA 2BQUA 3AKYA 5K0FA 3JAKB 2PX4A 3A3PA 2OQVA 4FGUA 4WIAA 1VSBA 2QJFA 1EFUA 3BJEA 4G0PA 4CF3A 1DSSG 4OHWA 1DHRA 2Q7OE 1A4XA 1W44A 3PICA 4P7FA 3K92A 4G0NA 1MP0A 3ZDDA 3QVGA 4F72A 4GRIA 4A6EA 5IT4A 3DLEB 1N6RA 4HQOA 4U2EA 3EDCA 3B6MA 2IY5B 3D0OA 2X0JA 4TL6A 4LRYA 3AUSA 2OP0A 1OC2A 4ARZB 3N53A 3RIYA 3GLVA 3M30B 3UCFA 4EFNA 3SV3A 3PC3A 2R8IA 1YVRA 2ZT5A 2RHMA 4ZVHA 4CIYA 1QK4A 3FDFA 2AFIA 2OORC 5H83A 4BO7A 2XA9A 8RUCA 5KTMA 1LXNA 3PENA 3OWOA 4KR0A 3FNRA 5AHOA 5BYSA 1LFDB 2RGYA 2LZ0A 3RARA 3O5AA 1BS9A 5KQLA 2Z09A 3UV3A 2I34A 5L95A 2EG9A 4DDKA 3AR5A 4PXBA 2B7CB 3HE3A 3UBTA 1ZMOA 1IZYA 3MR3A 3TW8A 4DJFC 2X40A 5M7EA 2C9YA 3UMVA 4IUBS 3DLKA 2PKWA 1DQRA 3BF4A 4AY2A 1ST3A 2RGWA 2W7TA 5EZQA 2C0QA 1AA9A 1S1UB 2QUBA 2MTLA 2PRSA 3RYCB 4Q3LA 4MNTA 1AGRA 5CT5A 4EF6A 3V34A 1RXVA 1HYEA 4IP0A 1EZZB 1XTTA 1J5OB 3L6CA 3RANA 2W4IA 2YC2C 3QKUA 2IS2A 1QUVA 3D2AA 4MVCA 3MCZA 1KYIA 3SMQA 2HNBA 1MRZA 1K0FA 5J2TF 4E2FB 1XC9A 4FZRA 3GRAA 1A8SA 4EHHA 4M38A 5FFNA 3Q72A 5F73A 2X5OA 1ODFA 3OR2B 1ARZA 1OHHD 4M9XA 2IK8A 1MB9A 3H6GA 5EJ7A 2MMGA 2QR2A 2MWMA 3W2WB 1E18A 4UOHA 1TA9A 4D9MA 4GPTA 5K8IA 2F55A 4UVIA 4RORA 3F8WA 1XD2A 3IRUA 2V68A 4TXJA 3ADAC 1EQUA 3NYIA 5CDYA 3AB4B 1JIVA 4XGIA 1M75A 1NN0A 2XCSB 3T4PA 5ALUA 2WF8A 2XEXA 4M9QA 2YWJA 3IT0A 4WP8A 2CKWA 1CE8A 1H2BA 2HRZA 2WCXA 2YKOA 4FHCA 3D7NA 1TMMA 4KGMA 4QOSA 3RV4A 4H7HA 3KLMX 1N5YA 1XTIA 2SBTA 3WGHA 3FMIA 2AGOA 5J2UA 1A82A 5IXSA 4P8RA 5EJ4A 2DBBA 1H9CA 4DV2F 3TEFA 4HYKA 1VBNA 3CEHA 5G02A 1JMVA 4NEGA 1RKBA 4NV0A 5HSGA 1E7QA 2HBQB 2QLWA 1PR4A 2HRQA 2FN7A 1DTSA 2APOA 2LCIA 4IGEA 1PSWA 1NPTO 4CNYA 1T91A 2OV8A 4NI2B 1XD8A 4DXLA 5AE1A 4ZZ1A 5JG7A 5E3AA 4PO8A 4IUFA 1M34A 2XM3A 3LK6A 4ZD6A 3K94A 4HNTA 4G0UA 4HGQA 2W0SA 1KK3A 3GIDA 1T8TA 4BUZA 1YDGA 4JL6A 2EYUA 1S7IA 1Z15A 3QVUA 2WMOB 5JMPA 1A9NB 2AJ8A 3GIMA 2J3JA 1RYZA 2QEXS 1KE1A 1FSZA 1IUOA 5JEEA 3PC8C 1YTUA 3T5LA 3O4RA 4PYIA 2CQPA 5A05A 4FFWA 3C7AA 3EVEA 3SSMA 3LC2O 2IIPA 2ZH8A 2QTLA 3EWSA 3UJ9A 3MUOA 2GYVA 4K26A 2QC3A 1H94A 4YBZA 4H7KA 2X8AA 2HH9A 3DL2A 1IZ8A 3A3OA 4NYJR 1AK9A 1XDSA 5AJUA 4G8DA 3TN7A 3BIWA 1RI4A 3Q7RA 3A13A 1HL3A 4LRUA 3PC6A 1GUAA 1ADBA 3VC7A 4GD3Q 4DIOA 4DSJA 4M1WA 1U9IC 1VG9B 3VAJA 1IFXA 5EG5A 2BEKA 1L5YA 5JMOA 3A6PC 3W7VA 3LALA 1S4EA 3L8EA 1C8KA 1KYTA 1CQZA 2VJMB 3LCUA 1X1DA 1RKVA 4U4AA 3SYNA 1TKAA 3MCUA 3HHDA 4E5YA 1XYVA 4BIMA 4BCBA 4YRAA 3HRIA 3R7LA 3BV8A 5EPOA 2BFCB 1I36A 3CNEA 2ID7A 4P3XA 4BATA 1RAGB 4G9BA 2J59A 3DHVA 2ZQZA 1DWPA 4DWJA 3P5BP 4IUYA 1SQGA 2NREA 1J0AA 2IBOA 3WKAA 3K4PA 1FA9A