4AUKA

Crystal structure of c2498 2'-o-ribose methyltransferase rlmm from escherichia coli
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
357
structure length
355
Chain Sequence
MNKVVLLCRPGFEKECAAEITDKAGQREIFGFARVKENAGYVIYECYQPDDGDKLIRELPFSSLIFARQWFVVGELLQHLPPEDRITPIVGMLQGVVEKGGELRVEVADTNESKELLKFCRKFTVPLRAALRDAGVLANYETPKRPVVHVFFIAPGCYTGYSYSNNNSPFYMGIPRLKFPADAPSRSTLKLEEAFHVFIPADEWDERLANGMWAVDLGAPGGWTYQLVKRNMWVYSVDNGPMAQSLMDTGQVTWLREDGFKFRPTRSNISWMVCDMVEKPAKVAALMAQWLVNGWCRETIFNLKLPMKKRYEEVSHNLAYIQAQLDEHGINAQIQARQLYHDREEVTVHVRRIWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBOSOMAL RNA LARGE SUBUNIT METHYLTRANSFERASE M
publication title Crystal Structure of Rlmm, the 2'O-Ribose Methyltransferase for C2498 of Escherichia Coli 23S Rrna.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 118
structure length 355
sequence length 357
chains with identical sequence B
ec nomenclature ec 2.1.1.186: 23S rRNA (cytidine(2498)-2'-O)-methyltransferase.
pdb deposition date 2012-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01728 FtsJ FtsJ-like methyltransferase
A PF18125 RlmM_FDX RlmM ferredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2810 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4aukA01
3.30.2300.20 Alpha Beta 2-Layer Sandwich THUMP fold THUMP fold 4aukA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4aukA03
3KQPA 2N47A 1XCJA 4P7KA 5CVUA 5DLYA 5CUQA 5EMLA 5FUBA 4YV0A 3GCZA 2IBTA 1BHJA 1VIDA 3M6VA 1G38A 3A7EA 2NP6A 4YV2A 5C9ZA 3KPWA 1YUBA 2OB1A 2ZWVA 3P9CA 4CTJA 3OZSA 3E23A 5DRTA 4HC4A 3CVOA 3BWBA 3ELWA 4R05A 1QZZA 1FP2A 2HR1A 3P9KA 4B17A 3ID6C 1INLA 3FPHA 3MTIA 4RTJA 1ORIA 2B3TA 3PVCA 3HCEA 3O31A 4KVZA 3MB5A 4E31A 4MHTA 3T7TA 2AVNA 2XYQA 4OBWA 5D1NA 3GRRA 2YX1A 2PV0A 2H11A 3G88A 2IBSA 1VP3A 3HCDA 3EGVA 1YFLA 2Y1XA 3TMAA 1NW6A 2FHPA 3EVEA 4KDCA 3SMQA 2GB4A 3UJ8A 5EKXA 2G71A 4CKBA 3G5LA 1NW5A 5FA8A 3UA4A 5LQRA 5EIFA 2BH2A 5DWQA 4A6DA 1JQEA 1QANA 4RTRA 1NV8A 5HEKA 2BM8A 5E1BA 2ZBPA 3DUWA 4GUAA 5FULA 1AV6A 3TKAA 3ERCA 1NE2A 4Y30A 4GBED 4QPPA 2IDKA 2O0LA 5E1MA 2XVMA 5K05A 2PWPA 3H2BA 3EVGA 5EGSA 1YZ3A 2B25A 4PINA 3LX6A 3GDHA 1RI3A 3EVDA 3FUWA 3SGLA 4ER3A 5HIMA 3HTXA 3OPNA 2I62A 2NYUA 3HVKA 5DTRA 5FWAA 3VC1A 1WS6A 5HILA 3JWJA 5JUWA 1ZHFA 4G56A 5H02A 1XXLA 3RIEA 2BM9A 5FQNA 3BWCA 5BP7A 4RTPA 3M33A 4RTSA 3LCUA 1UFKA 2QM3A 3NDIA 3R24A 4QVKA 4X61A 5DTMA 3UJCA 2E5WA 2OYRA 3X0DA 4OQDA 1EAMA 3VC2A 3FUUA 5U4XA 5GOZA 2AOTB 2AOUB 2HNKA 3P97A 1P1BA 5F2OA 1KHHA 1RJEA 1NBHA 2QE6A 4PYIA 3QV2A 4AZWA 2NXCA 3DP7A 4U7PB 5BW5A 3KPYA 2BR4A 2O57A 1NBIA 2QYOA 3HNRA 3KHKA 4PWYA 4QQNA 3LKZA 5EEGA 5EHGA 3Q7EA 5GM2A 3AXTA 5ICFA 3PTAA 1R6AA 5DSTA 3G2OA 3UJ6A 1RJDA 3NW9A 5DXJA 3ER8A 2IDJA 1IM8A 3RW9A 2OPBA 3C3YA 3T7SA 2AN3A 2G1PA 3EVBA 2H00A 3AWIA 2QY6A 1L3IA 5P8WA 4ISCA 3UJDA 4P7GA 5C0OE 5LQJA 3P2IA 2YVLA 3NWEA 3R6TA 4C4AA 3SSOA 5K01A 3EVFA 3KPUA 4E33A 5EQJB 1JQDA 1RI2A 2A14A 3P8ZA 4XUDA 5EC8A 4YUZA 3E05A 4MIKA 5E1DA 1R18A 3A27A 4DA4A 1U2ZA 2C7RA 4HRAA 1AQJA 4E2XA 5LQNA 3B3JA 2PX4A 3FTDA 1SKMA 5EMMA 3DULA 3AXSA 3LCVB 4PYQA 4RX1A 4C03A 5LSAA 3OZTA 4BP3A 4C05A 2WA2A 3FUTA 4AUKA 4FZVA 2OXTA 1VPTA 5DX1A 3OFJA 3V97A 1L9KA 3EPPA 1Z3CA 5DX8A 2UYCA 3TR6A 2I6GA 3I53A 4PONA 1ORHA 3C0KA 1M6YA 3UZUA 3KKZA 1KPHA 4CWAA 2IIPA 2AVDA 3B3GA 1EIZA 1X1BA 5E9QA 3P71T 5K0LA 3TFWA 3B3FA 2P3QA 3HCBA 4E2WA 5E1OA 3BKWA 3HEMA 2R3SA 2VDWA 2XYRA 2DPMA 1IY9A 4M36A 3UFBA 3CGGA 4CXMA 2Z6UA 2IGTA 2Y1WA 4K6MA 5FTWA 2ZIEA 2ZULA 1VE3A 3A4TA 5DTQA 2ZW9A 4RVGA 3IHTA 5ICCA 1QAMA 4PIMA 3MAGA 3G2MA 4ER6A 2ESRA 3K6RA 3KPVA 5F2KA 1RJGA 3KR0A 2AOTA 2AOUA 3BGVA 3UA3A 4KDRA 4YUYA 1I9GA 3AY0A 3LECA 3IV6A 5BXYA 5LQKA 5EVJA 3MERA 1YF3A 1L1EA 4EKIA 4MTLA 1HNNA 3SSNA 4QVGA 5EZQA 4E70A 4M7RA 2JHAA 3FTEA 1XDSA 3LHDA 2P8JA 4DCGA 3E8SA 5DM0A 4BLUA 5IKMA 4FT4A 5GM1A 4HTFB 5KVAA 4X1OA 4FSDA 3P2EA 4YUVA 2IFTA 4DM3A 1PRYA 4ATNA 3I64A 3ER9A 3UJ7A 3LSTA 4OBXA 5T64A 3SX0A 1NT2A 2IH4A 4ZTBA 3PB3A 4QTUB 4PYKA 4RYLA 4NECA 4EKGA 1JR4A 5JR3A 3SXJA 2FYTA 1M6EX 3O7WA 5E9JA 5FHQA 2ZSUA 1G55A 3CJQA 5GP1A 2I7CA 1NW3A 3VYWA 4RTNA 2KW5A 4KWCA 2FCAA 3TQSA 2PY6A 2VDUE 3MCZA 4OQEA 4KIGA 3FYDA 2G72A 5DM2A 5EG5A 2OB2A 5EMKA 4FGZA 4HGYA 4RVHA 3FZGA 3NVMB 4GOMD 1G8SA 2P3LA 3LDUA 4E32A 2CL5A 3BWYA 1XDZA 1M0EA 1YFJA 4POOA 4U7TB 1JSXA 2ZZMA 3PFHA 5B1SA 5G02A 3KU1A 2P35A 3PX3A 3A25A 3A7DA 1ZQ9A 2PT9A 4IV8A 5EPEA 5K09A 3OZRA 5IH3A 1BC5A 2EX4A 5DX0A 3UBTA 1N7JA 4LG1A 5DT2A 3KQSA 1WXXA 2VS1A 3DR5A 3M6WA 1D2CA 2XBMA 2GA9A 3LGAA 3O4FA 3ORHA 5E8RA 1XCLA 5BW4A 3I58A 5K0EA 5GWXA 5ICEA 1T43A 3GJYA 9MHTA 5K0JA 4DF3A 3AJDA 4RVFA 3G7UA 5T67A 1Y8CA 1JG4A 1MJFA 3HCCA 3THRA 1JSZA 1X1DA 3C6MA 2P7IA 4C08A 3FTCA 5MHTA 4PIPA 4WVLA 4X63A 2UZ4A 1WY7A 4FSXA 2GPYA 1ZKDA 2H1RA 5DRYA 2JG3A 2NXEA 3ME5A 2ZTHA 4HTFA 3SR4A 3DLCA 2ADMA 2XYVA 4KW7A 4QDKA 1PJZA 1SQFA 4C06A 5GIOE 1NW7A 3PX2A 3NMUF 4R8SA 4ER0A 2F8LA 1I1NA 4O29A 1SUSA 3UWPA 3LDFA 4BP1A 4QPNA 4FR0A 1O9HA 1VLMA 3CC8A 4LWOA 3IEIA 4F86A 2AOVA 4E2ZA 3NWBA 5HIJA 2PLWA 4EQZA 2UYQA 3G5TA 3DXYA 4PGGA 3B5IA 2Z6QA 2AOXA 3BGDA 2CMHA 3KQYA 4E30A 4YV1A 3BT7A 3LBYA 2ERCA 1O9GA 1JTEA 1L3CA 3M6XA 3OU2A 3P2KA 4GQBA 4R6WA 3ELDA 3FUVA 4BLVA 3OU7A 1BOOA 1DL5A 1HMYA 5E8JA 3M4XA 2JH9A 3KQWA 4PYMA 5D1HA 1KR5A 2ZBQA 5ERGB 2OKCA 4DQ0A 3BXOA 1R8XA 3BUSA 1FP1D 3P9NA 2PX2A 5EEHA 3JWGA 1KXZA 1NKVA 3GRYA 2P7HA 1UIRA 2PJDA 4FP9A 1EQAA 1KPIA 1RJFA 3K0BA 1H1DA 5LQUA 5E2BA 2IH5A 3R9XB 4LECA 2G70A 4PCLA 4GC5A 4XUEA 5DSXA 3HVJA 2YXDA 3FPEA 4EK9A 4RTQA 3GO4A 1JTFA 1BKYA 4RTLA 3V8VA 2VDVE 3S68A 3TRKA 4IWNA 3GIWA 4HH4A 2YR0A 3KR1A 3VSEA 4UOEA 3DMGA 4P58A 1JQ3A 5HIKA 5DXAA 3G89A 1QAOA 2WA1A 2G8NA 5GIPE 4OX9Y 5K0NA 3WSTA 1G6Q1 1RI1A 5HFJA 2XVAA 3EVZA 5FA5A 1WXWA 4CTKA 3ANXA 5DM4A 5ICGA 4ER7A 5K0FA 4RTOA 4MQ4A 8MHTA 3TPZA 1I4WA 1TW2A 3T0IA 2NP7A 2EFJA 3GXOA 5C1IA 3RODA 1X19A 4X60A 5K03A 3EMBA 1XJ5A 4CKCA 3FPFA 4PYOA 3NVKI 2BR5A 3CJRA 4H0NA 4R6XA 4RTKA 2PXAA 3TM5A 4EMSA 2HTEA 2P40A 3TOSA 2R6ZA 3IYLW 4E2YA 4GOND 2PT6A 3TM4A 4JXJA 4PGHA 5CD1A 2BZGA 3G2QA 3OE4A 2B2CA 4MWZA 4KIFA 4DCMA 2B9EA 2GH1A 2WK1A 4RSRA 2GAFA 3OCJA 3REOA 1XDUA 1XVAA 2ONYA 3EGIA 3MTEA 4M37A 4RVDA 5CVEA 2NXJA 2OZVA 1RI5A 2AN4A 4C04A 2FK8A 1MHTA 1Q0SA 2YTZA 4RV9A 5E2AA 2QRVB 3KR9A 4HG2A 1P39A 5FQOA 4YMGA 2ONZA 1KPGA 3DTNA 4QDJA 4RWZA 3THSA 4IV0A 2JHCA 3ELUA 3EVCA 10MHA 4OA5A 4DZRA 1N2XA 3EEYA 3G8AA 2HWKA 2PX8A 3ELYA 3MGGA 4HSGA 5LQCA 3T7RA 1VL5A 2C7QA 1O54A 5CVVA 2NNWB 1F38A 3HM2A 3HA5A 5LR6A 4WXHA 5EOVA 2AN5A 3G8BA 5DM1A 2V74B 3FPGA 2CWWA 1X1AA 3OU6A 3KQVA 5HOQA 3HP7A 1P91A 1NV9A 3NDJA 3PLAE 2FPOA 1QAQA 1B42A 3C6KA 2P3OA 4ER5A 3BZBA 5FWDA 4GEKA 2JHPA 4GOOD 5LQAA 5DPMA 4PNEA 4GC9A 4L7VA 1D2HA 2ZLBA 5M5BA 3GRZA 2VP3A 4GF5A 3TLJA 5KQSA 1R8YA 1EJ6A 2CMGA 1R00A 3FRIA 3LKDA 4PYLA 5CVJA 4DMGA 4P7JA 3GNLA 2ZIGA 2PSSA 1EJ0A 3EGEA 5KS2A 1VP9A 3D2LA 1VBFA 3DH0A 1IXKA 5FHRA 4XCXA 4AZTA 4P7FA 1TW3A 3MHTA 2AR0A 3KR2A 1TPYA 4R8RA 5E9WA 1R74A 3UJ9A 3KQQA 2EJUA 3B7PA 3M70A 1P1CA 5CCXA 1SVUA 4AZVA 1WZNA 2EG5A 4QTTB 7MHTA 2AZTA 4Z2YA 3HCFA 4EVIA 2K4MA 1WG8A 3LDGA 3I9FA 3FYCA 3PS9A 3E7PA 3A26A 3NJRA 2OBFA 3LL7A 2I9KA 3CKKA 4CKEA 5EHIA 2PVCA 1JG3A 4YUWA 2Z6AA 2B78A 2ORED 2JJQA 1G60A 3KQOA 1OR8A 1AF7A 2LD4A 2OY0A 2QRVA 4Y2HA 3SVZA 2ZVJA 3LCCA 4LWPA 1D2GA 3DOUA 4HGZA 2C7PA 3F4KA 2P1DA 2PWYA 5EKUA 3Q87B 4A6EA 5CCBA 2VZ9A 1DCTA 2NXNA 3KQMA 2YXEA 1DUSA 1JG1A 3LPMA 1EG2A 3EVAA 1X1CA 3FPJA 1SUIA 3JWIA 2PX5A 3DMFA 5K0BA 3SSMA 1SQGA 4YUXA 5HIIA 2CKDA 4GOLD 3GRUA 5CIYA 3M6UA 4V0RA 2GS9A 5FADA 1XTPA 3G2PA 2YQZA 3TKYA 1FJXA 3EMDA 3HVIA 4KRGA 4X41A 5EMJA 4C07A 4FT2A 3FUXA 1FPQA 3BWMA 3DXXA 4IKPA 5CM2Z 3UJBA 4AX8A 2IP2A 2FK7A 1UWVA 1SG9A 3EEOA 1N7IA 1ZGJA 3HCAA 4FS8A 4F84A 3GU3A 1KP9A 2JH8A 3KQTA 3CJTA 5K8VA 3SM3A 3B89A 3UJAA 5K0CA 1G8AA 1ZGAA 1YZHA 5K0GA 4V0QA 5F2NA 2ZWAA 3BGIA 5KYGA 2IPXA 2AOWA 2PGXA 3DLIA 3GRVA 4PYJA 3C3PA 3MQ2A 4BY9E 4YMHA 3MCTA 5FCDA 2O06A 3R0QA 2O07A 4QQKA 2O05A 3JWHA 5CVDA 5KQRA 3GWZA 3HVHA 5HZMA 1F3LA 2V7EA 3U81A 2PXXA 5EIWA 1FBNA 3HA3A 5T6BA 2ZZKA 3QOWA 4DKJA 1RI4A 2IH2A 5GINE 3DMHA 2FRXA 4PCAA 3I5UA 3R3HA 1Q0TA 4F85A 2YUIA 3GGDA 1L3BA 1V39A 2Q41A 2YXLA 3CCFA 3BKXA 1KIAA 2HV9A 4BLWA 2AS0A 2P41A 3FRHA 2UYOA 1VQ1A 3L8DA 2PXCA 3PT9A 1QYRA 2ZBRA 3QOXA 2ZZNA 1KYZA 3DXZA 3NTVA 2HMYB 2DULA 3P9IA 2PBFA 4OA8A 4XUCA 4AZSA 2ZCJA 2C7OA 3CBGA 2UYHA 1NW8A 3FTFA 4RTMA 3LBFA 3OFKA 3HA7A 3KPJA 2PKWA 1ZG3A 2GLUA 2BR3A 1JG2A 1KYWA 5EZSA 2EJTA 2OO3A 3OE5A 4PYNA 1YB2A 2ZFUA 2ZIFA 1AQIA 3PFGA 4M38A
chains in the Genus database with same CATH superfamily
5HJXA 5DLYA 4WZ6A 1SXIA 1EUQA 3HBNA 4ENPA 2XB4A 3IS9A 5JANA 4LJ4A 1S7CA 5FTNA 1RC0A 3S1TA 3HLTA 2WINI 4DSTA 4BE7B 1X8DA 2BH2A 1YBUA 1UINA 3DOOA 1YR9A 1TM1E 2GRJA 1XQ9A 2ZTSA 3BXXA 3DMJA 3N8HA 3AETB 3VPGA 2AEFA 4INOA 4UQPA 5FQNA 5J58A 1M0WA 1RCOB 1WQ3A 3S8YA 2RHDA 2QM7A 2WQ6A 2O2JA 3AKDA 5CNKA 3U17A 3ABQB 4WJBA 3AXTA 5HWSA 2VCYA 3NATA 1HNZF 3KMSA 3FQLA 4OZLA 3EXEA 3I2IA 1KSFX 1GXLA 3GLHA 2C9CA 4ZMRA 1V3ZA 1EGVB 1IQ0A 1QE5A 3E9EA 4MIKA 4DA4A 2AJTA 4GP6A 4FCCA 2Q1YA 2ZUTA 4ZPDA 4R8MA 5DI3B 2YMQA 4NULA 3GIJA 2JNJA 3WL3A 5ER9A 3NGKA 1M6YA 2P1RA 1WCIA 3HBAA 5E9QA 1T5IA 5IV3A 4GZLA 4CKWB 2X13A 2AFIB 3U4IA 1FE0A 5I7RA 3MERA 3GP8A 3LJKA 3Q7PA 3CPJB 3I64A 2RFLA 3LSTA 4H7IA 3SX0A 1KSPA 3O2IA 2YC2C 2FR0A 4Y0AA 4P36A 3O7WA 5GP1A 2VA3A 3NWRA 2BY4A 1ZYUA 5CITA 4ZVLA 4F4UA 1RYDA 2A2DA 1K6EA 3HD2A 3DLHA 4E5UA 3IDFA 1Z2ZA 4UDYX 4ZLJA 3A7DA 1DWPA 3BSFA 5JXSA 2W6ID 4AUNA 1ZXLA 4GVXA 4EA7A 3DKPA 2EG1A 4BC0A 2JAOA 2WHPB 2OEPA 4WK3A 4MW0A 5CYFA 3C15B 3NHAA 4PX9A 4HRVA 1ESCA 1W59A 4C5CA 3AR7A 4KW7A 1ODFA 1MX1A 1SQFA 1OC4A 3WE7A 4OD0A 2VHVA 5L1JA 1FXWF 3S0JA 5CHEA 4MA4A 5LP1A 2X8JA 1VCIA 1QYWA 3JD4A 4JJEA 1NKVA 1RQ0A 4FGUA 2C84A 1WUKS 3OFFA 4Z0TA 5LT5A 4KQGA 4WCEQ 3DB1A 5FBZA 5LQUA 3ILVA 3MF5A 4KFTA 3FZBA 2IZ5A 2A1UA 3R5CA 1JEYB 1WC4A 4XQCA 4OX9Y 3MRXA 3T7IA 1ZLXA 1J07A 5FA5A 1UK9A 1IONA 2GGPA 3IR6A 1RT2B 5JG7A 3NH9A 3VSDA 3CJRA 3L0YA 3PHEA 1KXJA 3ZDBA 2Y8WA 1Z16A 1UVIA 1AQYA 2GXUA 4ZN1A 4P6VF 5HTKA 4DS5A 4C0WA 4B5LA 3C46A 1C41A 4CEJA 4Z7YA 1D1TA 1Y8AA 5EOVA 1DCKA 3W5YA 2XEDA 1B7FA 3JS5A 9LDBA 1PN3A 5KFQA 2FZGB 1FX4A 2WZBA 3DBHB 1RT7B 5KQSA 5BMVF 4I9HA 1DO2A 4C3UA 4MPTA 1VA5A 2CDRA 4UZBA 1R9JA 1RWNA 3H11A 2AR0A 4O2AA 4XWAA 4Q4AB 3RUDA 4B9NA 2NO0A 1ZWKA 5SUHA 2J9ZB 3FNIA 4DLBA 3I61A 1E3LA 2EFOA 2ODAA 4S2EA 1RRKA 4LOAA 4FFWA 2Z4TA 1LLCA 4BWGA 4X64J 2V59A 3PZBA 5JVDB 4I0WA 2VNIA 3ROGA 1Y48E 1R7IA 2JZ5A 4LC0A 5HIIA 4GX1A 1LI7A 1XTPA 1BN6A 1N56A 1KP2A 5HRAA 3EE6A 1Q82T 1L5KA 2C4TA 1CS0B 4AC9A 1PNOA 4B3IA 3MINB 4BY9E 3SQLA 3GPIA 1Y3HA 4M54A 1YDWA 1J8VA 1IXSB 2QRNA 5LDHA 2JEGA 2I5JB 1B23P 4N9WA 4B08A 4EI9A 2JLQA 3NAIA 2XE6A 1I94J 3RIYA 3IAXA 1A4RA 5KFFA 5AIBA 1DDGA 4BEVA 3D54A 1DXHA 3OOWA 3OFKA 1EE1A 3HHKA 5EZSA 3DAOA 3CJSA 3T94A 1GGMA 1P0FA 1RCUA 2M6KA 3TDNA 2VK2A 3R77A 2FDCA 1EG7A 4FE3A 3SX2A 4QW9A 3A2NA 3SQNA 2OTCA 2I7VA 1MO3A 3V4LA 3FSYA 3H8SA 5KX5A 3LXXA 4MV6A 2X5XA 2PPLA 3UN3A 2G71A 3HJRA 1E6YA 1WETA 4LBPA 4WK4B 1E1CA 1WY5A 3GEPA 4G56A 4Y00A 1IUOA 1PJBA 5FUWA 1H2FA 3P0HA 2J9EA 3LIPA 2HUPA 3EB9A 2W6MA 2VT7A 2REOA 3T3MB 1GLNA 3A1WA 1RYEA 1FVHA 2WC1A 4N7TA 5DZSA 4MPDA 4B76A 3T15A 3PX6A 4LUBA 2MJUA 3QRRA 4FHDA 2X14A 4ITSA 3FFWA 4J1TC 2V7BA 3VYUB 1XMPA 2GJKA 1XJCA 3B3JA 2WJJA 4YJKA 4FFDA 3A05A 4UUMA 3IKVA 3I53A 1XTJA 1PR3A 3S5UA 2V8GA 1Y10A 2X7HA 3KEFA 4P7BA 1B0UA 3DRSB 2ZHBA 2YJ6A 4YYZA 3OIUA 4DX6A 4IH1A 1NRKA 3L43A 4Q45A 3ACDA 3R3ZA 3WIBA 4QOTA 4WLVA 5KAKA 4B9SA 1G1MA 3I6YA 1Y89A 4YRGA 2P4EA 4K81B 1FNNA 3V9PA 2CK3A 2VOPA 4CMKA 5EZ5A 2OK7A 3ZY3A 4UUAA 3MGKA 4WIAA 2LU1A 3VU3A 3HZZA 2J0WA 1DBVO 4PSKA 1GU7A 2YYAA 4YRRA 1EBBA 3TYXA 1Y63A 1WB4A 1DZIA 5CYMB 5TVKA 3R5JA 3CIZA 1WDTA 2PGLA 4J0QA 4LXUA 1T0HB 3G7NA 3THXA 2WIKA 2QNIA 1O51A 4HRYA 4M8NE 4F2RA 3ETOA 5ERYA 1XA0A 2IZOA 2LDIA 5FBRB 3KSBC 4FIZA 3COPA 1VM6A 4LJYA 1NFQA 2GPYA 1ZICA 2CGEA 5I3CA 1NB7A 2REBA 4IFEA 1RT6A 4L4SA 3KKKA 3F3KA 3KXPA 1B3RA 2VSQA 5JUMA 3BT7A 3GRKA 4RA6B 2Q0XA 3WWZA 3GCDA 5E6SA 2RVJA 2XUOA 1Y7HA 3DNCA 2MZTA 3MT7A 1ZIOA 2P69A 3GV0A 4TZ0A 3UDCA 2L0XA 4WFXA 4AKTA 4C0SA 1QP4A 1JLCA 2E1CA 1TJNA 1SBYA 4ND8B 3GSDA 2BABA 2VONA 1R0CB 3BMOA 4MJKA 2CWKA 3KEGA 2NGRA 5B55A 5CLGA 3X1DA 4G5YA 2ETVA 4KO4S 5IAJA 3WL8A 1K1EA 2B94A 1X5PA 2IXEA 1JFVA 3UWKA 4ZYLA 4X1KB 1SVSA 1IDOA 1VYVA 5AVYA 1Z25A 2E7ZA 3C2QA 1YJWS 4IO0A 1UP4A 5LP6B 3JX9A 4RM2A 3IG1A 4K8RB 5KVCA 5IVDA 2EK1A 3NDJA 4CIDA 3BD9A 1ZUNB 4DR5J 4USJC 2NV6A 1PW7A 3LP1B 4OMUA 1M6WA 3NV7A 3GFYA 4EA9A 1CHDA 3EF3A 4C3VA 4DMGA 4TLLB 2QRKA 4D9FA 2PBRA 4NG4A 2AJBA 2FUG9 4Y2RA 2XMKA 4JI4J 1ZW1A 3PFWO 1YZYA 4JOUA 4DUZF 3IR7B 2PVCA 1P17A 4LWPA 3TW4A 4A6EA 2B4AA 5IAEA 1EZZB 3P6YC 3CISA 2RQMA 2QL7A 4P08A 3SZUA 4X4TA 1DRUA 3N79A 4PEVA 4W1PA 1UPTA 3GV7B 1NJ5A 1NL3A 4J4BA 4NFLA 5JMWA 5H70A 2ZAIA 3OG9A 3QIDA 2AQ4A 2BKEA 5K8VA 3AYZB 1NA5A 1UDCA 5KT6A 1AUXA 5HLFA 5FAXA 3DZDA 3QU4A 3G4SS 4J1SA 1WF3A 2FUNB 5D8DA 1HNWB 5GINE 4YJ2F 1U11A 3E53A 3BS4A 3W62A 3P19A 5CA0B 4BATA 4LF7B 3D54D 4IJUA 2QAGC 2BJVA 2XCRB 2CBGA 5ALHA 4P0QB 5DW0A 2GQ0A 4D43A 4YT8A 5LDDC 3VPBA 3CEAA 2Q4OA 1AQIA 4ERXA 3GK3A 4B3XA 2COUA 1JDVA 1F20A 3BJZA 2QRRA 2UU9F 4Q02A 1KO1A 1C9MA 1FP2A 2AVNA 2R85A 4J7AA 2JEYA 1GTL1 5LU9A 3SMQA 3DDWA 1JIHA 4IFBA 3PUXA 3FNNA 1PLKA 1Y5IB 1DLJA 4L27A 1LW2A 3GR0A 2BGTA 1VPWA 5IABA 1IIBA 5B2ZA 4KV9A 4YP9A 1AKUA 3HVTB 4JV5F 1E7MA 1P2TA 3LRPA 1UC9A 1AFJA 1MB4A 4MAFA 2Q3LA 3FHOA 3MGJA 4AMGA 4KTVE 1N34F 3CBQA 2EX0A 4KQJA 2K06A 1XV5A 3KIPA 3DULA 4QDXA 2RKWA 5M2UA 4QARA 2XSJA 4C2MA 3OFJA 2D62A 5FDFA 2GMJA 3H2JA 1DRKA 5HN0A 3L7NA 2Q3BA 3NBMA 3JQFA 4ZEVA 2IS2A 3JPYA 1R5NA 3PCTA 4RW9B 2WJ6A 4ZYYA 3C8YA 2BTOA 1UODA 3IOMA 1KC3A 4IG4A 3FYUC 1QE3A 1FYDA 4FFOA 3FF1A 5AJ3J 3R3YA 1HE3A 2A3RA 4ZXPA 1RZUA 1QUVA 2Q5QA 5DJBA 3PYEA 3H99A 1C7EA 1PRYA 4JUIA 4C8NA 3CCVS 1HM5A 4FF2A 4RNCA 5DP1A 3IN5A 1L7QA 3AZOA 1D04A 3GLHB 3S44A 1C3JA 3GHHA 3H19A 5DF1A 1PHRA 1KQFA 5LSRA 1XNRB 4QX6A 4U2EA 1SELA 3UT6A 1NFFA 2RUSA 4JBNA 3R0JA 5DLQC 3H1TA 5EPEA 4N0PA 4UBMA 2M3DA 4KQ1A 1G98A 2UV8G 2MKJA 2Y1IA 5J4VA 1G3IA 2IYUA 2YY6A 4HQFA 4NP6A 3AJDA 4IRUB 3GPAA 1HR0F 1J39A 4Y98A 5A3VA 1NK5A 3B4DA 3WB0A 3PGLA 1MC8A 2EKQA 2XMQA 3IUPA 4QATA 2EZ9A 1HPZA 1EM8A 1FEHA 3PJFA 4IUDS 4LJ9A 2UYYA 1DX6A 2ADBA 4MVJH 2CVPA 2IEYA 3CH6A 5ERGB 4ZT2A 5KYYA 1NLUA 1MIHA 2QLNA 3JWGA 2W6PA 1PQPA 1FOEB 2LCFA 1MZVA 4X6UA 1VFNA 1JLQA 1YIJS 1K08A 4I4TA 3SYMA 4NC9A 4NZ6A 2FFAA 1FUIA 2D59A 2YKOA 3HKDA 3UI3A 1EX6A 1TADA 2VEDA 5K5MA 2XWXA 1E9DA 4BO7A 2FCRA 1KZHA 1BH6A 1XDDA 2INGX 4UHJA 3QW4B 1UA0A 2QV6A 2IHUA 3C3XA 5TJHA 3EZ9A 1RI5A 2NQTA 1IBMJ 2WU3A 4IFYA 5LIPA 3T5GA 3GJZA 2AI3A 1ADCA 5LLTA 3F6EX 2N75A 2U1AA 3SZGA 3MTJA 3OKAA 2PX8A 2HG4A 5J2NB 1O6XA 2D5IA 2IVZA 3CT4A 4WN9B 4D42A 4ZVEA 1A77A 1H9AA 1G2IA 5BYRA 2QMOA 3FDFA 2KHDA 3UOAB 2QTWA 2W00A 1P2VA 2A1UB 1T4GA 3W3ZB 4Z3KA 3OR2A 5IEBA 4DDMA 1WEXA 4RK1A 3QU7A 1U9CA 4IFVB 2HQIA 3KLOA 3WLHA 1ST2A 4L5AA 3O8NA 4O3RA 2OUGA 2WD7A 4W9MC 2I8CA 3L7DA 3LP5A 4M53A 4YUWA 3ILLA 2VP2A 1ZRHA 1SXJE 4YECA 4R31A 4FXPA 1TPZA 3ZG6A 3WYFA 2PL9A 2G0CA 3OOYA 3N1UA 1KTVA 3B3QA 1XU4A 1RWXB 3DOJA 1RZRA 5A71A 4CEJB 3IE0A 8AT1A 1FMLA 1HDRA 1UAAA 3HVIA 3QVKA 4DSJA 4WA7A 4B79A 5KPDA 3M8QA 1SEVA 1J06A 1NVGA 1RAFB 5TB5A 1E2JA 2XHCA 2GPSA 1TQLA 2R6DA 5BRNA 3PO4A 3H9UA 4CQLA 4K9PA 5B0GA 2WG1A 2WMNB 3AMVA 3TOZA 3PX4A 5KYTA 2B0GA 4FNMA 1AKWA 4WX2B 1RJJA 3PDNA 2QTTA 3LF2A 4CV2A 1FU8A 2PUWA 2Z8QA 2ZYRA 3AR9A 2YZMA 3GGCA 1SK9A 5KFEA 1JKHB 2VG5A 2WKRA 2C4NA 1F3FA 1JG2A 2NYAA 1XAJA 1RWKB 1M5VC 3TUZC 1BHJA 4MW5A 1L1FA 4L9WA 2WBLC 5DYNA 3GEGA 1ACLA 4RAQA 4ZGWA 2F17A 1NWCA 1ISIA 5COQA 5DNDA 1ZJ6A 5JAOA 3I55S 1BQNB 4GM4A 4Y6SA 1PJ4A 2VH7A 2O4CA 5TGZA 5FL3A 4HNVA 1HNIA 3NTOA 1E7QA 4XIJA 3DOEA 5LMUF 4M5HA 2QV0A 1F0PA 2P2DA 2ZEJA 3VGSA 1ZZGA 5RUBA 1OQ3A 3F0NA 2WSYB 2IIQA 1PTKA 1TKDA 2FD2A 2ZJAA 3D3CJ 3WB2A 1YVEI 2HFKA 3RW9A 2W6QA 2DMRA 2IYRA 4RCZA 3VXKA 2YWHA 4PXSA 1OMSA 4NL4H 2LKCA 3EWNA 4RVCA 2ONKA 4PLPA 3CX7A 3T1YF 2O1PA 1FK9A 5BQXA 1W47A 4GPIB 3OZTA 5FOUA 5A4MS 1GL3A 2GBCA 4QWBA 5ARDA 3V4RA 1NGSA 3C0KA 2MKHA 4P22A 2F9MA 1E1CB 5HKKA 2W2PA 2W6JA 4ZV9A 2V4ZA 2HZCA 2JBWA 2VA9A 4UBKA 1WI6A 2N3ZA 3DKDA 1QQ7A 3AHCA 4DF4A 3BBLA 1QAYA 1C1YA 1YQDA 4FT4A 1M1NB 1L5HA 3S27A 1BVYF 3Q0AA 1D4ZA 1DC6A 3AKZA 1XMOF 4PXCA 2DHRA 4B83A 4BFSA 3L7PA 1EB8A 7AT1A 2FF7A 1PZXA 4CV0A 2JFHA 4Q3OA 3PFHA 1QSYA 4TV9F 4UU8A 5HDQA 2ZVSA 1BC5A 2JKVA 3MG9A 2ZM5A 4FINA 1GWNA 2AD9A 1Y1PA 2YWCA 3LA6A 1URRA 1G8MA 3GJSA 5BORA 3IGNA 3BGSA 4RGYA 2JOQA 3ZZPA 1D8YA 3WC2A 5ADZA 4R1MA 4I5GA 5DLDA 1USGA 5C4IA 1V5GA 3E3XA 2ADMA 1GPYA 2BEVB 3FVRA 1WXHA 2XZDB 4RCYA 3B5JA 4MVJM 2AD1A 2PGDA 3GB9A 3DVRX 2X0EA 4NZMA 4YDQA 4GP7A 1GTVA 3C7KA 2VLBA 4JS0A 5BOVA 1ZPVA 4I68A 3ELDA 4TSRA 1RHMA 4EO7A 4QIVA 2OP0A 1VISA 2FPUA 3R5JB 1MH9A 1RAIA 5C8YF 2G5PA 4BAUA 3W5XA 4IJVA 1OPZA 1SOWA 4N65A 3D6MA 1SJ9A 1QWSA 3THXB 3ESRA 3GFFA 1ES9A 2YFKA 3CCBA 5GIPE 5MFZA 4AMUA 4FYVA 1A9TA 1ZS9A 5CT4A 3ROFA 1ORDA 5C1IA 1HDXA 4IINA 3I2GA 3RT7A 3TNFA 3NNCA 2V3VA 1NLKL 2GZOA 4F25A 1X31C 4JXJA 3KTAA 4AJLA 3RTBA 2W2TA 1VIVA 2REQB 3NOCA 1A8IA 1E66A 4GP9A 3CW2A 4BRWA 3SQGA 1FUKA 2FQXA 3PDJA 3QENA 5C7LO 4WXEA 1MMFB 5EINA 2VFSA 4G86A 3C19A 3GVPA 4RF3A 5LQMA 2FMUA 1ZINA 2CXEA 2E66A 2VP3A 3TK1A 2D0IA 1XSEA 4QW8A 2MQQA 2YC4C 4J1NA 3LYLA 3IB6A 2OUKA 3V81B 3BMOB 5KG7A 2DTEA 1QMPA 4X5OA 1FFEA 5SZHB 1I5EA 4AZVA 5FI0B 5KJFA 4EVIA 1K63A 2BGIA 1LC0A 3KHRA 1R7RA 2H1YA 4Y9DA 1S12A 5I51A 2HQGA 3Q3EA 4MV1A 1X7VA 1RZRD 3R2DJ 4Q9KA 4F9GA 2C2YA 5LYJF 2ECQA 3OQMA 4AX8A 2V7VA 3GU3A 3GGOA 3E9CA 4Y67A 3S1AA 1ECFA 2X2PA 3SK0A 3AHPA 3FLAA 1J2JA 2ZWAA 5DGCA 1Y5NA 2R62A 4D9IA 1RRFA 3WQQA 1FNBA 1QGUA 2OV4A 5F33A 1JXAA 4PZ0A 4HTAA 4LF8B 2C29D 3ORYA 4XCVA 3U1BA 2FX2A 3W1EA 4F7DA 1II9A 4JYAJ 4K05A 1T2CA 3NKLA 4YAGA 3IELA 3G2LA 2RIJA 1NVXQ 2QVBA 4KGDA 1OZHA 5HYVA 3JCZA 3C3WA 1QLWA 1G20E 2NU8B 3CBGA 4I5EA 3V4SA 3I9KA 1QVAA 3HXLA 4CQNA 2Y1FA 4YRLA 2H06A 3MT9A 2QL7B 1VIDA 4X8OA 2H2GA 3H4DA 1AZWA 3AKYA 3E23A 1T6YA 1IPHA 3DVAA 1VSUA 1GZSA 2YX1A 2W71A 4RHUA 1TXGA 4HB0A 1YFLA 2LEAA 4JBLA 4NI2B 3SJZA 2ASVA 5HLFB 1KJ9A 3GJ6A 2IDKA 4JUBA 8GPBA 4DA8A 1DBWA 2ZOFA 4LHVA 4HACA 1XTRA 3BCRA 1DT3A 4PLCA 4RULA 4REMA 2GPTA 1WS6A 2TMKA 4DY6A 3R24A 5HBRA 4X62B 4JLOA 5JAQA 1XDBA 4H60A 3EEIA 3L1JA 3URKA 2VC1A 2Z8ZA 1KQNA 2NT4A 1GKLA 2ASEA 4YP5A 1GX5A 3E58A 3HULA 1C9EA 1GKYA 1IBRA 5KYVA 3NOQA 2AJ0A 3L0DA 4IIFA 4A2QA 2PS1A 3EIFA 2CXHA 3H3JA 3ZS9A 2ZJ7A 3IQXA 3OA0A 1T25A 1LS1A 4MKRA 1Z6TA 1CEXA 1M1YE 3IPCA 4RPLA 3HJCA 3K73O 5HKKD 1LW2B 2W6JD 3CCZA 3DDIA 5CDGA 3MEDB 4EB8A 3HEMA 4FILA 3DYIA 3EFOA 3A3OA 4HT7A 3SHVA 4ZA2A 3K9FC 2IM0A 4KKXB 1ULBA 5J3JA 4CF4A 4DSFA 4XTCS 3WA6A 4X24A 1RI7A 2FPXA 1GFSA 3TLGB 2L41A 3STVA 1JMVA 4HEA9 3IOYA 3B38A 3EH2A 1ZIYA 4YR7A 4O0MA 3MFQA 4ZTBA 3ADDA 1YI8A 3PYDA 5IK2A 1X38A 5ESDA 3VYWA 1KHVA 3CF0A 3OMLA 1Q1NA 1EARA 3C6UA 2CL5A 3P52A 3J7AC 1OBOA 2H2WA 4AXJA 2XGPA 4HWSA 1TT5A 3BCUA 1G16A 2WU0A 4BQRA 2OCAA 2NVUA 1PFVA 3UCFA 3QGPA 2X0DA 1J24A 4KXQA 5AVKA 3AEUA 1A3CA 1JG4A 2M6RA 1NE7A 3NHUA 2RH3A 2XYPB 4PN7A 5LYYA 2O2YA 1SC6A 2OWDA 1B74A 3PX2A 1QGDA 4QFCA 4B4WA 4KH0B 1W36B 4XW2A 4O44A 2QLBA 1H2HA 3ML1A 4QHSA 4IILA 1OGIA 3SCJE 4FS1A 3LLSA 2EW9A 2PU5A 3AO0B 1ZH5A 2G67A 4BVGA 2OP1A 1KQFB 3U4QB 2ZUSA 3DHWC 4R16A 3UUGA 2RHQB 3ZHZA 1BHO1 4IIYA 5BWNA 3KK1B 5B0FA 2YR0A 2JL1A 4Q4DA 2Z08A 2C1EB 2XVYA 3WSTA 3AY7A 1AN9A 1UBEA 4Q9JA 2MDAA 3R7LA 2JDJA 3D6JA 2XNJA 4NMXA 3ESZA 1M7BA 4WXPA 1SY7A 4RH3A 5CFOA 4LZZA 2WIDA 5F7OA 5ULLA 1HE5A 4IYRA 4DWOA 2MSWA 5LC1A 2FOLA 1QIJA 2HNAA 4BCDA 4NXMJ 3LPCA 5KYYB 4LXGA 2XCTB 1QHHB 3PLAE 2DGDA 5ED0A 3N7UA 5D8HB 1VBZA 4EA8A 1NHKL 2VQEB 1NPTO 2V9ZA 4JC4A 3GOHA 3HKDB 4CM3A 4RWEA 1J20A 1OH8A 4PZAA 2VOOA 2EEZA 3QLUA 5I7HA 2UVPA 5HZKA 1CTQA 2B35A 2G06A 4Q16A 3JWPA 4PCQA 4WECA 4IFYB 4TV8A 2AWNA 4MTPA 4AJOA 4Z7OB 3WNQA 4UTVA 1RBYA 4XUGB 4O3PA 5JATA 4YDRA 2E3JA 2P5UA 1SBZA 4NH4A 4XWKA 4NAVA 3L8EA 1KEPA 3Q8LA 3E1GA 4ZJYA 4OFWA 3MM4A 4AVYA 3U9TA 3ZDDA 4TYAA 4KXMA 2XCSB 3RBDA 3CJTA 4V0QA 1YDEA 2VD3A 1LJ8A 2OCIA 4TWBA 3MMNA 1T5TA 1KMCA 5CVDA 3GIRA 1DAIA 3NIDB 1GV0A 4EATA 3RRKA 1OS5A 3CSDA 3OOEA 1N77A 4EY5A 2WD7B 2DTDA 2P62A 3JQRA 2QKYA 4XUCA 1SVIA 4DM4A 3BPSP 4GQAA 3KPJA 4YAKA 1EQMA 1G8PA 3QIPB 1K9VF 1YHNA 4G25A 1M5SA 4WW0A 1GPKA 2I9SA 1YB4A 2YWXA 4UDOA 3U37A 4ID8A 3RBXA 1QQTA 3M8QB 5I9NA 3A1NA 2QN3A 1IG3A 3DL0A 2QTVA 2WILA 2MZSA 4XGRA 2ECPA 2VWHA 2Z5GA 2JFYA 1EFVA 2CC2A 2J5AA 1TFUA 5EIFA 1UM9A 3L02A 1C14A 1R9NA 3EWIA 3QJGA 4KXWA 3PTWA 3GDHA 3N6RA 5DB4A 2RI1A 2FWPA 2FWNA 5H59A 1PJQA 3EQ8A 4LHEA 5DTMA 4GMDA 3RSHA 1KHHA 4RJTA 3BDAA 2BTQA 4C0LA 3H86A 3RSLA 4WMLA 4M5MA 1OOEA 4WZBE 4F21A 1FS5A 2J4CA 3K2IA 2H1OA 2X4LA 3LP0B 2WWWA 3PZPA 1UPUA 2JASA 4M89A 2OCKA 4MVJG 1EE2A 2RD5C 4O2LA 1I7QB 4RX1A 4BMVA 3TX0A 4B31A 1YCGA 2VUGA 2NWQA 1UP7A 1HNIB 2PL3A 4TWZA 1EFCA 1J7KA 4JR1A 4ENRA 4IV5A 2ZE7A 1JIQA 3H5AA 2HJGA 4OJMX 4PNHA 1LK0A 3HR7A 5EVJA 4GRDA 3VGTA 3D7NA 4DV1J 1YS7A 2HEIA 3LGXA 3TZHA 2WSBA 4L3NA 5GM1A 3IFEA 4QWMA 2D3O1 4HF7A 4Y0NA 1V1JA 3CR7A 1B7GO 3N6XA 5IK2D 3ZV7A 4HBGA 2R5FA 1PJ5A 5E9JA 3M8YA 1H2XA 3KJEA 1PFQA 4DUTA 1OV6A 5AVSA 5HZGA 1S0VA 1XJ0A 4GQIA 4X8MA 1S99A 2HBYA 3ZIDA 3ROPA 1CUEA 4QELA 4I99A 1MXFA 4DNPA 4PRKA 4Q24A 1Z0DA 3O2SB 2AXNA 1DADA 5JXJA 3WKEA 1Y3AA 5ICEA 1TD9A 4U7FA 4COOA 4FSXA 2H1RA 3FOFC 4QA9A 2I2FA 1Q14A 2NX2A 4PG6A 3AJ2A 3LDFA 1YQGA 3PHCA 5HIJA 1W9HA 3DGPB 4O1HA 2XUJA 4P93A 1H6DA 1B41A 1QE1A 4MMZB 5AVQA 5KB3A 4CIXA 3MT0A 3GFGA 4XGKA 5D1HA 2ZI3A 3CR8A 4BJ3A 1M8KA 2P7HA 4YFYA 3LO5A 1USVA 3THYA 1DT5A 2H8KA 4LFBB 2DPIA 4BB6A 2QHXA 2TRSB 2MDTA 3AHDA 1E1RD 3ZPXA 4OOFA 1WZUA 1IPEA 4LVNP 1DIAA 3ITHB 1ACMA 2R7TA 4P82A 1TJPB 4IEFB 3PKYA 1NDLA 1NW9B 4K9QA 4AJ9A 2XUPA 2FJDB 4ROSA 1EP1B 2EAUA 3RVQA 2AIRA 2BZGA 4YQZA 5DLPA 1GU1A 1EK1A 1Q7LB 4D3ZA 4ZODA 1SD1A 5AXDA 3MS7A 1SBIA 3A8TA 2YIMA 4HYTA 2HA3A 4BFTA 4DWIA 2WVDA 1KPGA 3TRFA 3HN2A 3UB3A 5F76A 4IO1A 1S4FA 5LZ5A 1Z08A 1YJ5A 3ILJA 2JGKA 4KWHA 4MQFB 4EPTA 1WE2A 3MZIA 4XLTA 1H3EA 4NS1A 1IJKA 5E2IA 5ETOA 5CVJA 1VLLA 1OCEA 4DMLA 4FYVB 3SJCA 3UE2A 2X2EA 5DVZA 3F6CA 1GA1A 4Q44A 4W5OA 5K8PA 5CT6A 1K73T 1SVUA 4GE0A 2MHEA 2VBFA 2ECOA 3AEQA 1T3OA 2YZ2A 2NYRA 3R27A 2ID7A 4DEZA 1Z2DA 2OGWA 4OZ3A 1LD3A 3SQGB 4CL0A 2VJQA 2HDNB 3UUEA 1X13A 4TMZA 1GFWA 1KLMA 3EDQB 1PGZA 3ZZNA 1D1UA 3L7MA 3RANA 1AQUA 4HMQA 3CXUA 1JX4A 1YQQA 3FLMA 3GH1A 1ODSA 3WADA 4KE7A 3HJTA 4NYJR 4PYJA 3N59A 1Y7PA 5JXWA 5HCNA 2AJQA 3GWZA 3FPAA 5ER6A 3AW9A 2Q2QA 1DJLA 4X54A 4F85A 1PZEA 3SF8A 2DH7A 2F3PA 3PWTA 4K7QA 2W2NA 1OJ7A 3DXZA 1T26A 2HMYB 3QFSA 4OHFA 3I5XA 4O4LB 4QQFA 1FYXA 2U2FA 4H1VA 1A9XA 1HARA 2RHCA 1QORA 3ET4A 2VHYA 4YUDA 1WKKA 1YRBA 3S70A 4PXDA 4CYMA 2B1IA 2FW7A 1F0NA 4LJKA 1ENPA 4LTMA 2KM8C 2V98A 1TA4A 1YTLA 1RBMA 1Y5NB 2HBRB 4BGUA 4FSHA 3GEDA 3SCIE 3RFXA 2BJ8A 3OCZA 4NPCA 1N5VA 1KLNA 3H5NA 2GPWA 3CJKA 1FF9A 5AXKA 1L8QA 2GW8A 3BSCA 4LZJA 1GTSA 2FJUA 2WAMA 3DM2A 2UUBF 2B8QA 4II7A 4GKVA 2Y67A 5GGYA 3D4LA 1DV2A 1E5LA 4DIEA 4OZJA 2XR1A 3HD1A 3E7WA 3FTNA 4F3NA 3BMXA 5E3IA 1SJ4P 4DSOA 4UZFA 3SOPA 3D7LA 3I2KA 4YUZA 1I9CA 3PRVA 1AZTA 3A3NA 3E2PA 1OFUX 4FFVA 3A70A 1W1UA 5FR1A 3I09A 2H8GA 3W8EA 5JAMA 1ATIA 3ASVA 3NHFA 2MINA 4LK2A 4YAWA 4JODA 3VJKA 5JAIA 3SCKE 5HJ5A 3NNDA 1HD0A 2VRNA 4HACB 2VDWA 3QUTA 3DW1X 3A4TA 3OL9A 4Q47A 4RVGA 5ICCA 1ZOLA 2VYNA 4MGEA 4MINA 4ES6A 1R0AA 4YUVA 3RYHA 2C28A 1MABA 1RBLA 2P2LA 1C7QA 1MJHA 4L8YA 1XXHA 4OIXA 4HFNA 2RMKA 3N76A 2XDQA 4UOHA 4P3OA 2VC2B 5C52B 1OLSA 4DYVA 3FPSA 4EFLA 5L9AA 2CV1A 4NIMA 5KKNB 2E6KA 2QI9C 1SO8A 4OGWA 2LXIA 5ECYA 2G25A 1P75A 4IDEA 4MI3A 4FXDA 3I58A 2ZRLA 3ZZ0A 4JEUA 1O3YA 5A4AA 3NM4A 3WLJA 1U90A 3C14C 1PYTA 4QDKA 4QU0A 4DPKA 3BAFA 3QTBA 3ESQA 4BP1A 2ERYA 3PQ3A 4MKYA 1FMTA 5KFSA 4GMXA 3STWA 4NAHA 3AHGA 1PW5A 3O90A 2IP4A 5JRZA 2OBNA 2CXRA 3K5PA 4MIYA 4WSOA 3CXCR 1GEGA 4DQ0A 1SCNE 2OR3A 2V58A 4HY3A 1RXIA 1E77A 4KLCA 3RS4A 1WLYA 1UZNA 4PHTA 1XUOA 121PA 5BV2P 4XVRA 1JPJA 4A47A 1NRWA 4KI7A 1Q1ZA 2BJ1A 1B93A 3LUJA 2QRZA 1MEJA 5K0FA 5C3UA 3MVEA 3LT4A 3WX8A 3VTIA 4WZAE 2OA0A 4LF5F 2ABWA 4X92A 2VBXA 2VJYA 3GGGA 4TTRA 4RELA 2AWOA 1IB6A 1LV5A 3AGQA 3SKYA 1MV8A 3MOSA 4ARBA 1SHTX 1NNDA 1WBDA 2QLBB 2IXGA 1N5TA 2Z1NA 3PEWA 3MFIA 4I36A 1KERA 4QXMA 1Q78A 3NYRA 3ENWA 4A4JA 1VHFA 3WK8A 2Q3EA 3GC6A 3VU0A 4L7VA 3V7WA 1JK9B 4R7TA 3X1JA 4QIHA 1N4LA 4QXRA 1S1VB 3E3OA 1Y0BA 1DPGA 1HE1C 4Z9FA 3Q3JB 4MJLA 4D8UA 1U2RA 3U9LA 5KG4A 3V4FA 5EA2A 2G0IA 5A5DA 4HQNA 4WBNB 1OB5A 2ZS8A 3I01A 3DXBA 3V4OA 2OQVA 4GM1A 4RIHA 1Z8NA 3CRMA 5HJ2A 1GSAA 1ZIDA 2HQOA 1L9XA 1A5AB 2BFEB 3POTB 2IUYA 3DLLQ 4I14A 3TW8B 2FFJA 4AYWA 3IO3A 1S89A 3NO4A 4UULA 1J8MF 5C1PA 2HNBA 3VC7A 2BH9A 1KJYA 2P4SA 3GUVA 2NSCA 3DUFA 4C01A 4J7UA 5AE1A 3T52A 3DVLA 1LW0B 4YMHA 4YA6A 4G65A 3TVZA 2H07A 4Q9HA 4IFIA 4DLYA 1Q86T 5CRIA 5I7FA 3GV8B 4HAYA 2YZGA 1JJBA 4OHYA 4B9MA 1UPPA 3LCMA 5F3TA 2KN4A 1QYRA 1OI4A 2UVPB 1HBMA 1FXLA 1UBLS 1V4VA 5IJ9A 3VV2A 4IRCA 4N01A 1QGOA 1ZJJA 4RPHA 4RH0A 1Z06A 4TV8B 3MMXA 2Y1LB 1NY6A 1JBEA 2GCIA 2BR3A 5A6SA 3IP1A 4EUNA 1G59A 3JALB 5FUBA 4NBRA 5CVCA 3M7VA 5DDOC 1S2LA 2KSQA 4YGYA 1J5EJ 3R8CA 4G9GA 3IERA 2V54A 4ZPAA 2CE2X 4C4SA 3EZ6A 2OHJA 5EFOA 1UDXA 4OX9F 3AUJB 2O66A 1DS6A 2DSTA 1OSNA 1FDUA 1ZIPA 2CJYA 5G3YA 4F6RA 1J0AA 1WDDA 4E5DA 2ZM6F 3VAHA 2YV1A 1YIDA 3A37A 3FUWA 1RAHA 4DLPA 2K8GA 3N4WA 1NBOA 5M29A 1ZHHA 4LFCJ 2CSUA 1N25A 2C2KB 4OQDA 1RXWA 4S1OA 5LNK1 4CT0A 1P7CA 1VLHA 2WD9A 1HKAA 4NLOA 1RD4A 1RJEA 5EHQA 4OQPA 1G8YA 2D74B 1KETA 3PEJA 1AXGA 2VP6A 4XFJA 1VQKS 1OMOA 4DCNA 1AZSB 2IVFB 2JCXA 1JAXA 4L7QA 1DKOA 3T41A 1ADYA 3A4YA 3AZPA 5JZOA 1JQDA 4XM2A 2EFGA 4Z4IA 1MT0A 5AHOA 2PTHA 3BXFA 2QTVB 1P9OA 5LQNA 2Q29A 1A0OA 3GLRA 2HHTA 4JC0A 4E4RA 2D1TA 3WR5A 5B37A 3TTUA 1Q1AA 3L09A 2AVDA 2V2KA 3H4BA 2B4YA 2JI6A 1I4TD 2IGTA 2VYND 4QCLA 3I82A 4MA0A 4LC1A 2AOUA 2PYDA 3OZVA 1MBZA 3MGAA 2OO4A 2JA2A 3CIFA 4RBUA 2G36A 3PQ2A 3EPGA 2FW1A 2OSQA 2PPVA 4PYKA 2FUKA 1YQEA 1CRWG 4AJHA 3BKUA 1KMHB 3EIHA 2GHPA 3U4CA 3H6HA 3LDUA 3RT9A 3LUPA 3PW5A 4ZI5A 2LIPA 3C41J 2Q7DA 1P3JA 2YIDA 2PCJA 4BLPA 3QH4A 3AEYA 3ETCA 4LDNA 1Q1KA 3INYA 4URFA 3AOAA 3G2JA 2GETA 1ONBA 4H7EA 1I6MA 3JZDA 3T5JA 1W94A 4BX0A 4XR9A 1QPZA 3PCOB 1ZD3A 1RPZA 3N0TA 5CP8A 1CJTA 3JQGB 5LLDA 3LI2A 3VZHA 2EP8A 3W5AA 3G13A 5B0CA 2LECA 1FXWA 1P2BA 4OYHA 4Y2GA 2FW0A 1Y6FA 3FJ2A 3PNSA 2QSZA 2EQBA 4KO0A 3SLGA 5BPHA 4DNFA 2Z1DA 2YPZA 2DFVA 2WKWA 3S68A 3DE0X 4B9AA 2FPSA 3L1UA 4WCVA 2W8ZA 3C5VA 1XN1A 3AUYA 4W5WA 2AYZA 3TB6A 3O1HB 5F8LA 1IHYA 4KMRA 3LO3A 1HNVA 5FYDA 1PFGA 4J76A 1SH2A 5K0TA 1VE9A 5I9LA 1JJAA 2DSNA 5CZXA 2R8XA 3K7EA 3BOSA 2L9NA 4IQ8A 1FRVA 1QE1B 4USMA 1UANA 4W8HA 1SUAA 2KPOA 1NQ5A 2OHFA 3THYB 4KACA 1O58A 4AWAA 3P0JA 1MO5A 2PEHA 4Q2LA 2WYOA 2A59A 4O4IF 4DUYB 4RJKA 4Z4FA 4TXSA 4HDMA 3TR5A 2CJXA 2REXB 1BLUA 3E84A 4R8RA 1QFZA 3PVZA 4BYMA 4N6NA 1D7AA 5BMVA 4MS1A 4KH1B 2AIRB 3NHZA 1Z22A 4BJHB 2G0NA 1V6AA 3OIGA 2MYUA 2IDEA 4YCLA 2GS8A 2E9ZA 1U3VA 3H42A 5L3VA 3L8HA 1T0PA 5K8NA 2VK1A 3EAGA 3EG9A 2CADA 5IFLA 1MOZA 1FDWA 2F55A 2J0UA 1VR6A 4ZO7A 3T4UA 4RV4A 3RVBA 1J90A 2ZH1A 3AL0C 3H3XA 4ARSA 1GH8A 2J7UA 1W1WA 2VJKA 2Q5EA 2FSHA 1CIJA 3AEQB 4ZZ2A 4IP0A 5K2MA 2OPQA 3FE2A 2CLIB 4A48A 3A4NA 2M2BA 4JXZA 3C24A 3ND8A 3VJRA 3F7NA 3G0HA 3VAGA 2O4UX 2FLKA 1LPMA 4JJ4A 4DV5F 3NWGA 4IDBA 3MM5A 2OV3A 1WG5A 4F8RA 4DWJA 1L7MA 1Q7RA 3D1QA 5JALA 4LPSA 2P0EA 2AEEA 1J0DA 2A0XA 1JKXA 1QH1B 5A9SA 1JDZA 4YRTA 2FZCB 3VKFA 3PG5A 5ALEA 2JAHA 3FJOA 3TE7A 2BXJA 2VT6A 4GYJA 2ERXA 1KMIY 2CN1A 4YP1A 2G9VA 1AVTA 4X1IA 4IX9A 5ELMA 2D2IA 2XG8A 3BO2A 3ZDCA 2M2IA 2W0MA 1E98A 4KT0C 1GQQA 2EV9A 1A9XB 4U7PB 3OIVA 2C77A 2D5BA 3VZSA 2AJ8A 4ZCSA 1C0TA 3AB2B 3V1NA 3W05A 4YI5A 4JGBA 5LQJA 1RWMA 1U26A 3X1ZA 4RZHA 3EG5A 4FIDA 1PBAA 2XB9A 1U3GA 1PG0A 2WNHA 1FEEA 3WISA 1GA6A 3U3RA 5T7LB 1K0TA 3H5IA 4MQBA 5KQPA 1HC7A 1BDJA 2WFLB 3Q4GA 5BNWA 1OTHA 5AKKA 4USTA 3DMTC 5HO4A 3CLKA 1E5TA 4G97A 4P84A 2JJ8A 1EUCA 3DM2B 2WPDA 1BEEA 3BIOA 3FB1A 1UDAA 3CWQA 2MWMA 1M3SA 1XNJA 1PSDA 2NPFA 5CGZA 3W5VA 3D1LA 3ZHUA 2D7CA 3HJNA 4M60A 3UNXA 1C7JA 4QPTA 3TTYA 2VSXA 5J1EA 4RY2A 1G21E 4O3SA 3K3PA 1TU3A 3GVCA 9ATCB 2FG7C 2NN3C 1LFWA 2GJSA 3UMRA 1KSGA 5IJXA 2VXBA 3GD5A 2J4FA 3P8BB 3ZNJ1 3C3JA 4BO2A 2Q6TA 3LHIA 1UEVA 4JBHA 1TMOA 4CR7A 1FLNA 2ZANA 2P5SA 3VBCA 3I0SA 1N0VC 2VN8A 3P3DA 3TAXA 4EGLA 3N2LA 5EGYA 4Z1MA 2COEA 4EL0A 4R71A 2WE7A 1CC1S 1E94E 4H31A 1JJCB 1VBKA 4UUPA 3V6LA 4Y9UA 1DTTA 3B3AA 2VH2A 4U8YA 2JH9A 1AS0A 1DTWB 4B4VA 2YWEA 1QG0A 4MIWA 2R5NA 1E2BA 4JN6B 4R1OA 2YQ4A 5KFMA 3BV8A 2X5NA 4OAQA 4RIEA 4XUEA 1BC6A 1OW3B 4CF6A 3S01A 4PO8A 2LPMA 3AERB 3W2EA 4UOEA 3GROA 4TYBA 1Z88A 1J49A 3PRHA 5CLQA 3ZJUA 5A0VA 4O8ZA 3VR6H 2HIYA 2WYIA 3Q98A 5FUXA 2KXNB 4R9NA 1ZY2A 2P79A 4YAIA 1YX2A 1QOPB 2FB0A 1XRMA 2AN4A 2ZYVX 4EABA 2RK3A 4W5JA 1BQMB 2OK8A 4O0IA 2EQAA 3W1YC 3T7AA 2WT9A 3ELUA 2C2DA 1C1CA 3WMXA 3K70C 2X40A 3DOLA 4AWBA 5FFFA 3N2GA 1KZ1A 4F3CA 2CZCA 1O08A 3AC0A 4YLYA 1ULHA 2YIVX 2VODA 2Z2MA 3W66A 2Y0SD 5ETMA 3H2GA 5TDHA 5DHPA 1R27A 5M5BA 5BYKA 3AHIA 1CY4A 2ZYDA 3WLPA 1M83A 3T9NA 4LBZA 4MYRA 3EGEA 4J49A 4XPCA 5B3JC 3KOMA 4DN9A 3UD5A 2F6RA 2OZKA 1D09A 1QQ6A 2O1WA 2ZYGA 1EVKA 1NK0A 4M83A 1Y1RA 1XEZA 2C7PA 4CJXA 3PRBA 5SY4A 4EHIA 3EZ2A 1K27A 1TMGE 1SOMA 3H0PA 4JASB 1Y3IA 3IVGA 4TLCA 3ZDQA 1GTRA 1ECJA 2HQCA 3IS9B 1SIOA 1N7IA 3EX7C 1BQXA 3ESDA 4O4JF 4PLVA 2A94A 3GEHA 1SKBA 2A5GA 3RUEA 1IM4A 4JUFA 4KGXA 4BB9A 3DMJB 1HLWA 1YZTA 4RQBA 1LJLA 4GIBA 3WNVA 3NVDA 1KZ4A 2XW6A 2D1CA 5F3ZA 1NW8A 4WOCA 2IHKA 3QMQA 2ZAMA 4YJ2A 1CG2A 2DP4E 4AY4A 3CZ4A 4RO0A 2HK7A 4EW6A 1H1TA 2X77A 3ROTA 5LFAA 4IDGA 5LJ3Y 3PYGA 4OQQA 2KT2A 3EXEB 3SVLA 2OM6A 1OI3A 2AEMA 2BDUA 3W2IA 3PFOA 2F7SA 2RU3A 1AY0A 1T91A 3QV1A 1SKUA 5ELLA 1H2UX 2WHEA 2PWPA 4KMOA 1WCIB 3RFFA 4HNHA 1YE3A 4E1VA 1EFRA 4ENVA 3A6ZA 1X1EA 3RIEA 3TP2A 4RUBA 5E0OA 2CIMA 1HBMB 4CM0A 5IJ9B 1IN8A 5BXQC 3P97A 1FUYB 4CNBA 1YGYA 3HNRA 2ZH6A 3G68A 4GLLA 4RU1A 5GM2A 4R0EA 4YJDA 5KEIA 1NPKA 5A6SB 5JEEA 5AJYA 2JFWA 2JZNA 4DCJA 1TKXA 1W85A 1L3IA 1BHQ1 4TS1A 5K6RA 1L1QA 5DBIA 4P34A 2M0GB 2HREA 4LRSB 4NU8X 1QM9A 2Q4BA 3LCVB 4KUHA 2Y66A 2ZYHA 2WAQD 4EUEA 2XWQA 5K0LA 1P61B 2DHXA 1JX6A 2PU7A 2I22A 3HBLA 2JKYA 2WPDD 3I1IA 4HXEB 3BGVA 1G9SA 4JI0J 5KNCH 3PGA1 3IDZA 4FN5A 3O3CA 3WLFA 3PP8A 1FFCA 1GTEA 2IZ0A 2Q2OA 3DS8A 2BJHA 4OGLA 4IDDA 1E3SA 3QLEA 1PTJC 4XRGA 4PAQA 4GBGA 4RKFA 1NN1A 1HG1A 4DYHA 2Y0DA 2QX6A 3N8DA 5C35A 2X8JB 2QTNA 4PVCA 2WM3A 2GK6A 1Z07A 1YBMA 3WYEA 2XO6A 2MYTA 1A0OB 3NAZA 5LSOA 5AK0A 1BS9A 4DV3F 1KO7A 3QF4A 3EZLA 2ZCUA 3LKVA 5DX0A 4PC6A 2P9HA 3VYRB 4QPCA 5MF6A 5LIRA 3W6ZA 2WNSA 1OX6A 1K0FA 4F36A 2GGPB 3ZU4A 3RBEA 2YJ4A 5IUJC 3IR6B 1M2HA 3D4PA 2XE4A 4C5BA 1NYTA 4FTWA 1SCUA 4Z1MD 2GVZA 1ZTTA 4PZZA 4AMBA 1AS3A 1RKUA 3DZHA 621PA 4EYEA 2XB6A 2ZUBA 5J2UA 2EFDB 4F2DA 3DHEA 4OEHA 4RD0A 2WM9B 1FYFA 3AB8A 5F98A 4PANA 2VFRA 3HB0A 2O2IA 2B4UA 1W8DA 1YQXA 3P32A 4JA0A 3NIWA 3BQNB 2DR6A 2HAIA 1MW9X 2CDRB 2FN8A 1RWNB 3H11B 3WGLA 1DO8A 4O2AB 4NLRA 3EVNA 4H0FA 4ZOCA 2N7CA 1SBTA 3WWCA 1KYIA 3H5TA 4ESHA 5CD1A 3JYLA 2BBEA 3D4OA 5F1OA 4G5SA 3HMKA 4WWHA 5F9LA 5B58T 3SIPA 1W30A 3QEAZ 4IZIA 3NC1C 5ALFA 4K6KA 4I0WB 1FERA 4N12A 1U48A 1W1IA 2X9GA 4DMKA 1ITPA 3IDOA 3W5CA 3N01A 3LALA 3M9NB 1DWUA 1ZMRA 1Z0IA 3OL7A 4ZPTR 1LPNA 2FN3A 3C4QA 5D84A 3LKBA 4WY2A 2AC2A 1VKZA 4OZ1A 1T3TA 2W22A 1N54B 1V95A 2V50A 1T1IA 3PPWA 4QBIA 1Q16A 4LZAA 4KB7A 2Q5IA 3EPRA 2QLWA 1KOGA 1FS4A 4DV4J 1VFJA 4JJ7A 4QBUA 1WUIS 3KKOA 3ZEIA 3EE3A 1Y4DE 2YHSA 2CQGA 1CJUC 4H7PA 5C53B 4M55A 2R8PA 4OGGA 3C8HA 1AE1A 4URGA 1PJ6A 1FJGB 2WSEC 2HK6A 2IDMA 3M34A 1G8AA 2UYGA 5KX5B 4NICA 4MX8A 5FBLB 1B6TA 3OUYA 2G5GX 1JFFA 1Z2NX 5IDXA 2EW8A 1RE1A 1E6YB 5LVAA 3D5EA 4M49A 1R50A 1OKKA 3V1LA 3R6DA 1F2HA 3R5KA 5KFGA 1VECA 2P2GA 3T6BA 4YB8A 5IAGA 5KI6A 3WDLA 1SJRA 3PQCA 1PEKE 3H42B 1JIXA 3RW6A 1OYDA 2BONA 5KCZA 2AC4A 3TTWA 2FY8A 4HFRA 3PJ9A 2BHNA 1EEHA 1DAGA 4DR1F 3E9DA 1GZ5A 5GMOA 2J0UB 1KMMA 3BK1A 2IBSA 5B7GA 2BZ0A 1IBKF 5FO1A 3I9MA 3UJ8A 4K87A 2V5HG 3U3XA 1I2BA 1C8KA 2CYAA 4PLGA 1EFRD 1WKJA 4LDZA 3M2PA 4JD5A 3OPNA 1TUWA 3W9IA 4B6PA 1W5TA 4C7OA 3PY8A 3GGPA 2QVGA 1U81A 2WRMA 2YVKA 2YY5A 2D3OR 1QHSA 1DCMA 1RADA 5C2CA 4QC2A 4MYSA 3I0RA 1A1SA 3TD2A 1CY0A 3T5KA 5I7SA 3OXGA 1VC5A 3ZNPA 4C4AA 2YX4A 1ZMTA 1KS2A 2HK2A 3MM5B 1UVJA 3E05A 1M34A 2WJYA 3SDZA 3R40A 4F5DA 5JAZA 2YASA 1G64A 2ORIA 1KI6A 2N9UA 4NXNJ 1IM2A 2ORWA 4D9BA 1M1HA 5A9SB 2B37A 4WE3A 4EGAA 3M2TA 2FPPA 2OGZA 2AXPA 2IIPA 1FNDA 2ZREA 3G2KA 4ND2A 5IVKA 2AI1A 3WWOA 1KBZA 4XFDA 2M8DB 1E5QA 4MGKR 3WNCA 1SXJC 1PK9A 3T1HJ 2VPTA 1Q1BA 4UW9A 4NDAA 4X1IB 1YF3A 4BC9A 5HVNA 4V0KA 5JI2E 4RBNA 3D6FA 2UUCB 2CJ9A 4MI6A 4LRXA 4BP8A 3D7KA 1RT6B 2JJ2A 1O6BA 5BW8A 1RWMB 4WKGA 2KW5A 4R1PA 3TQSA 2BVNA 5AE3A 3U1NA 3K8YA 1SVNA 5EMKA 5F9FA 4IHJA 5E6SB 3CF4G 2ZZMA 4OSEA 1B76A 1E5XA 1UCNA 5GVQA 2I2AA 3MMZA 2G13A 5ALZA 5JJKA 2GO1A 4JU8A 1RTTA 2GA9A 1HK7A 2RAVA 4XEHA 2O1XA 2GZ2A 3O1JC 1JLCB 4Q4HA 4TV9A 2CRLA 3QM1A 5JZBA 4WVLA 5CAAA 4R25A 2Q9BA 4F7WA 1U7UA 3Q12A 4O29A 1SUSA 3PQDA 2J46A 1DWOA 1S6QA 2RDMA 5HM8A 2I34A 2DEIA 3WXMA 4DX8H 2AFVA 4ZI7F 3QP9A 1R8XA 3SLKA 2WSIA 2PJDA 1E58A 4KFUA 2LZ0A 1Z5NA 1U28C 1OE0A 3IG1B 2CMDA 3RS2A 1VFPA 3MD0A 3EDCA 2WE8A 1S77D 4P0TA 1QFSA 3IBWA 4ED0A 4Y2CA 3QKIA 4DW8A 3CB2A 3VAMA 4ZA1A 4ZPCA 3K94A 5BW6B 5AXNA 2DUUA 1MROA 3FBFA 3SJAA 4R69A 1VPVA 2PXAA 3IQWA 4PGHA 1JVNA 3EGDA 3RGWS 1HBNA 3O3MB 3D2WA 1QG2A 5KG6A 4F8YA 1XAIA 5H1YA 3TS1A 2OBXA 1G3OA 1PCAA 2UXDF 1WUUA 2IM1A 4IHAA 1Z34A 4IKOA 3HKBA 1P7YA 4N3CA 4J2OA 3H9CA 4HPJB 1TYBE 5D7BA 5HOQA 4ARIA 1N32J 2QT0A 4BCBA 4ZAFA 4MW1A 4R98A 3LY8A 1A69A 2I6TA 5I7OA 2SNIE 4KR3A 2QZSA 5AICA 1N5RA 2GARA 3SKVA 3QBJA 1HG0A 3QI2A 3KQQA 3SLRA 1TVEA 3E0XA 1PEDA 3KDPA 4LDRA 2EJWA 4B8WA 3MXOA 4X90A 4Y2HA 4DR2B 3I8OA 5C5DA 3VC3A 1PZFA 2VNJA 3HB7A 2VXOA 5EMNA 3G8TA 4EYIB 5JCJA 1U4SA 1NQUA 4OI6A 3M6UA 3QT5A 3N2GB 5EMJA 4BMDA 3TBFA 3CFYA 4WKOA 1O97C 1EUDA 1OASA 2ZUWA 5DGBA 1KO4A 5B1IA 3B12A 1NYQA 2QTAA 4MV4A 2L48A 721PA 1X74A 2HHHF 1L5RA 3I72A 2DNKA 1OKKD 2R7WA 1YQTA 2FSSA 1EK5A 3D8HA 3GGDA 3EZ7A 1D09B 4RHEA 4LRBA 2RHOA 4BLWA 4ZQHA 2P41A 4S1VA 2CVFA 2XAAA 3C7AA 2J0EA 3DF9A 3GLGA 4BC7A 2D2XA 1FTCA 5TGTA 4DL2A 4EYSA 1GCGA 3U49A 3RR2A 5IMBA 5JNSA 1Q0RA 1DEAA 2J6SA 5M2PA 4HH0A 3L7YA 1UBCA 2JD1A 1ORIA 2HHVA 4KVZA 4MCAA 5KYUA 2DITA 4F3YA 1IOVA 1B0ZA 1C4AA 3NHLA 2DH9A 1ZETA 3OR1A 2I4IA 1VBXA 1AHHA 1GN9A 5LXYA 2XSJB 2JI8A 5HIMA 1U02A 2D06A 2FKAA 3SEOA 4JI5J 3W7VA 1TUVA 1CUCA 3CMAS 4AS3A 3M33A 4TUYA 1SXHA 4NF2A 1VS3A 4E51A 4K4TA 3ST7A 1RVV1 3LWMA 4QAQA 1WMDA 2I7XA 2FUG1 2HL6A 1CZUA 3R3SA 4IIXA 2XM3A 4TU9A 1ND6A 5EQJB 3I42A 4QUBA 1MGOA 2W9BA 4G0XA 3W5UA 3OJFA 1VA4A 1SL1A 1UJ5A 2IA0A 1QRUA 1L5FA 4LSNA 4YAJA 1YNOA 3TW6A 4KXXA 1KIFA 4UEKA 5KFKA 1Y33E 3TLAA 4PS0A 3FNHA 3V46A 1E1RA 2BM0A 4FMCB 4MR9A 1RBZA 4N03A 1E59A 3HJHA 3G2MA 3N7AA 5HF9A 1E1KA 5PNTA 1E9SA 5ISMA 3F3YA 1P0IA 5JADA 2R00C 1GAQA 4IDAA 4HDGA 4J9UE 1OXMA 2NUAA 2JJ2D 1DI0A 3JD0A 4LRAA 1O4WA 1HPZB 1EM8B 2YXNA 3VR4H 3LWNA 3MMSA 1TFRA 3W8GA 5EMHA 4S05A 1EAYA 1ULUA 1Y9JA 4ANCA 3NKVA 1TCUA 1YS6A 4R41A 3FVYA 3TUPA 1IZ8A 2P6PA 1JLQB 2FZWA 4RVUA 5DNAA 4I4TB 2FMIA 4P9SA 3PDCA 3WP0A 3X1XA 4F60A 4WGGA 1E0JA 3MJTA 3JVUA 2GF2A 1QIGA 2PV7A 5H9WA 2MQMA 4AJNA 2Q46A 4KPYA 1QH8A 4DBQA 5CFZA 3D5TA 4XO0A 2JJYA 4CLOA 3FKBA 3QGGA 1CR1A 5A6PA 3U19A 4HBZA 5SY9A 1WPGA 3RABA 4C06A 1APBA 4JI8B 4BASA 3AA8A 3H5YA 1C1HA 2DNPA 3VUEA 3IMCA 1XZPA 3WNDA 4YWJA 3FPCA 2BP7A 3MEQA 5I47A 1R5JA 2PMBA 1GXUA 2Q2NA 4DCTA 1LRLA 3W1WA 3TSCA 4DV2B 3UMVA 4TYYA 4RNNA 1UOOA 3S2ZA 3QF4B 4X7BA 5FJIA 2GIRA 2QTWB 2SHKA 5HCIA 4YGXB 4KLNA 2WHQA 3WRVA 3ZZOA 4DPMA 2O14A 3OR2B 2V7XA 5AO9A 3HA2A 4EI8A 2EFJA 1S8AA 3GMGA 3RNOA 1MC1A 4ZALA 3SQXA 3TZCA 2CQBA 1YS4A 3B1VA 1JHMA 2CPYA 4ZP8A 5FBKA 1MO6A 4QYXA 1Y34E 1NRIA 5B57C 3KR9A 2ZIAA 4G0QA 3EDOA 5EE9A 4PYDA 2H1HA 5J2UB 5LA6F 1KEZA 1KNZA 1N7HA 3UAXA 5T7BA 8AT1B 3C1OA 4R2LA 3SQOA 3T3PB 1CULC 3I1JA 5HMLA 4L57A 2O7QA 2JK0A 4UNNA 2GZMA 4B47A 2LVWA 5FP0A 4D41A 3E1KA 4Q93A 2PS9A 4CQLB 4P10A 1P0CA 3OZUA 1XZAA 4AL6A 2CB9A 4JEIA 5D6GA 1UKYA 3D7MA 5CT5A 1AB5A 1JZTA 5AW9A 5JCJD 3L0BA 4UEQA 2FPLA 4FI3C 4MW9A 2VG5B 1U9JA 3LPMA 1WKCA 4MICA 5A3JA 3WZMA 1T9AA 3FFTA 3EMKA 2ZAGA 1S4QA 1QZUA 4KXLA 1FSFA 2B30A 4RJIA 3QLHA 4FQ7A 4ARVA 2EW2A 3JS9A 5EE3A 4ZZ1A 1CNFA 3VVBA 1SWWA 1RPAA 4BC1A 3OZDA 1PKEA 3R6WA 1Y6ZA 3QRPA 1OD6A 4JFRA 3HF5A 3V1KA 4PSUA 1Q16B 2PZEA 4W5QA 1P1KA 2XHEA 3HY3A 3PXGA 4BFWA 2YOFA 1GTHA 2BRUC 2DULA 1JALA 5B0AA 1UJMA 3JXEA 4FQ8A 3LC7O 1WOSA 4MKBA 4GSLA 4RNOA 2QG4A 3VNVA 4NV1A 3IO1A 3OJ0A 5HVGA 3I4PA 1FXUA 3QVSA 4XAQA 3GPDG 3MMBA 2Z3VA 1H23A 4P7KA 5TMEA 1QP8A 4PLHA 1M5TA 3IAM9 1UL1X 1J21A 3CT6A 5B36A 3RK1A 1LCIA 2MZRA 1NJYA 3DBVO 1LWNA 3EXHA 3C6QA 5JCZA 4A8KA 2RQ4A 4R0VA 1FK9B 3KE8A 2IBMA 1I7PA 1DQZA 5HW0A 1JFFB 3LY9A 5BR8F 1U31A 1RE1B 3G71S 5KWIA 2OMOA 3BG5A 1NU8A 1YL6A 3NMRA 2OYRA 2JWNA 3QWUA 1IC6A 1OY8A 1SL0A 4BVKA 2NXCA 2W2KA 2WWGA 1NBIA 5EHGA 3NHYA 3BN3A 4WE1A 3RB0A 2EF0A 1L5GB 3PENA 5KJ6A 4DLRA 1L7VC 3HFZB 1L5HB 4N0QA 1PV2A 1PEAA 3QAUA 4FQ5A 3BIFA 4OSOA 4ZPWR 3D3EA 2MYPA 2FHJA 3MK31 7AT1B 4MP3A 2EKNA 4FWTA 2X2FA 3AWDA 4C3MA 1QX4A 4CF3A 3NEJA 5LNK6 2UYCA 3EVMA 3AHHA 3ZVMA 4LIWA 4RESA 3AOGA 1P6UA 4W6ZA 2POKA 3GA0A 3H4MA 1NZJA 1Q22A 2WLTA 3GJSB 5JSUA 2VJMA 1NVWQ 1ADBA 3VSBA 3VTKA 5ALQA 1R0BG 1J8QA 4KBIA 2PAAA 3I0RB 2QO3A 2V65A 3ZCTA 3N2YA 4GW3A 1H0KA 4BFVA 1RHMB 3AI7A 1LI4A 3OCYA 5DM2A 3AD7C 2XRFA 2ZYAA 4L8LA 1RAIB 4PR0A 1YBAA 2XI2A 1KI6B 1L3UA 2EX4A 3D6MB 1CRLA 2FPPB 1B0TA 3QG1A 3C3AA 4DSEA 2I29A 3GNSA 2BBTA 4M8IA 2KXHA 4CO1A 3CNQP 4CPDA 5BR1A 3QBDA 2ACYA 1Z82A 2TMYA 3IKLA 3OESA 1CUYA 1BMQA 5EE5B 2XITA 4GXTA 3D6FB 4MS3A 4HFJA 1NFRA 3HPRA 3KTAB 3VPAA 2ENWA 2B99A 1SKSA 1E3TA 3OU2A 1O9GA 3WLIA 2QMYA 1RHKA 2E4VA 3ND7A 2V3WA 1WBJB 2GWHA 4R54A 3GAMA 4U02A 1T5SA 1DKLA 3PDUA 4D4HA 2ASDA 4FP9A 2BRKA 5FV7A 4I1UA 2J30A 1SC9A 4B73A 4DR4F 2VFUA 5HIKA 3FRYA 4FW9A 1X39A 1GDHA 2WF7A 4CZCA 3MFYA 2A33A 4JT4A 4IOBA 3GG0A 4FKXA 2UXBF 1YVRA 1U7OA 4IG3A 1VGRA 4C89A 4H0NA 2QYGA 5A4KA 4QNMA 4ER8A 3K4PA 3E1SA 1S6QB 3IIKA 3LAKA 3SQWA 4OHWA 2QUAA 4UTPA 5AMXA 1FDIA 3W3AH 1JR6A 2CYYA 4Y6OA 3SIRA 2FLNA 2PR2A 2DFDA 1F38A 3HM2A 1RNLA 1NBME 2QVXX 1T8PA 3KQVA 2R96A 4AJJA 3LLVA 3PFBA 1IQTA 1B73A 3PDHA 4DV0F 3GAAA 1CZKA 1WW2A 3S1AB 3CA8A 4NPAA 1N78A 4C1NA 3SHOA 3W60A 2XOEA 4X8HA 3CZ5A 4IZOA 2H51A 1QGUB 2I2XB 5GMKa 1KVQA 3NYQA 2HM7A 3NANA 3MBKA 2QU7A 2K7JA 4NU5A 2GKSA 4EHKA 4DZ6A 3VV3A 2JGMA 3KD2A 4NARA 4MVJE 1QIHA 3GJ0A 5TXGA 3ZE6A 1Z4MA 5DLGA 2IYSA 3LA8A 1X1CA 5ALIA 5CIYA 1H8HA 1JEQA 1IJBA 1LLQA 3BB3A 3T3EA 1Z38A 3GFVA 4EYQA 4B32A 3QVGA 1I7SB 3B6KA 2YRWA 4QUKA 3BSNA 4JI3F 3DVAB 4GG1A 5K0GA 2EBFX 4QO8A 2HS3A 2PEBA 3CCTA 4LHXA 4KQ6A 1C4CA 2C4VA 4BJ6A 1ESMA 4UDXX 5LMZA 3DTYA 1Q0TA 4EI7A 1FQWA 4FVCA 4RMIA 2ZZNA 2KKHA 2IS4A 4DMUB 3CD7A 4DDHA 2PZLA 3MWFA 1XKLA 3VISA 4OZ5A 5MN4A 2ZC4A 3A6DA 4MR7A 2GKGA 3QT8A 3ZJ5A 4Y1RA 3K9BA 3DO6A 3DXFA 5E2QA 1UM8A 3DDNA 3IA0A 1BJKA 1QK4A 3O82A 3B1JA 1RHRA 4R7GA 3S28A 1TL7A 3FTPA 1GSIA 5AI9A 3URMA 6CHYA 5F1YA 1EUDB 2GXAA 1SQSA 3OMXA 5AVUA 4LYJA 4A1FA 1W0CA 2C7GA 1CBUA 2R48A 1YOVA 5FI3A 2I0XA 5J2MA 2PWAA 1LI5A 3O2NA 4HYEA 3EFOB 4XVHA 1LJUA 2GKOA 2J9FA 3A3OB 1AKMA 1ZHFA 1UXHA 2GJAA 1HLPA 4GVLA 2E5FA 2PIDA 1UBHS 3GLQA 2HRBA 4FDVA 5MN5A 3KV1A 4LN1A 4YJGA 2QK4A 1TJYA 2JAUA 3Q7EA 1V1MA 2HJ9A 3WGGA 5K2OA 2M8HA 1DKNA 2F4NA 4YRIA 1M75A 1X4BA 3ENZA 1BVRA 2FHJD 1SZJG 4L15A 4BNKA 5AOCA 1SK8A 4NCIA 5J5AA 5GAGU 1FU4A 3E9NA 1L5LA 3LTEA 3C6UB 4F72A 4ILEA 3F6PA 1BJTA 3OQ1A 4D9KA 3O8WA 1KOJA 1TT5B 2YJ5A 4XYGA 5H68A 3SYTA 2OZLA 3RC2A 3B3FA 1MH1A 2NVUB 2XHZA 1CVJA 1RVDA 4Q1FA 5F2KA 2ZFHA 2X0JA 4TUYB 3AEUB 4R9RA 1JQAA 2QPLA 1T6NA 4Q43A 3WVNA 3M9OB 4HS9A 2O3QA 1EK2A 4LF4F 3I5BA 2HB6A 1G18A 4EVSA 3BR9A 2W4IA 3KWLA 4O44B 3IUQA 5KFIA 1JR4A 3IMFA 2GUGA 3AFOA 3KK0A 3DFFA 4BQOA 2PLFA 1IYZA 2A9JA 4YP6A 1ULRA 1NDCA 2FEAA 2J07A 4A26A 1HNXJ 3ONEA 1YBHA 2VHWA 1F7VA 3GU0A 4B7XA 5B64A 3KQSA 2XWPA 1DAEA 2YWWA 1NKCA 3A6LA 3ITNA 5LOVF 5D77A 3HDSA 4MR9B 3SBDA 1T43A 1L7BA 1CC7A 3JQ9C 3A2KA 4BE9A 1MJFA 1RT1A 1FMJA 3LP2A 3I6QA 4HDKA 3EPLA 3L05A 4NMXB 1I1NA 1F17A 3PEFA 4EBCA 3GELA 3NWBA 3ZV3A 4YY3J 1ESNA 4P75A 4R6WA 4EVQA 1SQ5A 3NCPA 1XNQB 1HL3A 1GITA 2R8YA 1CR4A 1L7XA 1LLDA 5TF0A 3H98A 1OAOC 5B53A 1JHVA 3A28A 3P9NA 1FXSA 4E5MA 4MK9A 3F47A 2QJ3A 4LECA 2DT9A 1F4PA 3A8IA 2X1LA 5ALDA 2V5AA 2AZDA 1JAZA 1TYEB 3ZJ4A 2DFPA 4WZQA 3OM9A 1DB3A 2PFKA 4TTSA 5BVHA 5FPHA 4ZTUB 2OBYA 3O26A 1Y6JA 1FMCA 4R40A 1V8OA 4DF8A 3MF4A 3RAQA 1W46A 2EFPA 2R42A 4RW0A 4PAMA 1ZI6A 2GMHA 5EIAA 2JAQA 3LT0A 2LCWA 1SZCA 3OJSA 4TLQA 4LF9F 4FHGA 2VJUA 3LUGA 3PVXA 4DZRA 3PXCX 3UD3P 1O54A 4PR3A 3PSAA 1RTJA 1WUHS 3UR3C 4JFAA 2ETXA 3A6FA 2VQSA 4HEA1 2PKQP 1RW4A 3RV4A 4NDNE 1MO4A 2B0CA 4GLJA 1OGYA 4D96A 1S3SA 2Q6BA 1EJ0A 1KAHA 1KRWA 4N8DA 3OI7A 2YH2A 3CX8A 4BMNA 3GI1A 2CNNA 2Q9AA 2KHCA 3MB8A 5P21A 4HDRA 5ENDA 3RARA 3KKQA 3SICE 5AM2A 1PU2A 5DTJA 2QD1A 3PJRA 3ODPA 1H74A 2IEZA 2POQX 1KARA 4GICA 4GH5A 2J7KA 1WEZA 1XLTA 3CVKA 1T9CA 1L3KA 2MQPA 1H8HD 2BUCA 4KLZA 2VJAA 1POXA 5F3DA 2H9AA 1NM2A 3F8SA 3MOGA 1ZONA 2XMPA 4G0PA 1I7LA 4BMOB 3FEZA 1CR0A 4C20A 2P67A 3D2CA 3U27A 1TX4B 1EFVB 1JDBC 4KE6A 5KQRA 1UM9B 3TVKA 1GKIA 5KHAA 2OYSA 4FM9A 2FFQA 1J5OA 2ZSEA 4ETZA 4L0MA 2R1TA 1G0NA 1KZ6A 2ZU0C 2D0PB 5GV7A 1REQA 3MURP 4W5HA 2VT2A 1WP4A 1CUWA 2BTQB 4G8DA 1YB2A 1DAKA 1QAXA 2QMZA 5DM60 1QZZA 4H4OA 5IG2A 3HRKA 5LSLA 2RHSB 1GNRA 1T9BA 2UVWA 4C0XA 4KDCA