4AUKA

Crystal structure of c2498 2'-o-ribose methyltransferase rlmm from escherichia coli
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
357
structure length
355
Chain Sequence
MNKVVLLCRPGFEKECAAEITDKAGQREIFGFARVKENAGYVIYECYQPDDGDKLIRELPFSSLIFARQWFVVGELLQHLPPEDRITPIVGMLQGVVEKGGELRVEVADTNESKELLKFCRKFTVPLRAALRDAGVLANYETPKRPVVHVFFIAPGCYTGYSYSNNNSPFYMGIPRLKFPADAPSRSTLKLEEAFHVFIPADEWDERLANGMWAVDLGAPGGWTYQLVKRNMWVYSVDNGPMAQSLMDTGQVTWLREDGFKFRPTRSNISWMVCDMVEKPAKVAALMAQWLVNGWCRETIFNLKLPMKKRYEEVSHNLAYIQAQLDEHGINAQIQARQLYHDREEVTVHVRRIWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Rlmm, the 2'O-Ribose Methyltransferase for C2498 of Escherichia Coli 23S Rrna.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords RIBOSOMAL RNA LARGE SUBUNIT METHYLTRANSFERASE M
total genus 118
structure length 355
sequence length 357
chains with identical sequence B
ec nomenclature ec 2.1.1.186: 23S rRNA (cytidine(2498)-2'-O)-methyltransferase.
pdb deposition date 2012-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01728 FtsJ FtsJ-like methyltransferase
A PF18125 RlmM_FDX RlmM ferredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2810 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4aukA01
3.30.2300.20 Alpha Beta 2-Layer Sandwich THUMP fold THUMP fold 4aukA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4aukA03
1PJZA 3GRVA 2DPMA 3IEIA 4RTQA 5FULA 2ZIEA 3FPGA 4KIGA 5GWXA 5C0OE 1G60A 1O54A 1VIDA 2AOTA 5LQJA 3OU2A 3MAGA 3NJRA 3GJYA 4FS8A 3VC2A 5LQCA 2A14A 2OO3A 5P8WA 1X1AA 1KHHA 2AR0A 4L7VA 2IDJA 3TKYA 1XDSA 4U7PB 3TRKA 5K0BA 1O9HA 2PLWA 1JG2A 3NW9A 3TR6A 4E70A 1ZGAA 5CCBA 4P7JA 3KQMA 3NTVA 5LQUA 3KQYA 4IWNA 4LECA 4AX8A 4AUKA 2FHPA 3FYCA 4MQ4A 3CCFA 3G8AA 1XDUA 4GC9A 4BP1A 5D1NA 2NXCA 2R6ZA 2ONYA 4X63A 2NYUA 2ZIFA 1IY9A 2ZVJA 3CBGA 3BWCA 3G2QA 2P7IA 2QYOA 3GRRA 3JWHA 3LDGA 3MTEA 3O4FA 4GUAA 1L3CA 5F2KA 2UYQA 2IGTA 5FTWA 3HVJA 4RWZA 4YUVA 4F84A 4KDRA 8MHTA 3SSMA 3HCAA 5DTRA 2P7HA 2VS1A 4OQEA 5HIIA 4YUWA 3PVCA 4DF3A 2OKCA 4RTOA 1M6EX 3HM2A 5E2BA 1KIAA 2YR0A 4C05A 3UJCA 4OX9Y 2ONZA 3UZUA 1NKVA 3A25A 5EKUA 2VDWA 2AN5A 1HNNA 3P97A 2Y1WA 5LR6A 2O05A 3ER8A 1QYRA 2KW5A 3EVGA 2ZFUA 4RTLA 3KPWA 1EQAA 1RJFA 3R3HA 4X61A 3FUUA 1YZHA 1H1DA 3Q7EA 3BT7A 4EQZA 3FYDA 2PX5A 1FBNA 2ORED 3GRYA 3FZGA 3HA7A 5DM0A 5M5BA 4X41A 3PLAE 2JHPA 3I53A 1XXLA 4DCGA 2PX2A 1RI1A 1JR4A 1RJEA 1VL5A 3OE4A 4ER0A 5IKMA 3OE5A 1SKMA 2OB2A 3DULA 3QV2A 1WXXA 5JR3A 2H11A 5E8JA 4RTPA 1IM8A 2ZWVA 1ORIA 5DX1A 3LKZA 4HC4A 5HEKA 4ER7A 3KQOA 4YUZA 3BKWA 3KPVA 3FRIA 3NDJA 3G89A 3SGLA 2P35A 3OZSA 5BP7A 1VLMA 3DP7A 4QQKA 3O31A 4OA5A 3VSEA 1VP3A 3UA4A 3BKXA 2VDUE 1G8SA 3AXSA 2LD4A 4XUDA 3TKAA 5CD1A 2BR4A 3P9CA 5HFJA 3P8ZA 4GOND 1X19A 5EHIA 1N7IA 2UYCA 4HG2A 5EMLA 5T64A 2V74B 3HVHA 3F4KA 1RI2A 3DXXA 4KW7A 3NVMB 3U81A 3GIWA 2Q41A 3G2PA 5CIYA 3P2EA 5E1MA 2XYVA 4GF5A 3M70A 4BP3A 3I64A 3KQPA 3KQQA 3I5UA 1UIRA 3MGGA 1YF3A 1JSXA 4XUEA 5ICFA 4CTJA 4YUXA 3GCZA 3FTCA 4PYNA 2FRXA 3G7UA 2E5WA 3LCUA 3NDIA 4C07A 1R8YA 4E2ZA 5K0CA 2FPOA 3ID6C 2WA1A 1O9GA 3RIEA 4QTUB 4ISCA 3EVFA 2VP3A 3B3JA 1NV8A 3KR0A 2G70A 1BKYA 3HCBA 5GINE 2PVCA 1G6Q1 1L3BA 2YXLA 2ZULA 4EMSA 2ZBQA 3HEMA 1D2CA 3M6UA 1EG2A 3B5IA 2NXNA 4IKPA 4A6DA 2UZ4A 3LCVB 3TLJA 1ZHFA 1KPHA 4PIPA 1NBHA 5GP1A 1KPIA 3HNRA 3BWYA 4PYIA 4POOA 5KQSA 4Y30A 4GOMD 4V0RA 3KQSA 1EAMA 3R0QA 2AOTB 1YFLA 4U7TB 3LHDA 5FADA 4E31A 3FTDA 5KVAA 2BH2A 3CJRA 3DMHA 2HNKA 2EJTA 2AVNA 4QQNA 4X60A 5F2OA 3PFGA 1KR5A 10MHA 3P71T 4PYQA 2O57A 3E7PA 3EVAA 3OPNA 3KR2A 5GM1A 4DA4A 1WG8A 3A4TA 1U2ZA 1JTFA 2C7OA 1TPYA 1N2XA 2XYRA 4HGYA 5K03A 5EEHA 5EVJA 1JQDA 3BXOA 2IH2A 1F3LA 5ICGA 4PGGA 3I9FA 1BHJA 1QAOA 3TMAA 4WVLA 5B1SA 1SVUA 3M6WA 4PYOA 1WY7A 5KQRA 3HP7A 3FTFA 3QOWA 4FT2A 1Q0TA 4H0NA 3GRUA 4HGZA 5DM2A 4OBWA 2NXEA 3DXYA 3AWIA 3M6VA 5E1OA 1XTPA 2HTEA 3T7TA 3NWEA 3G88A 3P9NA 1R6AA 1QANA 5GIOE 1FP1D 2V7EA 3EVZA 5JUWA 1P1BA 3BZBA 3DMGA 2PX4A 7MHTA 3DH0A 3KR9A 4MHTA 2GB4A 4E2YA 3L8DA 3MCZA 5K0JA 3FRHA 1QAMA 3HCFA 4E2XA 3EGVA 3K0BA 5C1IA 3P9KA 1RJDA 4R05A 3PTAA 3T7RA 4MWZA 4DKJA 3NMUF 3GRZA 2YXEA 3VC1A 2HWKA 2GH1A 4DM3A 2GLUA 3P9IA 3B3FA 5DXAA 2WK1A 3QOXA 3HA3A 5CUQA 5E9WA 3TFWA 2PWPA 5ERGB 3V97A 3LGAA 3HA5A 4AZVA 3EEYA 5C9ZA 3AXTA 5EIFA 1AQJA 1L1EA 3KU1A 1RI4A 3CGGA 3MERA 5E9JA 4ER6A 5K0EA 5DXJA 1RI3A 3LECA 3UJ7A 2VZ9A 4C03A 5K09A 5G02A 2IH5A 3C6MA 4BY9E 5DM1A 1G55A 4F85A 5DSXA 2PKWA 3KPYA 4B17A 3SM3A 2OPBA 5FHQA 4PGHA 4RVDA 5FWDA 3FPFA 3B3GA 2IPXA 3LCCA 4CKCA 1N7JA 3EVBA 5DRYA 2NXJA 5E9QA 2UYHA 2Z6QA 4RVHA 5FWAA 5K0NA 2NP6A 2PGXA 3OFKA 3OCJA 4JXJA 4WXHA 3DUWA 5EZSA 3HVKA 3FPHA 4P58A 3THSA 3OFJA 2AVDA 5EGSA 3TOSA 5EMKA 4K6MA 3GNLA 3UA3A 2G1PA 1PRYA 3REOA 2IP2A 3B89A 4RTNA 4LWPA 3FUXA 2NNWB 1NT2A 1RJGA 5BW4A 5LQAA 1NW5A 2B2CA 2B25A 2C7QA 4IV8A 1FJXA 4R8RA 3ELUA 4QPNA 5EZQA 3T7SA 5LQNA 3FUTA 2EX4A 1XDZA 3G2OA 4YV0A 3EVDA 2OBFA 4QTTB 3G5TA 4FSDA 1SG9A 4GBED 4C04A 5F2NA 4PWYA 2JH8A 2EG5A 4FP9A 5EHGA 5EPEA 2ESRA 2IIPA 2YVLA 4Z2YA 1IXKA 3NWBA 3E23A 3G5LA 4PINA 2G8NA 2EJUA 3LBFA 1ZGJA 3LDFA 1UWVA 3EGIA 3MB5A 4KIFA 2AN3A 4P7FA 4P7GA 4PYMA 5DTQA 5EQJB 4DZRA 4PYJA 2Y1XA 3G8BA 2ZTHA 1VQ1A 4OA8A 5FA8A 4LWOA 5GM2A 2JHCA 1G38A 1G8AA 2I9KA 2ZZNA 2QM3A 3LSTA 4IV0A 3UJDA 1HMYA 1ZG3A 2QE6A 4QVKA 2P41A 1NE2A 3MCTA 2C7PA 3GO4A 5FCDA 4FZVA 3NVKI 5EEGA 4RTKA 1L9KA 3S68A 1YUBA 2G71A 3EGEA 2BM9A 2QRVA 3JWJA 3TM5A 3PT9A 3E05A 4O29A 3ER9A 2XVAA 4A6EA 4HSGA 5BW5A 3EMDA 5EMMA 2ZBPA 5KS2A 5LSAA 5LQKA 4HTFA 3EEOA 3FUWA 2FYTA 5K0FA 4OBXA 2BR3A 3A7EA 1DCTA 4GQBA 4MIKA 2IH4A 2ZCJA 1YZ3A 3ERCA 1AV6A 5EIWA 1MJFA 5DLYA 5DTMA 3HCCA 3UFBA 3R9XB 2XYQA 1ZKDA 4KDCA 4MTLA 1JQ3A 2IDKA 3BUSA 4F86A 4CTKA 1M0EA 1MHTA 3MQ2A 2P3LA 3UJAA 3CKKA 3KHKA 2BZGA 3LDUA 3MHTA 5DPMA 5IH3A 2JH9A 1KYWA 4M38A 3A7DA 2CKDA 1Y8CA 5FQOA 2O07A 1VBFA 2QRVB 3VYWA 3BGDA 2PSSA 2PY6A 1RI5A 1WXWA 4AZWA 2ZLBA 3OZRA 2I62A 5FQNA 1DUSA 1KYZA 3LBYA 5EC8A 2DULA 4NECA 4CKEA 4YV1A 3SSOA 1QZZA 2HV9A 3BGIA 2Z6UA 3V8VA 3FTEA 3JWIA 2O06A 2UYOA 2PWYA 1AF7A 1WS6A 4C4AA 4CKBA 2ADMA 5EKXA 3BWMA 1DL5A 3M6XA 2P8JA 2YX1A 2PT9A 3TM4A 4GC5A 4C06A 3UJ8A 2YTZA 1NV9A 2GA9A 3OU6A 5K05A 2HR1A 3JWGA 4E32A 1YB2A 3HCEA 3B7PA 1EJ0A 1WZNA 1X1CA 3I58A 4EK9A 1SQGA 5BXYA 9MHTA 3OZTA 3THRA 3LX6A 3UBTA 1P91A 3DTNA 1ZQ9A 1XVAA 4UOEA 3C3PA 1QAQA 5D1HA 2HMYB 4RVGA 1P39A 3X0DA 2PJDA 3DMFA 3GGDA 5GOZA 4KVZA 1BOOA 3H2BA 1ORHA 2H1RA 2OYRA 1EJ6A 2PX8A 3IYLW 1NW8A 2AOVA 4EVIA 2I7CA 3Q87B 4RVFA 3RW9A 4YV2A 3HCDA 4YMHA 4RX1A 1KP9A 4RTSA 4PCAA 5EOVA 1Q0SA 1NW3A 4ZTBA 5T67A 1R8XA 5HIMA 3TPZA 2CL5A 4E2WA 5CVEA 2FK7A 3WSTA 4RTJA 3FPJA 1FPQA 1TW3A 3KR1A 4XCXA 5U4XA 1SUSA 4XUCA 4OQDA 2P1DA 3K6RA 3R24A 5DX8A 3UJ6A 3HVIA 5GIPE 5K01A 2AOXA 3EVEA 2PXCA 3PB3A 2B78A 2WA2A 1UFKA 3A27A 2ZBRA 4HRAA 4BLWA 3ELWA 1JG1A 3DR5A 4M37A 2JJQA 2P40A 3C0KA 1I4WA 3KPJA 3ME5A 5FHRA 3SMQA 1R18A 3BWBA 3CC8A 5EG5A 3GXOA 5HILA 2QY6A 3A26A 5HIKA 5HIJA 4Y2HA 1JQEA 4GEKA 2C7RA 3HTXA 4FR0A 1R00A 3EPPA 4YUYA 4KWCA 3DOUA 2I6GA 5MHTA 1JTEA 1L3IA 5K0LA 5CM2Z 2YUIA 5CVUA 1INLA 2ZZKA 2OB1A 1NW6A 2PBFA 1V39A 3CJQA 5DT2A 2R3SA 5FUBA 4DMGA 5K8VA 1JG3A 3P2KA 3SXJA 2AZTA 3PX3A 4EKIA 3SSNA 4X1OA 3P2IA 5DRTA 2IFTA 3IV6A 2PXAA 4PYKA 3CVOA 3LL7A 5DM4A 4M7RA 5DX0A 4PNEA 1NBIA 3SVZA 3CJTA 2GPYA 5DWQA 1KPGA 4R8SA 3ELYA 4GOLD 2FK8A 5EMJA 4EKGA 2G72A 2NP7A 2ZIGA 4QVGA 4CWAA 2YXDA 1TW2A 2AN4A 3AY0A 3PX2A 1I1NA 4HTFB 2BM8A 5CVVA 3DLCA 4RSRA 4C08A 2Z6AA 4FGZA 4FSXA 2ZWAA 1R74A 3T0IA 4GOOD 4RTMA 2PT6A 2ZSUA 3R6TA 3LPMA 3UJ9A 1EIZA 1I9GA 3M33A 3UWPA 3OU7A 2PV0A 3E8SA 2ERCA 3PFHA 2VDVE 3KQWA 4V0QA 4AZTA 2YQZA 3FPEA 1X1DA 1M6YA 1JSZA 2CWWA 3DXZA 5DSTA 1XCJA 2ZW9A 3KQVA 5FA5A 3EVCA 3RODA 2CMGA 4E33A 2AOUB 4M36A 1YFJA 1FP2A 1X1BA 3SR4A 2IBTA 2EFJA 2JHAA 3ELDA 3AJDA 3MTIA 1XCLA 2P3QA 5KYGA 2GS9A 3GWZA 3KQTA 3TQSA 4PONA 3ANXA 1F38A 3UJBA 2AOUA 4PCLA 4P7KA 4RV9A 1NW7A 3FUVA 2O0LA 3M4XA 2PXXA 5CVDA 4AZSA 4ER3A 2B3TA 2B9EA 3KKZA 4G56A 3SX0A 2F8LA 4BLVA 3D2LA 5ICEA 3EMBA 5E1DA 3G2MA 2XVMA 1VPTA 4QDJA 4ATNA 1SUIA 1T43A 1XJ5A 4E30A 1KXZA 3LKDA 1BC5A 2BR5A 5HZMA 5LQRA 2ZZMA 2FCAA 4FT4A 1SQFA 4HH4A 4LG1A 4DCMA 1JG4A 2IBSA 4RTRA 3C6KA 2CMHA 2P3OA 3PS9A 4DQ0A 3BGVA 4R6WA 5K0GA 4CXMA 5ICCA 4QPPA 5E8RA 3GDHA 1D2HA 2OY0A 5CCXA 5CVJA 2N47A 1VP9A 5HOQA 2GAFA 4QDKA 4KRGA 5E1BA 2JG3A 1OR8A 4BLUA 3KPUA 5E2AA 1AQIA 3C3YA 1Z3CA 2K4MA 3GU3A 1VE3A 4PIMA 2OXTA 4R6XA 1D2GA 2H00A 3DLIA 3O7WA 4PYLA 4ER5A 2AOWA 2OZVA 3IHTA 4YMGA 2XBMA 2AS0A 5H02A 1B42A 1P1CA 4RYLA 3ORHA 5T6BA
chains in the Genus database with same CATH superfamily
1RT2B 4TM7A 2DHRA 4PBTA 1QHIA 5C0OE 3FOCA 1XNHA 1ROFA 3U7JA 3K16A 4O23A 3DJYA 3RB4A 1X1RA 3HKEB 4IO1A 2PGJA 1AB8A 1NIPA 2VDKB 1MRNA 4YRSA 3UGKA 4WUTA 4DL5A 4F84A 3UO0A 3TZWA 3OSPA 3HM2A 2M7SA 2O7RA 5BR4A 5SY9A 2W6NA 5JAIA 3MRVA 5BY2A 1Q6YA 3GDOA 1V7ZA 1P4RA 1FEEA 4CL2A 3A6EA 4UMFA 4WP3A 4DB4A 1P9NA 1YFKA 1HWJA 1XQIA 1M8PA 3VI4B 1MG5A 2WW8A 4CT9A 4LZJA 2FG6C 2ZSHA 3BKXA 3MUVP 4NRTA 4TKVB 2BKOA 2GNOA 3WX8A 5KYTA 3QO9B 2F1RA 3D6AA 1MJHA 2VJVA 2AHOA 4UTXA 3MR2A 3I56S 3BERA 1DARA 3UAYA 2ZOFA 2C7BA 4GMFA 2FLPA 4KQ2A 2AC4A 5JCXA 4LXGA 2AGPA 4ISCA 5M29A 4OXYA 3KR0A 3PNSA 4JB8A 3SDBA 4LF4J 1QIFA 1LB1B 1GL7A 5JFOA 1U7PA 1IXZA 2RI1A 1MC4A 4BJ6A 5JZSA 2WMYA 5E6RA 2QUJA 3E8XA 4JYAF 5ES3A 1LPBB 4M5DB 2NPFA 3E03A 3GROA 1MABA 2JFYA 1GKUB 1E3DA 2R7MA 2HBQB 1R3DA 1II8B 3G6WA 2OMOA 5IH7A 4O3FA 1THMA 2R751 1NXPA 1V16B 3A2MA 3DCNA 5LMUF 1JSCA 3OA0A 1VSQA 4KVGA 2RHRA 1A96A 3LVRE 3PUYA 4ESEA 1GGEA 1CF2O 3KTDA 3WNCA 4IGKA 1S8NA 2IH5A 2DR5A 2C1ZA 1H1LB 4LZAA 4PLHA 2ECKA 3KDSE 1NH7A 4RVDA 5LUBA 1Z4MA 4ZYZA 2DD8S 2B34A 3RR2A 4ZHSA 2PL9A 4WXHA 5B1EA 2QT9A 3OCJA 5REQA 3L7NA 1W93A 3WQPA 5EHXA 3BRSA 3M8PB 3DMNA 4OVKA 4M63A 3EVDA 2DHDA 4C04A 4FP9A 4RNHA 3V8NA 1CWUA 4HYYA 3LV8A 2DGDA 1Q44A 3PV0A 2ZEJA 1V26A 4P81A 2C7PA 4GI1A 3TECE 4GKKB 3E05A 3R76A 2XOKD 5L95A 4BCCA 2F00A 1OB5A 1DXQA 3F7OA 3RH0A 1DC5A 2ORVA 2XHWA 3UFXA 2IDKA 1JDJA 4CQLA 3SYKA 5IFMA 3CWCA 1VLYA 1Z22A 2IXTA 4QASA 4WHMA 1TL7B 3LK7A 5JFTA 2D74A 5HG0A 3AF5A 1UBJS 2PUCA 1OI4A 3W1EA 4HHUA 2Q5IA 1AUDA 1IG0A 4QUBA 3ZY3A 1KU0A 2YHSA 1NWHA 4IIUA 4ZEOA 1YI8A 4NFHA 4PSAA 1JJCB 3KLHB 4PGMA 1KAGA 1UPTA 4AFFA 4OBBA 5AHOA 1YSCA 3WSTA 2XV1A 3QOYA 4FBTA 3ENNA 3EGNA 2GCEA 1GRCA 4JCOA 4Q1DA 4CM4B 3LZCA 1V6CA 1Y7LA 1YRBA 5AI9A 3GXOA 5HIJA 5TDHA 1AX9A 1OZ0A 2WF9A 2CG4A 4HB4A 2F62A 4ALJA 2H3HA 5LA6F 2ZYDA 3JZFA 1U1DA 3KJHA 4O4GA 3PVXA 1LPMA 2DG2A 2RNEA 4ECXA 2GPYA 3VH4A 1KVIA 4RJJA 4JYAB 3ZOZA 4NXNJ 1BX1A 1UEIA 2CWXA 3ADDA 3D6JA 3U3RA 4PM4A 3CDEA 2ERCA 4HVTA 3R3XA 4UNNA 4PXSA 2VDWB 3S2SA 2IPLA 2PZKA 2GHRA 1U1EA 1GY8A 4H6VA 3NIDB 2GJ2A 4RKRA 4DR6B 1JJ7A 4DUZB 4AYBD 1U6FA 3DT9A 4ZVEA 3MT7A 5AXCA 4WFAQ 1F2GA 1YZKA 2DWCA 1BC5A 1Z62A 1OYOA 5F2EA 2FJXA 4PN7A 1VP9A 1KIFA 5I7OA 1IBLF 1PD0A 1A6LA 4KUEA 5F78A 5CYMB 2VG6A 4L3VA 3Q8MA 4TT3A 4AB1A 1Z0FA 1E1CB 1ZKMA 2G0CA 4GP6A 5FTMA 1VK3A 2IITA 5FF9A 1EYZA 2XKBA 2V8PA 3TSAA 1UPCA 1TTTA 2NM0A 3MJVA 4AUKA 3T3OA 1KJNA 5JUMA 4M21A 721PA 2EPIA 4CKYA 1NHVA 1ORVA 3L9XA 1Z0KA 2XY4A 4TV8A 3X2EA 2VJQA 3CKYA 1KEEB 1JFVA 2B82A 2RAQA 3R7AA 2RGUA 5AJXA 2OP1A 3NNHA 4ER0A 3E9YA 3H5VA 4QUEA 1V5IA 3LKZA 4L4UA 2PFSA 4DW8A 2UUAF 1MEOA 3EPHA 2QWXA 2A5DA 4AVYA 3C48A 3KL4A 1U9CA 1N5LA 5SZHB 3NGLA 1XAIA 2C2XA 1Y9EA 4GP9A 1RHRB 3BR9A 3TR0A 4ZPAA 4MYRA 4F6LA 3DKVA 3SC2A 1WKBA 2QTWB 1TA9A 4J16A 2RBGA 2CLKB 2CQ1A 3P9XA 4F38A 4IKPA 1WKCA 2PMFA 4QJBA 3F46A 4XASA 2XMAA 1Z07A 2NSLA 5LBTA 4FJ0A 3DAHA 1FX0B 5JXGA 2GPAA 1VMBA 1U9ZA 1R27A 1ZPDA 2EW8A 3AM4A 4O44B 4OMFG 1SY7A 4WXEA 2B4OA 5F21A 4BVHA 4IWYA 3AFOA 1DBDA 2ZI3A 3ZGNA 4KYUA 1XELA 2RBEA 1JIIA 2ZAMA 3SBXA 3W7BA 2IXDA 5C1IA 2YVSA 3SYTA 2F5GA 1IAQA 2B9WA 2WHRA 3EXG1 1PYOA 4ID5A 2H0RA 2YKPA 3N6RA 4JI2B 1ADYA 3LUGA 5K2OA 3ESRA 5CXSA 5CZVA 1PTJC 2OUKA 3QEAZ 4UULA 3UN5A 1ILWA 4I19A 3DOMB 1NT2A 2QN2A 2REOA 3EXCX 1CETA 2ST1A 1OD6A 4EG4A 2C7GA 4D45A 2HHTA 1P1TA 1NRXA 2OPSB 3FYSA 3I0RB 2PS3A 2MINB 3A4NA 1EE2A 4QIGA 3HJVA 4LWOA 2BSXA 3KDOA 4IV0A 1RAAB 2I78A 1GJRA 4XRRA 3E0XA 1TL1B 4IDPA 5EEGA 2UZ1B 4CNBA 4B6PA 2VFTA 5FOQA 1E9DA 4IHJB 5EWGA 3V1MA 4MFBB 2VSQA 4B46A 1NBMA 1LI5A 5MFZA 1ZRMA 3SXLA 2P1ZA 1BMQB 3FAZA 1VFJA 1DNPA 4UUXA 2WHXA 1KFDA 3PLRA 1UDCA 4GM0A 3WLHA 2IPAB 4J3FA 3KJFB 4YJKA 2ZRNA 5U4QA 2WNIA 4GKAA 4G1FA 3NMAA 3DFZA 2CQ2A 4DWJA 3K5MA 2EGGA 3PL5A 4KIWA 4EABA 4M3NA 4D4MA 3VYRB 2OEPA 3WBBA 2MSLA 4LF9B 3VHRA 3FA2A 2GN6A 2RH4A 3KZMA 5EWLA 4J37A 4L6IA 3RK4A 3QZ7A 1FXWA 2C97A 1JQJC 5E3JA 1TECE 1OY8A 3QPDA 1RQ7A 3AQIA 2FGCA 4F3RA 1O94D 3HV0A 4I3FA 821PA 5K8CA 1NAQA 2IYIA 2HREA 1RZMA 3W64A 3OT5A 5LA6A 4D2IA 4ARIA 3RYFB 5BQPA 4OB6A 5F3DA 2GX8A 4F67A 1A95A 4B3RF 2OJ3A 5I9MA 4ZK6A 1MO6A 3A3OB 1RWMA 3FETA 1ORDA 1NPTO 5CBKA 3CYFA 1YJNS 2W9AA 4C0JA 4CLZA 2PV0A 4EUKA 2SNIE 1VCHA 4YIKA 5C7OO 1WCIA 4C8ZA 1SMKA 2DFKB 1Y5NB 5KNDA 3JTMA 3QT8A 3C14C 3ZQ6A 1PFUA 3W2TA 2WOMA 4UBJA 4ANDA 2VJBA 3HCWA 1HYGA 5DW3A 3P0RA 5FFMA 2B1GA 5JSHA 2W2MA 3NWPA 3CXUA 2X42A 2WWTA 3DB1A 4DV5B 1NK8A 3V1TC 3KKPA 3KT0A 1AGRA 3KPUA 3UOWA 1Z3CA 4AJIA 3UBMA 2ZYWX 3DKKA 2ZQ5A 3HDQA 3BBBA 4K26A 3P45B 4PHFA 3T7CA 2RGGA 5HL7Q 3K73O 1RKVA 1U4SA 1KHHA 2LU1A 3NANA 4NOMA 2HU8A 2XE6A 4OK6A 1JDBB 1TJ3A 3G79A 3UVJB 3REQB 4LZZA 3FTFA 4Q9IA 3RVRA 1VRTA 1UKUA 1ZD4A 3E81A 1THZA 2C03A 3U0BA 4Q9DA 4Y2VA 2B4QA 2ZROA 1FERA 2QB5A 5AW5A 1BW9B 3AHGA 4DF3A 5F0WA 2PLFA 2ZYIA 3UZUA 4IOMA 4EQ6B 1SCJA 1QYRA 4JVOA 3HWX1 3QQCD 2HMUA 1XJWB 3UD4P 4Q9NA 5CJJA 3WQHA 4EHLA 4B4WA 4GVXA 1OWXA 4E03A 4KNVA 3QX7A 3VAMA 2O2GA 4WFJA 5HMMA 2QUZA 4GD3Q 4JJ8A 4X66F 5KAMA 2PRKA 3EUFA 3GQCA 2ZH8A 2REQB 1KSGA 5J1TB 1ZK2A 2GJAA 3IUEA 5BW6B 1V48A 1TJNA 2R7WA 3N07A 3BF8A 4IQ4A 1SCDA 1NU6A 4ZU3A 3SEZA 1KI6B 4BECA 3L0SA 3GJXC 3HUEA 5LXRA 2J09A 4MTPA 1HR0J 1HBJA 3H0EA 3H6KA 4YDDB 3FN4A 1T3SA 1WPXA 2RI0A 1AMOA 4MQFB 4WKBA 3UW3A 1UBOS 3PC3A 1U1PA 2DH5A 4I55A 2Z5VA 1BJTA 4RUHA 2BKLA 1XMVA 4U2GA 4M83A 4DY6A 5DO9A 4IXTA 1K86A 2HNYA 5KFVA 4AYXA 2ZBUA 1Q7TA 1US8B 2O8BA 3PZRA 3PC4A 1RQXA 4CKWB 2BEWB 4CEIB 4YLEA 3CLSD 1V5GA 1TT5B 1QVGR 4NCGB 1WCV1 1WLSA 2A4KA 3OD2A 4MWCA 5K3FA 3MECB 3TEJA 1U9YA 3I2KA 1NJWA 3VNUA 4EG5A 3MM4A 3QKSA 4YQZA 3TOZA 4A4JA 4LNUB 2OBYA 2XOXA 4F4AA 1BX3A 3KJQA 4HWKA 2PKWA 4I5GA 5DIZA 1WNTA 2YVUA 4ZS6A 3HI6A 2OK8A 2R2TA 2I38A 3PX4A 3ZJYA 4B76A 1CJKB 3M5CA 2G25A 3M2TA 4MV6A 4JI2F 1FKOB 3X1XA 3VHXB 2JGKA 1JEAA 4O4IA 1D8TA 1XV5A 2HNZB 4E0DA 1FJHA 2IYXA 3DOIA 1XNGA 4QW9A 2VJUA 3VR6A 3W63A 5JSQA 3DS8A 4RK4A 5C1OA 5IN5A 3D6UA 4K4TA 1BD3A 3LUCA 5G1OA 4AZ0B 3HHKA 1CBKA 4XH9B 2WWXA 5C1BA 1AXGA 4HKQA 4GQBA 4RORA 2I6WA 1D9ZA 3TAMA 2I1RA 1XZLA 2BE9A 4CNQA 1GK8A 3OWXA 1HD0A 4NCXA 4OOEA 1IZ0A 2XT9A 2CNWA 2QPOA 4MQLA 2GESA 4BV3A 2E1CA 2ZKTA 2OHJA 4HRVA 3ZHYA 5BWOA 4YRDA 1CVJA 2YHAA 1UANA 1BROA 2R7TA 2Q27A 4ZVKA 3GGSA 3K2YA 1R4AA 1LTHR 4R3UC 3V4FA 1SOVA 3ZWCA 5ALIA 3RHZA 3ZZYA 3HCDA 1JJ2R 5ERYA 4QECA 4PCAA 4EYSA 1HBMB 1WB6A 3FOFC 1FP6A 1RHKB 3ABSB 1PJ6A 3BPDA 2QEQA 3GNSA 3C85A 3CWZA 2BJ3A 1LFAA 4EPTA 4RFSA 5GIPE 2CDCA 1JT2A 5AMXA 3I9OA 4HJXA 2MT9A 1JKJB 3FFAA 4IV5A 1SL0A 4G5FA 3O26A 4OLOA 3GAZA 4EDFA 1LRJA 2ZUCA 4CM8A 3T52A 4U2DA 3W79A 4R1UA 3RC7A 3TQRA 4A23A 2VZ0A 1A9XA 1CUFA 3RAJA 5DZ7A 3PXGa 1FYDA 3ENWA 3IXLA 2ZWAA 3L4SO 3TIFA 3ET5A 4CR7A 1J8YF 4GMKA 3TLAA 5BNZA 1WEHA 3E2IA 5ENDA 5ETPA 2GEUA 2VATA 4JKIA 5C53B 2J0XA 1QGYA 3PCRB 1IVYA 5K05A 3EFHA 5IDVA 2B3TA 4B4OA 1CE8B 5HVNA 2XB9A 2VHXA 2J6BA 4DQ0A 2GO1A 2OY0A 3C3LA 3AF6A 1IUJA 2RDIA 5K14B 4XJVA 2J9RA 2VF4X 5IAOA 4MKHA 1IN8A 1XI2A 2GM3A 3T5MA 3IVRA 3NJ8A 2D41A 1T1IA 1JH8A 4PZAA 3S70A 3H99A 4KUGA 2VWHA 3H87A 4KIGA 4Z4CA 1Q1ZA 3ZE2B 4LRSB 3M2VA 1ZP6A 4BVEA 1S1XA 1ORWA 1A9ZA 1SEPA 4RPFA 2NSHA 3CRRA 4GUAA 3K1JA 3SYZA 4KX3A 2H9ZA 1RP7A 3GD5A 1BO6A 2GYYA 3VISA 2XSZA 4U7WA 3ETCA 4IDCA 5EJEA 2MLYA 2CVHA 4QPJC 2VCHA 1P2DA 3DVSX 4JI3J 1W5SA 1JR4A 4RM2A 5JI3E 2I3DA 4EA8A 3NHSA 1N34F 4RTPA 2PKCA 1BDBA 4RBUA 2YOGA 4ZWNA 1E9SA 4CQMA 1G3IA 1U9IA 4Y65A 4QQKA 2Z4SA 3O4VA 1FJ2A 2D6FA 4MO2A 5CD1A 3NTRA 3R9LA 3AD8C 5JDIA 1LDBA 1J8MF 2IYEA 5F8JA 5HFNA 1IZ7A 1E6CA 2ECPA 3AVYA 4GX5A 1K08A 3B6ZA 2BW0A 2O0KA 3FRZA 4F36A 3GG2A 4C11B 4LQDA 3TKLA 4CTJA 2FPOA 4WW0A 3CDAA 4QO8A 3BILA 1K44A 3IILA 3B3JA 4DUZJ 2PKQO 1SURA 1JHZA 4Q4DA 3D7RA 1G98A 2CQIA 3H9BA 3BWYA 1BE1A 2HVHA 2WD9A 5FRDA 1UT8A 3P9YA 4DILA 1LU9A 3ZLUA 4HK4A 4NBTA 3MM7A 2XWQA 2GXSA 4YI5A 4KGZB 4CQNA 2YHBA 4OQQA 4KO3S 4BBJA 3R0VA 3K9HA 1SL2A 4I4IA 1MT3A 1UDWA 2VKTA 1AN9A 2MJLA 4V38A 3CO5A 2G13A 2ZJ6A 2PS9A 1MMLA 2A67A 3FSXA 3PHTA 1QO0D 3V8PA 2ZI7A 4PHCA 1WDMA 4QOTA 3H20A 3UJ7A 2VK2A 3UMGA 1RWVA 1JU9A 2E1MC 5TE9A 2N46A 3W8RA 2HK6A 3CUNA 2IDLA 1N2GA 2RH8A 3E9DA 4R5MA 4CLOA 4B2YA 3HYTA 4DE5A 1ZJYA 4WXPA 3RJ9A 3ST7A 1E77A 2IIBA 1FJXA 1HOTA 2FW8A 4LHWA 6FDRA 4ZPVR 3SXUA 3KAKA 3H65A 1EGQA 1S0VA 3OAAD 3QXCA 2MLZA 3DFFA 2QNBA 3HCXA 4Q6WA 2WIJA 1R50A 1WHWA 2VYND 1SC9A 4D9JA 3NYIA 3HZZA 3MAQA 4YRTA 4BLRA 1G5PA 4EFLA 2JD2A 1XZBA 4HN4B 3GLFA 1XIVA 1NW4A 4DR7B 4PKDB 5J1EB 2XE8A 3N5KA 4W90B 3KSAC 3N7TA 4R2KA 2O5RA 1ZM3A 1JWAB 4NE7A 2WPDD 1OWPA 4QXQA 2J9EA 4N47A 4EP1A 2O8DB 2ZC3A 2JH9A 5IH3A 4TL6A 1E2QA 2D7CA 2BX6A 2EK6A 1QHEA 3I0ZA 1F0NA 4B9EA 4GFDA 4KZPA 2Z2JA 4BNDA 4NG4A 3WA6A 1KI3A 2AT1B 3FVTA 3MI7X 3JQKA 2D1RA 4ZVVA 1Q17A 2BFPA 3U4DA 1LSUA 1TADA 3EHDA 4DG8A 3VR1A 2LVBA 4WXWA 1LZKA 2VHJA 3A06A 1JR6A 3RVQA 1HYSB 5FBLB 1HFKA 4G0XA 4QR2A 1CQXA 4MA5A 2RGRA 3AYXB 3HA2A 4O8ZA 1C0UA 4I36A 3DR5A 3W6NA 5CH8A 3DDZX 2IYAA 3VYTB 3CZ5A 3G6VA 2DVIA 3N2KA 3MM5A 3BICA 4V1Ak 1B1AA 2F9LA 2AZTA 2FRDA 4RV5A 2MYTA 2AQIA 3PDIB 4F04A 2K7ZA 1AQ6A 1EHYA 3TW8A 2FK8A 2PJZA 2KE5A 2P6NA 1B14A 4S2UA 4X7RA 5CLIA 3B6JA 4I67A 1KFEB 3PJWA 5EJGA 2IWRA 1PQ4A 3QRWA 3RRKA 3DVAB 3OEEA 4P7KA 4MI3A 3KKZA 3ISND 3Q86A 1GG5A 4ROTA 1M66A 2MTBA 1GTVA 1RBMA 1ACJA 4NG5A 3EYAA 1ULZA 1ULAA 4JI0B 3D4LA 2GAFA 2H65B 1N34J 1QB7A 1FEHA 2XITA 3RVOA 3DLIA 3WKBA 2VPWB 2V7BA 5E6SB 3L49A 4P6VF 2AZDA 2XCIA 3WIUA 4LSGA 3THWA 3Q3IA 5IBPA 4U67Q 3IEMA 2P5YA 4J2OA 1KGDA 3N2GB 4P5DA 4MR9B 2WSBA 1LS1A 1LF0A 3RUDA 4RGYA 1NUPA 1FP4A 1XLTA 3ETEA 1PGJA 3A9TA 2HC9A 2X2OA 5I4IA 1VZ2A 3UAOA 3EX7B 5BR8B 1BH2A 1QAJA 1E2LA 2D2FA 1WJGA 2NTEA 4MMZB 3D4IA 3V00A 3BGUA 1G3RA 4X65B 3SHQA 3PEUA 2UVQA 3PC8C 5KVVA 2ERYA 1YHQS 3CURA 5GMEA 4FCWA 2IXAA 1SG0A 1L4UA 3QIAA 3AG6A 1LPAB 1MW7A 2G76A 4MPRA 4QGGA 5F1KA 2A6OA 2VDUE 1G8SA 1DB3A 2N7CA 1AZLA 1V1MB 2Y71A 5DOZA 1PBTA 3N86A 3HJFA 4BP3A 1NYQA 3DL4A 1TZ2A 3MOIA 1FPMA 4NYOA 1RTDB 1KQFA 1BXNA 2PI4A 1CJUB 4C89A 2VQEF 3MEDA 1PNOA 3W2IA 3QEKA 2BD0A 4GOMD 3R0QA 3T15A 1DQAA 1Q2UA 4XSHA 2DHGA 4XOIA 3SKXA 3U3MA 1K66A 2GAGC 1U99A 5EEHA 3AB7A 3VR0A 4CH0S 3L1UA 2JWNA 3OM8A 3LYUA 1R27B 2Q4DA 3DXYA 4RPGA 4WACA 1K75A 4II7A 3MSCA 1V7PC 4R9NA 1CR6A 4E2YA 3P9KA 3NMRA 1V5VA 1M2OB 2BFBB 4WKGA 1E2JA 3HCPA 3P5TL 1XRQA 5G4KB 4G5YA 3DZGA 1QG2A 4C03A 1RDFA 4YCBA 1Z4OA 1IBSA 3K0AA 2FZLA 2WIBA 2HWTA 3W3AD 4RHUA 1R8QA 5A3RA 2AG0A 4OLJA 1GUYA 5BSFA 4AKTA 5FWNA 2DQSA 2KB0A 3HB7A 1GT91 2PT7A 1NO8A 4B9TA 3CUWA 1G21B 2O7NA 2ORWA 4BC7A 3W62A 1GRVA 2ZB2A 4G65A 3T9AA 3EGIA 1VQNS 4JA2A 5T4EA 1JJ4A 2P6SA 4JGIA 1NXOA 3SBOA 4W4TA 3FKQA 2HFOA 5ENZA 1N6QB 1SAYA 3BJIC 4XVQA 4J7AA 4I0WA 5K2MA 4GUDA 3OSZA 4X97A 4USUA 5LXYA 1PV1A 4N7BA 4HB0A 3K31A 4MWEA 3BFJA 2AWZA 3PNLA 2VIIA 4E6PA 3PC8A 4E7PA 5B3KA 2CQHA 4OX9J 3VCDA 1C30A 3VF0B 3DZKA 2B4RO 6LDHA 3THYA 3K2IA 1HNIB 1KTVA 2ACKA 4CKEA 3OL8A 4F71A 1GR1A 2D5IA 2ZXUA 2AYYA 3UG6A 3TFOA 3F8SA 4GT1A 2HBYB 1HIYA 4TYWA 1WZNA 1XMQB 3QSIA 4YO8A 3T35A 1OTXA 5HANA 4Q02A 3SFTA 1RPTA 1RE1B 4B3HA 1LH0A 3S8EA 4RJTA 5CVEA 1IE3A 2HF8A 1I94B 3EZYA 1HQEA 5NULA 3CNBA 1EDZA 4QM6A 4QYZJ 4TL8A 1AQYA 4AD8A 4JMPA 4QWCA 2HLDD 2DQKA 3AVTA 2GX6A 4DMZA 1NH8A 2EOAA 3D7KA 3G1WA 4WY5A 4B02A 1NW6A 4UEQA 5E41A 3WNDA 4PXCA 3Q8YA 4UFNA 1K6JA 1H2EA 1D5WA 3I01A 2PRIA 3WICA 1OJLA 2LCQA 4C4YA 1GLVA 2GZAA 3V6HA 5C5CA 4DV2F 4IINA 2ZAYA 2DBVO 3B1KA 3NIGB 4KQKA 2WBLC 2PWZA 3D3QA 1Z4PX 4KHPJ 5EUQB 1SOMA 2G7MC 2G2ZA 1ZJ4A 2W6ZA 1FP2A 2BR0A 2CYAA 1WCIB 1H42A 2BY4A 2J3LA 1TR0A 5A0YA 1P1HA 3SJBA 1E60A 2WP0A 4N1AA 5BYJA 1FTNA 4OOFA 2JRLA 4GVLA 4IAOA 1ZCJA 1KC1A 1ZH0A 2YX4A 4XDDA 1DFDA 1H9BA 2WONA 5HKKA 3EZ5A 4LBHA 3KLEB 3U3DA 2OXIA 1NVBA 2DNZA 5HDBB 2Q3HA 5C1DA 4IHQA 3UJNA 1KOOA 3MTQA 1FF9A 1G60A 1ZH2A 1FX2A 1OX6A 1EP2B 1BCSB 4QO7A 4CG0A 4F9GA 4BYGA 2XNRA 4A2PA 5KIAA 1JKMA 4B3MJ 3PE6A 1DTTB 3CMES 4EELA 3L6RA 2EI5A 4P58A 4R2WA 5CLLA 2REBA 4YUWA 1UJNA 3ITEA 2JLRA 5KNBA 4R9VA 3NS6A 1NQ5A 3UMBA 2C7VA 3B12A 4D0LB 2VONA 1YB5A 3EQ9A 3PD1A 1WKLA 4FPXA 5KU7A 3EK2A 4BRUA 1LXCA 4DR2J 1N2SA 2Y92A 1PR3A 1AH2A 1FK9A 1J2EA 2XY5A 3KXPA 4FF2A 1RHUA 1M5RA 3NR2A 3TD6A 4FGWA 3ZZOA 4MRAA 3K9GA 3R2CJ 5HMYA 2W2XA 4DNPA 5K3BA 3UEOA 2OHOA 3CGWA 1R4MA 4KQIA 1MJGA 3I64A 4EL5A 1YF3A 1XP8A 1KNQA 3IUSA 1FX1A 1LJUA 2WABA 4D8UA 1E66A 3LP5A 3NG8A 2O8EA 2WK4A 1T0HB 4LTDA 4V1CB 5IZCA 1CDDA 1NTRA 4K86A 1USVA 5ED0A 2JLCA 5EHZA 1EAMA 4D8VA 5KVAA 3TVDA 1Z6YA 2ZH9A 5PGMA 1CG6A 1ZITA 4ZT6A 3JQPA 4E09A 4PGGA 2ZTSA 4MUAA 2AGOA 3M6WA 1G0NA 3GL9A 5BN4B 3TK1A 1GQRA 2XF2A 4ZHRB 2ISCA 3K9FC 2W2QA 3PE4A 2RUGA 2WKWA 1UOQA 4CLXA 4A0GA 7MHTA 1RADB 2MZSA 2AA3A 3PC7A 4YJFA 1QYXA 3SFUA 3DEAA 1X14A 2E66A 3W9IA 2YWRA 4G6ZA 3PXXA 1RI4A 5JG7A 1CCWA 2I2DA 2NU7A 2PX6A 2OGUA 4JB2A 1BKSB 5EE3A 3TIGA 4UD2A 2NP6A 4QFMA 4NJEB 4ZP9A 4IVRA 3HR7A 4NPHA 2NZXA 2HGNA 3WP1B 1ZN2A 4DR3B 1AO3A 4O3OA 3BSCA 2ATLA 4GXNA 1UP6A 3FYUB 1WEZA 2O8VA 4R0JA 1K3UB 2QZZA 1I2CA 3S5JA 4NNJA 3BDEA 2K3KA 3GT4A 2JHCA 2VG8A 3M9LA 4L57A 4HEQA 4OZ5A 3TP2A 5H68A 3IQZA 5I45A 1PR4A 1RTKA 3TNYA 2R8KA 4TV9A 4KO4S 3OZFA 2Q43A 3OCCA 4C5AA 4OPMA 2WY2D 2RQKA 2ZTVA 2VYNA 5JAHA 5EIWA 5AJTA 3TQQA 3RVSA 2F4VJ 2OEJA 3ZU6A 2ATCA 5BMOA 2XGMA 2VDIA 3PE3A 1OHHA 2YCBA 2I66A 2QMHA 1U8YA 2BJ8A 1NUTA 3QLJA 2C29D 5L7WA 3PQ4A 1I2MA 2QJFA 5HA5A 4L15A 4HWSA 5I7HA 3T1OA 2GDJA 1CZUA 3QF4A 3RI3A 4EFAC 1GPLA 4R25A 5JVDA 1XVAA 4OX6A 3N0WA 2R8BA 1D3AA 2NSJA 3BSNA 3TW8B 3Q15C 3VTFA 1AB6A 1NUQA 2RDJA 2VTEA 4JBIA 1QNFA 4TUYF 3HXKA 1B15A 5HIMA 3W5AA 3R5CA 2DWOA 4AKIA 1XNRJ 1BMQA 4RL4A 3EZ9A 1RAAA 1P1LA 1RT6A 4DG1B 3MGCA 1GAQA 9ABPA 2W6PA 2G82A 3TI9A 4U3JB 1EIWA 3MMSA 2N75A 3R4VA 4ZEXA 5FTJA 1T9YA 4Y9DA 3DOUA 1FNSA 4DBLE 3HKDA 4LJ9A 3ZTQA 4O5OA 4NF2A 1PNQA 2HOQA 3R7DA 2KL8A 4YECA 3DZBA 1Y4DE 5JXJA 1R8HA 3DWFA 3H90A 1GFIA 2PD3A 2ZB3A 3MJDA 5BW8A 3PA8A 2RGWA 3UJ9A 5CDFE 3WGYA 1PZXA 3GJ8A 4XQCA 1TQDA 1W34A 1JYFA 2F3PA 3FNHA 1Y6GA 1L5QA 2JJ1A 3BSFA 3TBKA 1SR8A 1USKA 4KXQA 3OIUA 2JFUA 4MB6A 2QSUA 1QSYA 2C5AA 3CU5A 2PYDA 3PQ6A 4Q0MA 3PRBA 4DHWA 4Q3NA 5L8RC 1QIEA 1KJIA 2ZKIA 2X3YA 3KTFA 1Y4ZB 1H6DA 2O3QA 1SWVA 4U95A 1WZ2A 4PF1A 3ENVA 5KYYA 1X87A 4QDUA 3MLAA 3RYFA 3SBEA 5JBIA 3A3OA 4FK8A 3FPAA 1ZMBA 3G68A 3UK1A 3O1HB 2Y1FA 4JLKA 5K0BA 2CUTA 4HTAA 4E70A 1OO0B 3AL3A 4AJNA 4NZPA 5F2KA 1C29B 3VVLA 3MYYA 5D3ZA 5NLLA 4BO6A 4IEFB 4FW9A 1MFPA 4ND6A 4NBLA 1V6SA 4C7VA 3WDLA 1YOBA 1DLOA 3RIHA 2F4VF 4DL6A 2HQRA 1P6TA 3WYCA 2FG7C 1Z4IA 1J25A 4TN5A 4TMTA 5HF9A 5BV1A 3OOHA 1JK9B 2R2RA 2IY5B 2WC1A 4M9ZA 2ARKA 2W6OA 3BKWA 4B9SA 3TRHA 2HV8A 3TNFA 3DP7A 4LBWA 3H42B 2HVZA 4RKUC 4L5BA 2J7PA 4YP7A 1PK8A 3BQNB 3LXUX 2RKIB 4UJ3A 4Q2LA 2FSUA 1JU4A 2N42A 4GF5A 4KUHA 4K4XA 4K4SA 4AQYB 4PYNA 2RGNA 4C07A 2KN4A 2BANA 3B82A 4XI9A 4GGMX 2GCIA 4DX5A 4XIUA 1MU2A 2IP4A 2VHYA 5K8TA 3OIWA 1BWVA 5B7QA 1W6RA 1P1RA 2BW7A 3TTTA 3L8GA 2BGTA 3Q0IA 2I4IA 1R8BA 1V35A 3X1ZA 4AI6A 1QB8A 3ZVRA 4JI0J 4RW7B 3P96A 3BKTA 4D4JA 4OUDA 4IMIB 1AMUA 1E3EA 4IW3B 1OW3B 5EUCA 1P9QC 4C0KA 4QZVA 1T03A 3EPIA 2GEBA 2C9MA 4JI1F 2FX5A 3U80A 4TMXA 2E4WA 3U3XA 4PXBA 5K0JA 4DSTA 3OQMA 2DBZA 5B58C 3A1FA 3CCSS 5DNUA 1DEOA 2AK2A 3IP6A 4RY8A 2IHJA 2Q50A 4NS4A 2VBIA 2ZIZA 1QRSA 4OG2A 5D3MA 1NJ8A 2XH8A 3MMXA 2IRUA 3VDMA 4OAOA 4LF5B 3SI8A 1N8NA 2EC2A 3FPHA 1KE2A 4JEMA 4G1BA 2OMEA 3RUBL 2X40A 3S28A 2IHR1 1XA4A 3R4CA 4TZ0A 3HDHA 1ZJJA 2EG5A 3EC7A 5AVQA 4C4SA 2WV7A 1US8A 3MD1A 5TNXA 4FFNA 5MAOA 1PEYA 4H1HA 4PO3X 2HY7A 4USJC 3TD2A 5A0VA 4XJSA 2D0DA 2I87A 1OFHA 2I9KA 1T8EA 2NW6A 3JR3A 4KAJA 2HMSA 4M0UA 4YCCA 1HBMA 3NM5A 4XW2A 2UUAJ 3MMAA 4MQBA 5IANA 1HWYA 3I30X 1GD1O 5C25A 1U6KA 2GHTA 3R9XB 3VU1A 1MH1A 4KDCA 1R43A 1FSPA 3O93A 3C8MA 5FQOA 3B7GA 3KLOA 2HZAA 3HKWA 3TLCA 2HHQA 1E0DA 4FOLA 2J5XA 3CWJA 1FLVA 1N6NA 3BWMA 1HL7A 1OS5A 1I10A 3FCAA 5JV5A 3UK2A 3HHEA 1XPUA 4BFLA 4LKOA 1BKDR 4BNDB 3DTNA 4IR9A 4RVGA 5EE1A 2H17A 1RD4A 3I0SB 4PE5B 1UFVA 1U0SY 4MS1A 4AD6A 4DIEA 5JCPA 2ZR0A 1RPZA 3JTOA 3P8BB 4BX3A 4MP6A 3EZUA 3GJQB 1SUSA 1XQYA 2MGZA 3DN9A 3N8DA 2D0IA 2FPLA 1VA4A 1V8PA 3CCCA 2MOKA 3QIPA 1ZVKA 3BM5A 4V02A 3CVOA 5E0KB 2LMIA 2HWIA 4F26A 3FSIA 4ETIA 4R8SA 4RY0A 2AFVA 2DB3A 1TT7A 1U1RA 3QFHA 4LXTA 1S0UA 4O2BF 1XSEA 1NC3A 3QJYA 3U4IA 2VI5A 2EWHA 3WBJA 1S7GA 2V7WA 1OBCA 2CJWB 3B38A 3U9TA 5KX5A 1AV7A 1TJYA 1YQEA 2P30A 3OD1A 1EE9A 3TQSA 3UDEA 4KAXA 4B80A 4BZWA 1GZDA 1AA6A 4BHTA 1UJ4A 2P9FA 5ITHA 1YC5A 3FMIA 5ICEA 4LHVA 2CCGA 3RGIA 1U7XA 2VAXA 5FNVB 3L0DA 4GWKA 2ZGVA 1RGVA 4KQMA 3SQNA 2I76A 2QTGA 4RQBA 1MFZA 4H59A 2LBPA 1CUGA 2OZVA 5G1PA 3G9CA 4LOIA 2HU2A 3VR3D 3H2HA 5BYBA 4IIEA 1D6SA 3DPSA 3HDSA 3LO8A 1JAIA 2IDEA 4IRUB 4E13A 4RA6A 1ZGAA 5L40A 3VU3A 1LD3A 2YZKA 1GNTA 4J9OA 4TYBA 2P7IA 1H0HA 4F91B 1ULHA 5DYWA 3HT3A 4RTOA 2DQZA 1IUKA 1OYWA 2NV2B 5LC1A 2O2HA 4Z1MD 1DQPA 1X4BA 4RF3A 2GT1A 1OT5A 3GRYA 4N8EA 2WRZA 1IH8A 2QL9B 1IHDA 4DZTA 1L5RA 3OTEA 1YB6A 4U9HS 2HQ1A 1YCGA 2HPZA 4FWBA 4DT1B 3AD7C 3SDSA 4M0KA 2QYGA 3QFWA 1WMAA 3F78A 4FFOA 3AXSA 2MZJA 4CL8A 2X15A 1EFCA 4WIAA 4EB3A 1GTHA 4XGRA 4LPSA 4YT5A 5CDTA 1AUOA 2XXAB 2CNDA 1EXVA 1S1CA 3L7PA 2FYXA 3GRFA 2LFVA 1NM2A 3LQ4A 1JEQB 3L7DA 2VL7A 2GDZA 1GU0A 4G5QA 1N7HA 5DNAA 2QLFA 3NEYA 2RQMA 3UB3A 1V3ZA 2OHFA 2P91A 4NICA 1U4BA 3SBMA 4WZBB 3UR0A 3QVXA 3OZBA 2BWJA 2JLZA 4TV8B 1L9XA 2HNKA 5FO1A 3IWNC 2HMWA 4G36A 4ZITA 3SMZA 2VXOA 2VBZA 5A05A 5K03A 2JX2A 3CVKA 1HDGO 1R0SA 5BSMA 3CULA 2BIFA 4YONB 3IBFB 1WUKS 5KYUB 1XVVA 4Y2RA 1ZAXA 1X13A 3ZV7A 2VICA 3T54A 1YZFA 3NAIA 1A9SA 3T5GA 1M2OA 1G5RA 3QJPA 4D6PA 3G17A 4FKXA 1QQ5A 3KLPX 3B3GA 2IPXA 3VNBA 1DKRA 1K97A 2HXGA 3DUWA 3V1UA 3VNVA 1A71A 3OJWA 5JJLA 1XRLA 3E35A 1YS1X 5LQAA 2QA4G 1YR7A 3VSCA 2O2IA 1DY3A 2OTCA 1Z2AA 4G5HA 4H3VA 1IKYB 4L9WA 1U1CA 4MW0A 2L19A 4CM5A 3GA5A 2E55A 4MR7A 1V1RA 2G06A 3EDQB 4CUKA 5T8KA 1XLUA 4B7CA 1LFPA 5D3GA 1LGYA 4I1OA 1GDDA 4KODA 1L4BA 3VTKA 1YS4A 4O08A 5C7IO 1JAXA 1GILA 1EJ7L 1NR1A 1O5OA 1BU8A 1U0BB 5FOXA 3UGJA 3GNQA 4H17A 1RXYA 1XZNA 5LVAA 4DUTA 3JAWA 1YS7A 5B0EA 4DSOA 5IQQA 5GJCA 2YHIA 4NU8X 1SFRA 2I62A 3DONA 2CHFA 4ALLA 5T4BA 3UTDA 3GPBA 1MEJA 3N2EA 3QNWA 2EG2A 1HK7A 3NGXA 2XW6A 1LW2A 1BE4A 3H2JA 3UV6A 5I9TA 1YB2A 2F3TA 5CYJA 1I3NA 1K6IA 4RSMA 1WXGA 3LRXA 1PJAA 3P20A 1T0JB 5AW9A 3W2EA 3IXQA 3QGHA 4U7UD 2PZJA 1WVGA 1N0VC 1E94E 4BBZA 5ELMA 4LF7J 1ID1A 1HD1A 1NXTA 1H4VB 5HROA 2Z56A 1SXJD 4RK0A 3MMCB 5CDFA 5DTEA 4ZRNA 4YB8A 4S1OA 4KV8B 4NEYA 1PJ2A 2H2GA 5THXA 3WVNA 1FFDA 4TY9A 2Z3WA 4PUOA 1FOEB 3DRYA 4CV1A 1TYBE 3QLEA 3P2KA 4HNAA 1GPDG 4PBSA 1LC3A 4V03A 5FPPA 4PYKA 3IQIX 5DM4A 2HW8A 2CADA 1CQZA 2QMXA 2R7LA 3OP1A 2C96A 1V8BA 4WNIA 4C08A 4NLQA 3OW2R 3MEKA 4HVLA 4YJ3F 2RGNC 3R3JA 4CM8B 1U48A 4P2MA 1QDEA 3TLMA 1QRAA 2P27A 3V81B 1GPBA 3QNUA 1U8AA 4BCDA 2X6RA 3WB0A 3SM9A 2HF7A 3CF0A 5DBGA 5LNK6 2JANA 4ATNA 5HLFA 1G18A 5LFAA 2JFBA 2B0GA 3Q6IA 5F8GA 2V6AA 7AT1A 4X54A 4CM1A 2G4VA 1JLSA 3DYBA 3M4NA 5DM70 2AV6A 3PDIA 4LXUA 2V5HG 1T2UA 2O7VA 1VJRA 1JEEA 1L5FA 2AYMA 4Y9UA 4WK6A 3HB4X 4BX9A 4E8UA 4A8KA 1HH4A 4EUSA 1Q84A 4GZMA 1RJWA 3ZDZB 2CUNA 1EFLA 3MGKA 3QJJA 4QSMA 5DYGA 5CT6A 3Q89A 4OXIA 3CSUA 5IXSA 3OFFA 4Q5IA 4EHFA 2O0JA 5AOBA 2AYGA 2Z5FA 4X0EA 2KM1A 3DOCA 1P6XA 4OI2A 4EPYA 2AMVA 2H4YB 4D3ZA 1UVIA 2G1HA 1MMFB 1UP1A 2ZCVA 4EEXA 3S2UA 4TTIA 2IUSA 2W2LA 2WIFA 4GICA 4RACA 5HQTA 2MLXA 4L74A 4GR4A 5FTKA 2CIMA 2I5JA 2XUOA 3DWIA 5D77A 5DK4A 2YXPX 1MR3F 2AEJA 2I2AA 3TLGB 2ZYGA 4E3WA 5MN5A 5T5QA 4BO3A 1Y1RA 2YVQA 4MYTA 3KFXA 3H75A 1C8LA 3O3LA 4HZUA 4NXMJ 1GEHA 5FDLB 3LTEA 2IXGA 4ZK7M 3ASYA 1HQ2A 4Q7EA 3CH4B 3IN5A 3QVGA 5KFMA 2CLLB 5L1KA 3NRBA 3THPA 1R6AA 5JLAA 2CNLB 1Z6GA 1E6LA 4UDXX 1JILA 1XYYA 1RHJA 3ODPA 4PZZA 5FI0B 4MDFA 3NMUF 5KSOA 3E51A 5CUQA 1RJ9B 3G0GA 4TTRA 1KWKA 1U2RA 3HULA 3D5TA 3DV0B 3BIFA 3QXXA 3EB9A 2VBCA 3ROMA 4ZVLA 3F9CA 3A1UA 1HLGA 3L4BC 1JX4A 4X6YA 1LWXA 3NFYA 4NYMQ 3OUZA 4QPZA 3DGPB 4HV4A 2YIMA 3ECCA 4MV5A 3HD2A 2XKJE 4F46A 1CFJA 2W70A 5ALUA 1OPXA 2BJ9A 3CCRS 1I33A 2Z95A 3QEMA 2CV2A 2XCTB 1X5PA 2ACYA 2HA7A 4NJEA 1EBBA 4J0QA 4OYYA 4M89A 1C4AA 3VAZA 4F2SA 3SZOA 3EAGA 3MS7A 2I0XA 4JJAA 1E20A 3L4EA 2JD0A 1YJTA 1LV8A 3CH6A 2H3EA 3QIVA 5E0OA 1KDTA 5LA6B 4J0GA 4G1QA 4Y2KA 1CSEE 3IFSA 5E3PA 4ZKAA 1FXUA 5JQGB 3RYHA 1MIOA 3ZQJA 1ONNA 3IMEA 3CW8X 4GOJA 2WM9B 2QF7A 1WV0A 2FSVA 3SJAA 3TUJC 1II0A 1NRJB 3QM1A 1SG6A 4PCQA 4YPOA 2A0KA 5AKGA 4E5UA 1YKFA 4MUGA 2FIUA 4C0HA 1TK3A 1EP4A 4O4LA 3HQ4O 2FF7A 3NV9A 2ODTX 7REQB 3WMRA 4FDLA 3T7EA 4QD3A 2P75A 4I8DA 1B4SA 3C7AA 3HSDA 4C30A 4RTSA 1B4DA 3KXLA 3HVTA 4TXSA 4NESA 2CFSA 2PJRA 3MM6B 3K6RA 3R24A 1FYVA 4ZEWA 3RYIB 3WYGA 1MENA 2PXCA 3JQBA 2HHXA 1UM8A 2QY6A 5ALYA 2XULA 3M3HA 1PJSA 4OV6A 4Y9TA 1RTHB 2OSBA 3GCGA 5MLCV 3KZ1E 4HDQB 2E7XA 4FVTA 1TQ2A 2FR8C 4DOZA 4HQOA 2P1RA 2YNFA 4J9LA 2CXHA 4NDAA 2HT6A 3K5HA 4IH9A 5G4DA 1T3HA 3U2QA 3HBFA 2XYPA 3S2YA 4BWYA 4DR4J 2DUWA 3FZQA 4CNYA 4EH1A 3RVMA 4YALA 1E2MA 1EEHA 2A78A 4NBSA 1YFJA 4YC7A 2DNGA 2OG2A 2ZIAA 4RMHA 3HU1A 3LYLA 1XN1A 3TSCA 1EK0A 1JLBA 4EA9A 3BXFA 3UT5A 4OJGA 2JJMA 2PMCA 1RCXB 1HV8A 1SQFA 2E4AA 2P9CA 1B0UA 4QPPA 4NRDA 3ZH9B 4XOUA 1PZGA 1JJAA 1ECFA 3B2QA 4QRDA 1G2PA 4EAQA 4QATA 2CDNA 4YRBA 2FFHA 4W9RA 1HKUA 4DQPA 2ZIEA 3FPGA 4BNUA 1V0JA 4ZO7A 2XTMA 5H8WA 4PO8A 4J0DA 2NVUA 4RNNA 3H0PA 4FKMA 1L8XA 2NSBA 1J70A 2HBQA 1XDBA 3AIMA 1WTCA 3G2JA 1NAHA 1IUPA 2FUNB 1W4LA 4LJ6A 3OZWA 2ZSIA 4LVNP 3LAWA 3K2EA 1T2CA 4DSIA 2RRNA 3U4CA 1TVCA 3R6LB 3AERB 3TR5A 5DDIP 1HR0B 4M1MA 3C4JA 5BMVB 4HLQB 2ZUUA 1EB0A 4P71A 3VGSA 4B6JA 4AO6A 4JGBA 3TAQA 2UZ0A 4H4DA 1VJDA 5L53A 5I9NA 5HEKA 2D2XA 3DOHA 4ZMMA 2WM8A 2LA4A 3TDMA 5G4LA 3VZQA 1MF7A 4C4PA 4P52A 2IPNA 2GZ2A 3KLEA 3H42A 4FSHA 1U63A 5JBNA 4ZZ0A 2RK3A 1RTIA 4Z4EA 3ZWNA 2O54A 1IONA 2HB6A 2VLBA 5IWAJ 1EQ2A 4LF8B 3PDNA 2VODA 1TU3A 4HH1A 1EG2A 5IJ0B 2Z43A 4KJIA 4NFYA 4L9AA 4RZSA 1RFLA 1NNUA 3W0LB 3V34A 4KO8A 1N2XA 1KYQA 4UHFA 1NM5C 4EJ6A 2GBPA 1KJJA 1CEZA 4YBRA 1HBUB 3VU9B 1SBQA 2GD2A 2GPNA 4FC6A 4V2UA 2H5LA 2Q0HA 3NYRA 3PWTA 3LWBA 3N2NA 4P4NA 5JIBA 2XNDD 2BE9B 4CDMA 4WT7A 3CGGA 2ZH3A 2WSFC 2IS4A 1YG0A 3OR1A 1L7QA 2ECOA 4KR9A 4NH0A 3D8SA 4MVCA 2Z08A 3V6DB 2WFMA 2OM6A 1V3TA 3NTUA 3TF5A 3BXPA 3F9IA 3IHKA 2R0QC 4XIFA 1ITZA 1H5QA 1OFIA 1WPQA 2DPLA 3AOEA 1C4KA 3AVXA 4FILA 1RYBA 3O3OB 5EP2A 2I80A 1J6UA 3GCWA 4GPTA 1MQAA 4Z51A 2XWPA 3OTBA 3ZWOA 3ZU2A 1E64A 3WGLA 1SKQA 4TKTA 3EFEA 4W1SA 1UTAA 2F59A 2V4ZA 4I2NA 2VZEA 2XD4A 1JHPA 3FGPA 1HFEL 1Q0ZA 5B2EA 4Q82A 4L4XA 5JAMA 2IU4A 2YQ3A 1VTKA 2NV6A 5GAHU 4KGMA 1YU6A 5ALHA 1I4EB 4LGYA 1NHUA 4G85A 4IDNA 1EZ4A 2FWAA 5HHTA 1EE1A 4DU8A 4IZIA 3FRYA 3UWTA 2GPJA 2FUG1 4R71A 1T5IA 2P6PA 3OU6A 3F3YA 4WU3A 1XTTA 3BZWA 4PNZA 2AQHA 4WAUA 3QWFA 4A5OA 4MA0A 1KQGA 3GFZA 2FMIA 1D8ZA 2QSWA 3KHRA 1NFQA 2W2NA 3HFRA 4ZHQB 1H2ZA 4YAUA 2Q8NA 5BRAA 1P2VA 2JIQA 4YMHA 1RLCL 4TV9B 2ZD1A 4YRFA 1DIHA 1HDOA 3RD5A 1YDFA 2LIVA 2QR2A 3OI7A 1U2SA 1FA9A 1IMJA 1RYDA 1QIJA 1N2HA 1QGED 3WBKA 2VAMA 3OZ7A 4KHMA 3ME5A 4JSTA 3BWBA 5HILA 5BT8A 5B2FA 1CB7A 2ILTA 5K4GA 3HRIA 2W7TA 3AIKA 6PFKA 2CLEB 4NMXB 1GA4A 2OO7A 4HN2A 4XIGS 4P3KA 2ZRIA 4ECSA 3R0JA 1DCKA 3FVWA 1ZBDA 4YCLA 1BS2A 3R9KA 3VHLB 2E44A 2BRUC 2ZM5A 2P62A 4BLOA 2WWHA 4GOOD 4R1MA 5KWSA 2GSWA 4O2AF 4D9MA 5J4HA 1KRXA 3L0OA 1W4RA 1O6FA 4QYZK 3PFEA 1OOEA 1JBEA 2IVFA 3KKLA 1EBFA 4UARA 4O3NA 4HLBA 3H0KA 4RK5A 3DYAA 1FQJA 1ZNXA 1RMTA 4KXYA 4FT4A 2E2WA 3I76A 2XMUA 2LKCA 4XZ3A 2I4MA 1N25A 4C97A 2F3JA 1ODIA 3PHBE 4PIMA 1P9RA 2GKSA 1OH8A 1EX8A 4K0KB 1MDFA 1UDRA 3B1JA 1IHPA 5E2IA 2ISSD 3U48A 3RYLA 2IDJA 1YQUA 3FZYA 3WA7A 2XWXA 1OXKB 2JC1A 1AGYA 5F52A 1DKUA 3MTEA 1UP7A 1X15A 3F1KA 2OKCA 5HZGA 2VG5B 5H70A 1YKGA 3A25A 4FGSA 5AD1A 1A5AB 2LEBA 2GO9A 2ZDGA 3DLKA 5JAOA 5CK5A 1IOWA 3TZXA 3F3SA 4TY8A 2W8KA 4UW2A 2IMOA 4UUOA 4Z2XA 4MJLA 5L6MB 3PIRA 1P0CA 3O3NB 1EU1A 2J4FA 1TKBA 3Q8RB 4JQCA 1G6BA 4E11A 3KOAA 1GFSA 3SDZA 1CUWA 1IWBB 5BWMA 4NLLA 2FOXA 1E2NA 1SVSA 4RKFA 5CIYA 4GEGA 3OWHA 4Z0TA 1KY3A 1ISGA 3R7SA 3L06A 3JTEA 1U5CA 4ZV7A 3R0XA 5ESWA 2NUUG 1F2HA 2QUKA 5DF1A 1OBOA 3U17A 1FFSB 1R6YA 2PKRA 3F6YA 3NBUA 2BKUA 2WWFA 5TQVA 2J6IA 5GP1A 2RAVA 4OFZA 4J29A 1SI9A 4TTSA 2JNWA 1C3JA 1POXA 1FRZA 4E31A 4QNMA 4XJTA 3I6PA 1XD2A 2BGNA 3BC1A 4YMTA 3BD8A 5FBQB 4C2AA 4CLDA 3IA2A 2RB4A 3FJOA 4F8EA 1N33F 4O8CA 3AUXA 4ZD6A 1X94A 2FZGB 4QOHA 4E22A 4A82A 2Y1KA 2PR2A 1Q4RA 3M8QB 1IWOA 2AJBA 3RC1A 4JT2A 1TK0A 2F1IA 2I8EA 2HWKA 2IX9A 1W48A 2BT4A 2VP0A 4X93A 1CUBA 1G8GA 1TD9A 4DV4B 3EE6A 5K09A 4DNOA 1S6YA 1LFWA 3KPYA 1YMVA 3LCCA 2GYWA 4RD1A 5DRYA 3STXA 4GKBA 5J63A 4DQUA 3LIIA 2EQAA 4OLPA 1L4MA 4UKDA 3DMTA 1DTSA 1GMWD 1FFYA 4LK2A 4RKWA 4XTRA 4OF4A 3WL6A 1JFFB 5EX0A 4NLWA 1IJFB 2V50A 1XDZA 1NNLA 1OWLA 4FSDA 1KOJA 4CCHA 4FFWA 1J5EB 1V5WA 2X8AA 1V3RA 2JVIA 4DIFA 3U49A 4DVJA 1K8QA 4HXEB 1MPTA 2K2QB 1HHQA 2UUOA 4Q4AB 1ARZA 3CZRA 4R98A 4P32A 4YP0A 1SBHA 2I6FA 1S76D 3CC2S 2CQGA 2AD1A 2NTJA 5LQKA 4R1TA 3GX1A 3J7A1 1DWOA 1YQQA 3IUBA 4OU4A 3UMVA 4QDOA 1J5EF 5HVGA 4YJ2B 1O89A 2H2AA 4M38A 2M4MA 3F3KA 3LA6A 4RKQA 3BL8A 5FJ4A 1Z37A 3DZJA 2N9UA 4FF1A 5KTTA 2A1BA 1PEDA 3TL6A 1FX4A 1U3WA 1J0XO 3QF4B 2YY7A 3CF5Q 1Q3HA 4IMRA 1Y3AA 2NQPA 1LSOA 3CLVA 5HBMB 3G9QA 4JC4A 1JLEA 4CVNA 3D28A 4TLQA 4Q3EA 2ZQZA 3OPYB 2W2OP 2ALYB 4OL0A 2QMUB 4LGVA 5BURA 2F55A 5JZMA 2ETXA 1RXWA 5F33A 1D9FA 4OMUA 3AHJA 1W88A 1NJSA 1EWTA 4PQAA 2VU5A 4Z1OA 2E5GA 2YFHA 3WXBA 2VF3A 5KKCA 3HU5A 1UXOA 4B6GA 3NS5A 2IYWA 2ZDPA 4YX9A 3MPUA 4N9WA 3IA0A 4FYDA 1M1GA 2KT5A 2FC9A 4ZVPA 1N75A 3ZX4A 1NI4B 1CRZA 4EPRA 1K8ZB 4RPJA 2GARA 3EVCA 5I5EA 1UZHA 2KJVA 1OH6A 1X9SA 2AXPA 3A13A 5FBVB 5JXIA 1E2DA 3W6OA 3V4PB 3C6TB 5CHEA 4D82A 4NCBA 4MTCA 4TTVA 3ZD7A 4OL9A 1ID8A 2NUHA 4D57A 3IHWA 1XF9A 2LTAA 1TFYA 4DJDC 4FW8A 1O57A 2ZJ2A 3FQKA 3P27A 3Q2OA 2Q7OE 4UUAA 2QRQA 3PSAA 2XBMA 2C4VA 3TLKA 4RYLA 3AOAA 4TYMA 4RTQA 2QT1A 3MWGA 2OLJA 4PC6A 5JDCA 5CH7B 4EYQA 3E84A 4KRWA 3QVMA 2CY0A 3PFOA 1BWPA 2OCDA 4OYLA 2PD1A 1JQ5A 3IHLA 2DJ5A 1ZISA 1GITA 4J1TC 4KYVA 1UMBA 2GZRA 4NZOA 3KRTA 4KR6A 1UEJA 4ABYA 1DT5A 2HYIB 4UE6A 3HVJA 3IQHX 3SSMA 2X41A 3T0FA 1ETHA 4OAPA 4Q9LA 4B3TF 3H3FA 5ITSA 3FD8A 4HS9A 2ZFUA 4HN9A 4YCJA 1GQQA 3ZCPA 4TL7A 2CGEA 4JL8A 1JEYA 2PX5A 1OLUB 2BF4A 3Q8WA 3NTOA 4HDKB 4Y6OA 3GFVA 3C3WA 4Y9RA 4PNPA 1ECLA 1RQLA 1PBUA 3Q8PB 4IILA 2KDOA 3DM5A 4IH5A 4KQXA 1H0RA 4N5LA 4RR5A 3JYOA 3CX6A 3FDIA 1DWPA 4B5LA 1EWRA 3N75A 4LIWA 1URRA 4J94A 2WJVA 3G8CA 1J0AA 5EJFA 3COWA 1KDVA 3TTYA 4E2ZA 3B1VA 2DBYA 1IXSB 3T99A 3R6DA 2WQ7A 2CFRA 1K2VN 3TA1A 1X8LA 4DV0F 1JIUA 4GX2A 3DXFA 2C1EA 3W1WA 3OURA 1U8ZA 4A6DA 4JUCA 1V25A 4GXTA 4HAZA 5E3CA 4RVNA 3PQCA 1GEEA 3Q0TA 3PFGA 3TAUA 4A6PA 2CFOA 4DA4A 1FKPB 2XY6A 5C8DA 3ZWBA 4Y98A 1KVJA 3QEOA 5IC6B 5IS2A 4GXRA 5G53C 2FPGA 4IS3A 5BNFA 2XB8A 4AYTA 4BVLA 4C7QA 3A6KA 1DTQA 2ZPAA 1RWBA 4BWMA 4LR7A 1LDNA 1NDKA 5AVUA 3VC1A 4N8OA 5DP2A 4K0KF 3DF7A 1KS2A 4DDUA 4OV1A 5C9ZA 5AW6A 4BX8A 4CT5A 2PBZA 4LX8A 4YMEA 1AFIA 3WGOA 4CRJA 3CC7S 4PEVA 3AF0A 2DLNA 1SC4B 3BH6B 1DC7A 3LRPA 5BR1A 3B9RA 4FEGA 3P52A 5GADl 5KFIA 3V1NA 3WJ2A 2YMQA 3NWBA 1M7BA 4G9BA 2N1BA 2XZOA 5C8ZA 2EFOA 4I69A 3N74A 1P61B 5K0TA 2BM9A 2BH9A 3JXEA 1APBA 1RT3B 1VKJA 2QJTA 4HTFA 4RIHA 4BAZA 4WFZA 5EWJB 4TGLA 4UE2A 4N3BA 4CTKA 3IPCA 2MHNA 1WI6A 3DDIA 3I2IA 4CEHA 1R8CA 1VQ8S 1D2NA 2WZCA 3W4KA 4YRQA 3N8HA 1QTRA 3PWKA 3OLQA 1IKYA 1P2GA 3LGMA 1E2KA 3WE7A 1NUEA 1GCIA 3VM6A 3NORA 1E2IA 3DI6B 3QZ8A 4JITA 3QEBZ 4LYDA 4Y0AA 2FRDC 3AB4B 1NHKL 3TSYA 1GPYA 2DGQA 1KAMA 5TQ0A 1VKZA 3MWLA 2YNIB 3OKFA 1IKXB 4N54A 3AETA 4DYDA 4OHZA 4W9MC 5LZ4A 4FPRA 2J4DA 2YY6A 4AYWA 3FGOA 3T1YB 4YDRA 3H5LA 3KTAA 1DAGA 1RYYA 1WOSA 3ONEA 4WU2A 2HMTA 1N78A 3L7MA 5EMJA 3MPYA 5LM7E 1O0PA 2Q6BA 2KI2A 5D0HA 1ZJ6A 3B54A 1KEUA 1RT1A 2E4UA 1TVMA 1N57A 1DXOA 4RJKA 3T0IA 4G5XA 1WF1A 1V4VA 2OXFA 3FPSA 3I2JA 1JJBA 4XPEA 4HACB 5KPJA 3TVYA 4ILLA 5EE9A 1G21E 2C0QA 2CJKA 2A1UB 1W1UA 2HRBA 2ZE5A 2ROQA 4ZTUB 1Y3JA 4H7EA 2CKMA 4Q2MA 3SZUA 5JMWA 4B33A 3CJ4A 4WBXC 2HLDA 3PP8A 4MPPA 3CGIA 1LVUA 5E4JA 2OXTA 4I4CA 3NBPB 2OD2A 4PYLA 1XZDA 2XADA 3T41A 1CQPA 1C1XA 4PTLA 9ATCA 4DR2B 3K8QA 3P2MA 2W8BB 2BELA 1BNCA 3AO0B 2OPSA 4P7JA 3NTVA 4LECA 3KJIA 3RKSA 5IXYA 2B6HA 4WFNQ 1E8MA 2Q4BA 1XL1A 4C14A 1FRHA 3KYIB 1VKNA 3BK1A 1NHWA 3EZLA 2C95A 1ONPA 2A9VA 4BKPA 4HR2A 2IC5A 5LMNB 1SB6A 1E0AA 4IDOA 3PLAE 1TTHA 1Q0QA 3E18A 4G1EB 3BH7A 3ZHSA 2XD9A 1S0NA 3OE5A 1LKZA 3L3CA 5DX1A 2AFHE 3PZPA 2YH2A 4OSOA 2M6RA 1UOPA 1KN6A 2BJVA 3D1JA 3HL0A 2JK0A 3EF3A 3KJFA 3R74A 5BSRA 5EJ6A 1VLJA 4K28A 6Q21A 1KRPA 3NCTA 4NE2A 2V69A 1U2CA 3AQOA 1RYFA 2J8ZA 3Q98A 4WBNA 5ECYA 5AXDA 5CD4H 4W5NA 1SHUX 4KI7A 1KK0A 1FQWA 1DPFA 2BPOA 3FFTA 2P90A 1OH7A 3Q88A 1PU2A 4TVOA 4P1ZA 1XQ6A 3EZGA 1D2CA 4L78A 3FI9A 3IO5A 2P6OA 4TLLB 3QWAA 3I5AA 3L7AA 4JI4J 2P5VA 5AE1A 4YEDA 3WDMA 3L09A 3V2UC 2FQYA 5KFZA 4TQRA 3SHFA 4LBYA 4EVSA 4B3IA 1G9TA 2JZNA 1W87A 3IWLA 4ZVRB 2WQZA 2J0UA 4AP9A 5KQRA 5CX4A 4K0KJ 1XA3A 1F9FA 3K89A 1RTJA 1L1RA 4RELA 3A6HA 3UANA 2P4UA 2PGAA 4X4VA 1TRHA 4B2IA 1VM6A 3NLCA 2RILA 2BFDB 5CM9C 2BONA 3LH5A 2RRAA 3SN6A 4PQGA 3OVAA 2P5SA 3LY5A 2JEZA 1P31A 1V7QA 1SXJB 5FWAA 2BE2A 5J4KA 4R2XA 2OGTA 2VH5R 4IDFA 2HNDA 1JQAA 2FDRA 4DLEA 3U19A 4J9KA 4I55F 2X9GA 1RAGB 1V95A 3D0QA 4X4NA 2OXRA 3M32A 4BEBA 1FDRA 1RBOB 4EIWA 2HIYA 5EHGA 1CZNA 2HAEA 3OWOA 2GNPA 1V1RB 1RKQA 3ZHRA 3K6SB 2PYIA 1SZCA 4RQTA 1C8VB 3PNBA 2OBLA 1HNWB 1JI3A 1UBUS 3QHQA 2AJDA 2V98A 4YRMA 4P2XA 1F8YA 1TJPB 1NVVR 2PMEA 4FNMA 3IOEA 4M98A 5F7JA 3ZGYA 4BWVA 3BVPA 3ILVA 4BGEA 4MWBA 3I6QA 1EWKA 2A86A 4L5JA 1O0CA 4EGJA 2UXBB 1BEEA 2WF5A 1QE3A 2AW3A 4CCSA 4D8XA 2ROEA 2C2NA 3RGGA 5AI0A 2OG1A 3FKSD 3NLLA 5FWXB 3AZQA 4IXDA 3LQQA 1KBZA 1KC8T 4QXRA 1TZ0A 2PUEA 3LL4A 1RAEB 2GA9A 2VXYA 3AF4A 4FFBB 3D3KA 4DL4A 3MBKA 1QFSA 4AWXA 1BWEA 2HMYB 2WB1D 2HFZA 1N5QA 1RXVA 4GSLA 1KMCA 4CDGA 2QMYA 5JW6A 2OAP1 4CM7A 4NMMA 1RAJA 3SE0A 1GZSA 2JLSA 4JI6B 3IOMA 5BPHA 3BBPA 5F98A 3LLVA 3A4YA 1FPQA 2FQ1A 4JAVC 3H1TA 3GJTA 4CM9A 3W9YA 4E14A 2YNHB 3ICLA 3C0KA 3AR7A 1XVLA 4ZLJA 2GPBA 3RK0A 4BLGA 3G8DA 3VKUA 5CXXA 3DU5A 2OSVA 1URNA 2VJDA 3P2IA 5CDSA 7MDHA 2EKQA 3D6MA 1HOXA 3DRRB 1CJVA 4JQYA 3C3BA 2GK6A 3NGSA 4RVUA 3KYDA 5IULC 4L3WA 4BB6A 4RU9A 1Z5GA 1H9CA 1A9TA 4BN0A 3G2LA 3A6PC 1X1BA 2ZDHA 4YAJA 1IKVB 3D8HA 3CEPB 4KSCA 1Y9AA 1EDBA 2C20A 1VQ7S 1XTQA 3JALA 3GJ5A 4J9UE 2QVYX 4JLSA 3K70B 1FE4A 5LB2A 4ZT7A 2PAAA 4RIEA 1N0IA 4KPCA 3ZE0B 2R44A 3KAQA 4GMDA 2V4UA 2LVWA 2H00A 1VHFA 4HDRA 2I3GA 2OZLA 5AXKA 1PJZA 1ND6A 4NA1A 5ICSA 5KYUA 5FFNA 3H25A 4LDRA 4LHYA 3PQ2A 2YH1A 1L4EA 4IIJB 1SQEA 4NZNA 1I1QB 4NWIA 1LS6A 5AVSA 3G8QA 4B83A 4H6WA 5F3WB 2HEKA 1JLGA 2AMJA 4AE5A 3BE6A 5LWHA 1AIPA 4MZDA 1XMOB 2DBQA 2WVJA 3EW7A 3ABZA 2RK4A 2O05A 5FPHA 4I2QB 4R0MA 1Z7WA 3E8OA 5KWIA 1FCJA 2HRQA 1O08A 5IZ4A 3OZVA 3IQDB 1QGUA 3TCKA 3E22A 3L7UA 3HKCA 3ECAA 1OIXA 1FLNA 1FFAA 3QBDA 2AC2A 5SUHA 1R8AA 2E29A 3W4IA 4B48A 5ADZA 4IJ5A 1RRFA 3HU3A 1A5BB 4DJJA 3M9OB 2VB6A 3B13B 1II8A 1YR2A 1WA5A 1AQLA 1TRKA 2NAFA 3C6QA 4YAEA 2J5BA 1YJAA 5K8PA 2CXOA 4GM4A 5K3OA 3KVVA 5C46F 3NVAA 4JWTA 2LU2A 1B0AA 5KU1A 4AUNA 3CCQS 1HNVA 5ARDA 4Y30A 1ZJWA 1DU4A 4M5NA 2F7VA 4KMOA 1WUIS 3EIUA 2HWYA 3VV2A 1TUGA 2VT3A 4MHOA 3W60A 5A9TA 4ZANA 1ST3A 4YXFA 2AIRB 3LVFO 5B1SA 1F2VA 5JJKA 2AJCA 5DM6Q 1JRLA 3NWEA 3OFVA 2ZU0C 1VC6A 1U3TA 2YKGA 1U1LA 3VR4A 3DFKA 4DS5A 2WZDA 1QKKA 3FMPB 2HA4A 3DV0A 1Y7IA 3KWFA 4EJFA 3C43A 3ZIAA 4NABA 1IOZA 2VWPA 1V3SA 4CLUA 4AY2A 5LOVB 2OV3A 4IICA 3B60A 3F41A 1G55A 1FNDA 3B9PA 4P73A 2JLEA 4ZO8A 4B34A 4ZJQA 1TT5A 1N8RT 1EVYA 3UV3A 5IBCA 2X0JA 1S72S 1Z0DA 1M6WA 2IP2A 2VV5A 1E9RA 3AR4A 4QPNA 5K3SA 2VSYA 2VT2A 3JQ6A 1ODSA 1QVRA 2B7LA 1GMWA 1XJ0A 2KHCA 1TMYA 1FWPA 1JPUA 1E1RD 1YLXA 3E48A 3PI7A 4HRYA 4YHHF 4XWOA 3LSTA 1YITS 1EGAA 3HFKA 3DSRA 4TXJA 5C37A 1G59A 1E2EA 4M1YA 4GGPA 1JZTA 3FCHA 1SOWA 2BP7A 3JQDA 5B3JC 5FOWA 4L02A 1FXRA 5IJXA 3ZNOA 3B78A 3HP1A 2WOJA 1S77D 1QHSA 3HLKA 3NAGA 4CIBA 3DEYX 3ZY4A 5IN4A 4Q93A 1U0HB 2RHJA 1JZSA 1BHQ1 1NF8A 4PVCA 5FQNA 1WHSB 3H2KA 3WGJA 1L5NA 1AS0A 1JDBC 2GIQA 1N7GA 1TIBA 4F02A 4JT8A 3PW5A 4O4LB 3T1HB 2QYSA 3U7HB 3AHDA 2YS6A 4GWGA 2QY9A 3ADKA 1HTWA 1EETA 2FJPA 2KHZA 4BO5A 1P4JA 5JAUA 3AL0C 4OIMA 1L4KA 5GMKa 1NW8A 4MAKA 2ES4A 2H5JA 2FWMX 2C5GA 3ZX5A 4ML3A 5GVSA 3JQJA 2GILA 2XT6A 3SZMA 4BNHA 3I5MA 4EI2A 2KTQA 3VVUA 3A6FA 4UZBA 2DGTA 4R84A 2NV0A 3MTJA 4BVKA 2EG1A 4CWBA 2C99A 4HDMA 1OAKA 1LK0A 2DTEA 1RM3A 4IJUA 4A9AA 2J31A 3VBCA 3UOAB 3NHFA 4E12A 1GAOA 1R16A 5B1DA 2BRKA 2E21A 2JIBA 2WT9A 4RQAA 4IR1A 4DOMA 2PT6A 4CLWA 2GJ8A 1QQAA 3W5IA 1SVDA 2R8GA 2R2SA 3H9UA 3UGQA 2DNRA 4JUZA 4JJ6A 3AY7A 3SR3A 1YJXA 2EFNA 1T0BA 2PAFA 4AZSA 4GVBB 2JI6A 3OQ1A 4A10A 2EWWA 3JD0A 4NXMF 1FDDA 5BQ3A 3OZIA 3Q2IA 1EFTA 2ZRGA 4LUCA 3EA4A 3TRFA 3INTA 1XQXA 3VGPA 4KRGA 4LJRA 5B7WA 4YT4A 2IV2X 2WVBA 3TPCA 4OFBA 4BRWA 1AK2A 3HUTA 2CNLA 4DB2A 4I7FA 4MR9A 1WMBA 1YIDA 1ZBQA 2OWDA 2V3VA 1PJQA 5DGTA 5AOCA 4AQYF 3NJRA 2KVQE 3LT0A 4M76B 2R3VA 4KTTE 2DNMA 5TT0A 3AKCA 4HFMA 2G3YA 2W22A 2Z5GA 3TGWA 4QYXA 3OF3A 4WOPA 3ABRB 2OPQB 2ZSFA 1YAJA 1GPKA 3T9NA 2AE1A 1QVWA 3JS9A 5DHRA 1XN4A 4L50A 3BWXA 4JWKA 1SCBA 5L39A 4DR5F 4K6OA 3KMQA 5BNIA