4AUKA

Crystal structure of c2498 2'-o-ribose methyltransferase rlmm from escherichia coli
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
357
structure length
355
Chain Sequence
MNKVVLLCRPGFEKECAAEITDKAGQREIFGFARVKENAGYVIYECYQPDDGDKLIRELPFSSLIFARQWFVVGELLQHLPPEDRITPIVGMLQGVVEKGGELRVEVADTNESKELLKFCRKFTVPLRAALRDAGVLANYETPKRPVVHVFFIAPGCYTGYSYSNNNSPFYMGIPRLKFPADAPSRSTLKLEEAFHVFIPADEWDERLANGMWAVDLGAPGGWTYQLVKRNMWVYSVDNGPMAQSLMDTGQVTWLREDGFKFRPTRSNISWMVCDMVEKPAKVAALMAQWLVNGWCRETIFNLKLPMKKRYEEVSHNLAYIQAQLDEHGINAQIQARQLYHDREEVTVHVRRIWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Rlmm, the 2'O-Ribose Methyltransferase for C2498 of Escherichia Coli 23S Rrna.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords RIBOSOMAL RNA LARGE SUBUNIT METHYLTRANSFERASE M
total genus 118
structure length 355
sequence length 357
chains with identical sequence B
ec nomenclature ec 2.1.1.186: 23S rRNA (cytidine(2498)-2'-O)-methyltransferase.
pdb deposition date 2012-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01728 FtsJ FtsJ-like methyltransferase
A PF18125 RlmM_FDX RlmM ferredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2810 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4aukA01
3.30.2300.20 Alpha Beta 2-Layer Sandwich THUMP fold THUMP fold 4aukA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4aukA03
1R6AA 3P9IA 4C05A 2PX5A 1RJEA 3CC8A 2UYOA 4YV0A 3FTFA 5DXAA 3E7PA 2P3OA 5DM0A 3PFGA 4X60A 4E70A 2O05A 1M0EA 4RTJA 3CGGA 4ER5A 4DKJA 5CVEA 2PVCA 3IYLW 4FP9A 2ZZNA 3NVKI 4HGZA 1KPGA 2AOUB 2ZULA 3VC1A 4PYNA 2P1DA 1WXWA 4DA4A 2HR1A 2EJUA 1YFLA 3BWMA 2Z6QA 2ONZA 2FPOA 4RYLA 4KIGA 3KHKA 5CVDA 3EVEA 4C04A 3DXZA 3G8AA 3KR1A 2WA2A 1NBHA 4K6MA 3HP7A 2PKWA 3AXTA 4RTQA 3ELYA 4U7TB 4E31A 3GIWA 4ATNA 3G2MA 3M70A 3UA3A 4IKPA 2AOXA 4LWPA 2FK8A 3EGEA 5E2BA 2ZWVA 4OA8A 5E8JA 4PNEA 3GXOA 2ZWAA 4P7GA 2GAFA 4RTMA 3KR0A 4QQNA 4HSGA 4YMGA 4IV0A 4DM3A 5FQOA 5CCBA 3B3JA 5MHTA 5DM1A 3KU1A 1FPQA 3LBYA 1AQIA 4RVHA 3EVCA 4Y30A 2ZW9A 4X41A 2ZBRA 1WY7A 3UJ6A 4DF3A 2OPBA 3HCFA 3I9FA 3LX6A 2IBSA 5LQNA 3A7EA 4LG1A 4HTFB 2WA1A 3UJAA 5KS2A 3HCAA 3FRIA 1G6Q1 1DUSA 2AOTB 4GOLD 1EJ0A 2PX8A 4R6XA 3RW9A 3PTAA 1YFJA 1O54A 3DLCA 3UJDA 5JR3A 4F84A 5E9QA 4U7PB 4JXJA 5FWAA 5KYGA 2Z6AA 3TFWA 3IHTA 3ELDA 3FYCA 3A27A 2PX2A 1ZKDA 3G2QA 5EZQA 3TMAA 5F2OA 2B9EA 3M4XA 3GRYA 1JTEA 1XDZA 2A14A 3BWYA 3FUWA 3AWIA 2AR0A 1PRYA 1T43A 3FPEA 3KQYA 2GB4A 5CVJA 1RI2A 3BGVA 5DSTA 2NXJA 5EG5A 3R9XB 4RTKA 4UOEA 1INLA 3SVZA 3UFBA 4RTLA 1NV8A 5M5BA 3F4KA 1EAMA 5DTMA 4FT2A 2P41A 3HA3A 1VP3A 3C6KA 5K09A 3CBGA 5EKUA 3DMFA 4AUKA 2B25A 3EGVA 1D2GA 3V8VA 3ELUA 2ADMA 3MQ2A 4RV9A 3OZSA 1HMYA 2UYHA 2JHCA 2QY6A 3C6MA 3EVZA 3HNRA 5LQCA 4YUVA 4EKGA 4RTRA 1TPYA 1R8YA 4IWNA 4GQBA 2G70A 2IDKA 5K03A 1DCTA 2G1PA 5DWQA 2NXNA 2OKCA 2ZTHA 5BW4A 3P97A 3FUUA 4R6WA 5DPMA 2OYRA 3ER9A 3NW9A 1NBIA 3P71T 2UZ4A 5DSXA 2V7EA 5LSAA 3M6XA 1JG1A 2C7OA 3GRUA 5FWDA 2HV9A 2GPYA 2OY0A 5FULA 1KR5A 1L3IA 3E23A 3OU2A 4RSRA 4EMSA 3LBFA 5HEKA 5HIIA 5ICEA 5FCDA 1MHTA 2V74B 3UJ9A 3MAGA 3TM4A 5D1NA 5DX8A 1BOOA 4R05A 2I62A 4C06A 1OR8A 1L3BA 5GWXA 4Z2YA 3T7TA 3EVGA 1ZG3A 3HCDA 3HVHA 3THSA 5T6BA 3LCCA 2E5WA 4C4AA 3NTVA 5LQUA 2R3SA 1WG8A 3I64A 2HTEA 3K0BA 3KPWA 4BP1A 1N7IA 1P1BA 1RJGA 5IKMA 1KHHA 1ORIA 5FTWA 2WK1A 2G8NA 3MTIA 4E32A 3CVOA 4P58A 2VP3A 2NXEA 3I5UA 3EEOA 3NDJA 3NWEA 4OQEA 3HEMA 1JSZA 5E9JA 2IH5A 5LQRA 1NW6A 2QRVA 2PXXA 3P2EA 3BT7A 1KPIA 2B78A 3QOWA 3HVKA 2BM8A 4PYLA 1G8SA 4BLVA 2BH2A 2P7IA 4HGYA 4EQZA 1RI4A 2FK7A 3KPJA 4KW7A 1N2XA 1KP9A 1QZZA 1XVAA 2PXCA 1SUIA 5EMJA 1DL5A 4AX8A 4A6DA 1G38A 2ZBPA 4GC5A 2PXAA 1L1EA 2CKDA 2GLUA 2ZVJA 2OB2A 3BUSA 3IEIA 3A25A 1G55A 1WXXA 2AVDA 1XCJA 5JUWA 2C7RA 4DQ0A 5FQNA 3SGLA 3LDUA 5E8RA 2ORED 3TM5A 4P7FA 2YTZA 5CVUA 1VP9A 1MJFA 1ZHFA 3CJRA 3UJ8A 3KQVA 1V39A 3KQQA 3BXOA 3GRVA 3OPNA 4KDCA 2PWPA 2YXEA 1R8XA 4KRGA 3SXJA 5K0FA 2N47A 3LPMA 1VE3A 1I1NA 3M33A 3WSTA 2CWWA 2PJDA 2IGTA 2Y1WA 4CKEA 4RTPA 3NVMB 3HVIA 1TW2A 3KQSA 5EEHA 3MCTA 4GBED 5GIPE 5EGSA 3OU6A 4YMHA 2VZ9A 2ZCJA 2H11A 4EVIA 2YVLA 3EVBA 1O9GA 3IV6A 3SX0A 2ZFUA 3TOSA 4R8RA 3PVCA 3TR6A 2Y1XA 3TPZA 5EC8A 4X63A 5HILA 5F2NA 3KR9A 3DMHA 2Q41A 3HA7A 3ME5A 3OFKA 4DCMA 5EHGA 4YUYA 5K0JA 1YZ3A 2ZBQA 3NDIA 3X0DA 4QQKA 2JH8A 1R00A 1X19A 2CMHA 3E05A 1VPTA 3FPHA 3TKAA 3M6WA 2BR5A 3LDFA 2IH4A 3JWGA 3FPGA 5GOZA 3DULA 1X1BA 3OZTA 5LQKA 3CJQA 3GCZA 3EVFA 5K0CA 10MHA 4MHTA 3Q87B 5U4XA 2YQZA 5ERGB 4GOMD 3P8ZA 1EJ6A 3JWHA 2QE6A 2PV0A 1EQAA 2P3QA 2PLWA 1WZNA 3CJTA 3FYDA 3ERCA 4DMGA 2P7HA 2AN3A 3EPPA 4XCXA 2I9KA 2Z6UA 4C07A 1NW3A 1AV6A 4PGGA 5CM2Z 3HCCA 1KXZA 2NXCA 5EQJB 1SUSA 2XBMA 3O7WA 3PFHA 1WS6A 2AN4A 5HFJA 2IFTA 4V0QA 2C7QA 1I9GA 3GRRA 5FA8A 4EK9A 5K05A 3OE4A 4AZWA 5BP7A 2ZSUA 3LCVB 4CTKA 4PCLA 4X1OA 2ZZKA 1UIRA 4FR0A 4GOND 3TRKA 2H00A 4YUXA 3LKZA 3VYWA 2QYOA 2FHPA 3M6UA 4RTNA 2H1RA 1X1CA 4QPNA 1JQ3A 1SQGA 1G8AA 2GH1A 1NT2A 3FUXA 1YUBA 2AVNA 4QVGA 1BKYA 4CWAA 3EVAA 5CCXA 2P40A 5E1MA 3HCBA 4EKIA 1JQDA 2KW5A 1ORHA 4GEKA 4ISCA 4E30A 4YUWA 4PYIA 2YR0A 2CMGA 3B3FA 3QOXA 4HH4A 4HG2A 4FSXA 3U81A 4MQ4A 1FJXA 4MWZA 2XYVA 1XXLA 2BR3A 1KYWA 3D2LA 3KQTA 4RWZA 2JHPA 4FT4A 5EEGA 4CTJA 4RVFA 3OCJA 1FP1D 4PWYA 3OZRA 3ORHA 5C1IA 5EMLA 3TQSA 4PYJA 5T64A 5HZMA 2ERCA 3LHDA 4ER7A 1SG9A 2YUIA 3I58A 2IDJA 4M7RA 4C03A 2OZVA 1M6EX 4BLWA 3UZUA 3UJ7A 3EEYA 2P35A 5C0OE 1NW8A 5DLYA 2PWYA 3NMUF 3G2OA 5CD1A 4PONA 1QYRA 1U2ZA 1XCLA 2PGXA 2VDWA 5GP1A 2EX4A 1JTFA 2ZIGA 3P9CA 3UJBA 4CKCA 5HIKA 3OU7A 3LGAA 4ER3A 2QRVB 2HNKA 5C9ZA 2JG3A 3PT9A 3KKZA 2PY6A 3A26A 4OA5A 4RX1A 2OBFA 3DUWA 3BKWA 3JWJA 1QAQA 5HIJA 5LR6A 5GIOE 4M38A 3SR4A 4E33A 4YV1A 2AOWA 4E2WA 2VDUE 3S68A 3UBTA 5FUBA 4H0NA 2EJTA 3NWBA 2XYRA 5HIMA 4CXMA 4NECA 3GNLA 2FCAA 7MHTA 3FPJA 4MTLA 4M37A 5E2AA 3HCEA 5GM1A 4V0RA 3C3YA 4P7JA 4E2ZA 3C0KA 3V97A 2C7PA 2NYUA 3LSTA 1VL5A 4A6EA 1KIAA 4F85A 3FTEA 3G89A 3G7UA 5K0EA 4HTFA 4LECA 3BKXA 5D1HA 3R24A 5K0BA 3DXYA 5B1SA 2JH9A 3T0IA 1BHJA 3EVDA 5DX1A 3DXXA 4KIFA 3BWBA 1IXKA 4MIKA 3SSNA 5BW5A 1RJFA 1ZQ9A 3OE5A 2AOVA 5GM2A 3KQWA 5DX0A 1SQFA 1VLMA 4FSDA 1F3LA 2XYQA 5FHQA 4YUZA 4XUDA 4PCAA 4DZRA 1JSXA 3O31A 4XUEA 1KYZA 3VC2A 5EPEA 5EOVA 3TLJA 3BGIA 2G71A 1NW5A 1EIZA 4WXHA 4POOA 5K01A 1R74A 5K8VA 1QAMA 5EMMA 4M36A 1M6YA 5LQAA 3JWIA 3PS9A 4X61A 1NW7A 1VQ1A 1HNNA 1BC5A 2O06A 5E1DA 1D2HA 4F86A 1ZGJA 3P2KA 1JQEA 3T7SA 3MCZA 5CVVA 4GC9A 4DCGA 3CCFA 4PINA 5LQJA 4BLUA 4ZTBA 3MERA 4E2YA 2AOUA 3ID6C 4R8SA 4OBXA 5BXYA 3LCUA 1YZHA 4RTSA 3SM3A 1L3CA 3P9NA 1R18A 2F8LA 4PIMA 4BP3A 4IV8A 5E9WA 1XDSA 2OB1A 4C08A 2IBTA 1QAOA 1P1CA 3PX3A 5FHRA 2VS1A 1N7JA 3KPUA 5K0NA 3MHTA 3FUVA 3UJCA 4BY9E 2NP7A 3A4TA 2EG5A 3FTDA 1D2CA 2BR4A 2ONYA 4O29A 4QTUB 4E2XA 4ER0A 3BGDA 2PSSA 5CIYA 2QM3A 4AZTA 1XJ5A 2PT6A 4FGZA 2IP2A 4PYKA 2ZZMA 3G2PA 3R6TA 4GF5A 2K4MA 3MB5A 5DXJA 3GWZA 4G56A 5K0LA 3KQMA 1FP2A 3DR5A 2YX1A 3FZGA 1YB2A 3GJYA 1L9KA 2DULA 2JHAA 2UYCA 2BZGA 3ANXA 1B42A 2P8JA 4KDRA 5DTQA 3DP7A 3FRHA 1X1DA 5K0GA 1VIDA 2DPMA 3LECA 1SKMA 3GRZA 2AN5A 3RIEA 3ELWA 2HMYB 5EZSA 3KR2A 2PT9A 4Y2HA 4P7KA 3NJRA 2EFJA 4YV2A 2OO3A 1O9HA 4QTTB 3AXSA 4GUAA 5DM4A 5EMKA 1JR4A 3GO4A 1AF7A 5EVJA 2IPXA 3BZBA 3H2BA 5G02A 3KQOA 5FA5A 4KWCA 4QDJA 4RVGA 1XDUA 1EG2A 1NV9A 2I7CA 3R0QA 3TKYA 5KVAA 5DTRA 5H02A 3DLIA 3I53A 1RJDA 5DT2A 3HVJA 4B17A 1NKVA 2GA9A 3G88A 5HOQA 2GS9A 3GU3A 4PYQA 9MHTA 4FZVA 3MGGA 3AJDA 2OXTA 3SSMA 3G8BA 2XVMA 5E1OA 1P91A 3Q7EA 5EIWA 3KPYA 2HWKA 1UWVA 1ZGAA 2B3TA 3K6RA 5DM2A 3KQPA 5DRTA 2LD4A 3B5IA 3C3PA 3M6VA 2I6GA 3G5LA 1JG3A 1RI5A 1I4WA 1IY9A 3P9KA 2O57A 1UFKA 2ZIFA 3PX2A 2NP6A 3ER8A 1JG2A 2UYQA 3B3GA 4RTOA 2CL5A 1QANA 3DMGA 3QV2A 1AQJA 3KPVA 3DTNA 1TW3A 4HRAA 3P2IA 3VSEA 2IH2A 2AZTA 1VBFA 1PJZA 2O0LA 3EMBA 3DH0A 2ZIEA 1FBNA 5FADA 3UA4A 1IM8A 4CKBA 4GOOD 3FTCA 1SVUA 3EMDA 3THRA 3HM2A 5CUQA 1Q0TA 1Y8CA 4OQDA 1Z3CA 5EHIA 2JJQA 4KVZA 4QDKA 5ICGA 5KQRA 2ZLBA 2FYTA 3AY0A 4L7VA 3OFJA 3E8SA 4HC4A 4PYOA 2AOTA 3HA5A 3SSOA 4AZSA 3MTEA 5E1BA 2R6ZA 3T7RA 5ICCA 4OX9Y 2YXDA 2ESRA 2IIPA 2BM9A 4ER6A 1Q0SA 2PBFA 3B89A 4WVLA 5EIFA 3O4FA 4PYMA 5F2KA 3EGIA 5T67A 1F38A 4FS8A 5KQSA 2XVAA 1KPHA 5P8WA 2G72A 5DRYA 1G60A 1P39A 1X1AA 3REOA 4QPPA 3SMQA 3PLAE 2O07A 4LWOA 3RODA 3GDHA 3CKKA 3G5TA 1RI1A 4AZVA 1XTPA 3LL7A 4RVDA 5EKXA 3HTXA 4PGHA 5IH3A 3UWPA 3BWCA 3B7PA 2NNWB 3FPFA 2VDVE 3FUTA 1RI3A 3GGDA 1JG4A 1NE2A 3A7DA 4QVKA 3L8DA 5GINE 3DOUA 8MHTA 4XUCA 2FRXA 3LDGA 1H1DA 2P3LA 3R3HA 4OBWA 5ICFA 1YF3A 2B2CA 3LKDA 4PIPA 3PB3A 2PX4A 2AS0A 2YXLA
chains in the Genus database with same CATH superfamily
3KV3O 5TQ0A 3BSAA 1NM5C 5E6SB 4E70A 1E92A 2MQNA 2ZWPA 5U9CA 4O1IA 5IOLA 3EY4A 2WJZB 2G9RA 4CH1A 4YCAA 1DI0A 2H57A 4R98A 2AG6A 4JI6B 2UUCF 3H13A 4D98A 4DV7B 3OECA 4WMLA 2ZJ2A 3EMTA 1RHJB 1NXWA 2Q5LA 3QQPA 3A9CA 4G63A 3QG1A 3UJAA 4L5JA 2HWYA 3NGDA 2UYYA 2DBVO 2JK1A 2QIPA 4H6VA 5E3JA 3ELDA 3ZD6A 4WX2B 1CULB 3QHAA 4JQSA 2J3KA 4CCAA 2DBQA 4DPKA 1W2BR 3GQCA 3MR6A 2C4UA 2NGRA 1REQB 2JC3A 4RPKA 3RJMA 4C7JA 2RBKA 4Q3DA 3LHKA 5DSXA 3F44A 2NQ8A 2VK4A 2FEAA 2AW0A 3QEAZ 5KNDA 4ESEA 1F2HA 5EZYF 4U7FA 4QJBA 4OGLA 1RADA 3T5KA 4G9BA 2H2HA 3BB4A 4EO6A 1ZINA 3DFIA 2YXPX 3FNBA 3PC2A 2F3SA 4DV6J 3I4HX 3CPWR 4CLPA 1IM6A 3SYLA 2ODNA 3WMFA 2PTHA 1RT3A 1AXGA 1VLHA 2XZTB 1P7PA 5JIBA 1WSWA 2DZDA 3UXEA 5J2PA 4DDHA 2QFIA 1N5JA 1T9VA 3OZDA 2C7RA 2AYXA 5LUBA 2V5AA 1TFYA 2GHQA 5LXRA 2MEWA 2IPOB 4CYUB 1UKAA 1NK8A 3THXA 5KPJA 2LUOA 3BFVA 4CDNA 1ZGCA 2LWIA 1OLXA 5F9MA 3OFKA 2PL1A 1GKKA 3C5EA 4IG9A 1JAYA 3IAXA 1VLYA 1H65A 2I6SA 4PABA 2X2FA 2GF0A 3L7NA 2M6RA 2Y1RI 1LQ9A 1PIEA 2OV3A 4W9RA 2GCPA 1G4UR 5AKGA 2Y8YA 1E3SA 1NY6A 1RPJA 1JU9A 3M6UA 1R0AB 1FP4A 2OPSA 1JQ3A 3G0IA 3RU9A 4D9JA 3EHDA 1UQUA 4ELVA 4GOXA 2D41A 5IQQA 1TA4A 1KK3A 1ZH0A 3H2ZA 2X3DA 3GQBA 1VQ5S 3RLIA 3BRWA 5ALWA 3NUZA 4BO7A 3DMNA 3R5GA 1XCLA 4DL6A 2HVDA 2HWUA 3I34X 2H9IA 1PEKE 2WINI 1NFRA 3A26A 1JA0A 4M0FA 5KOHB 3E7DA 4DWOA 1EWQA 3EUFA 2NYUA 4A6EA 2AFRA 2YWRA 3EXYA 4LF8F 4JI2B 1F8UA 4E5YA 3MJDA 4DXDA 2GFQA 1IXKA 4RZ3A 4EI7A 1A8QA 3GY0A 4IVQA 1ZBTA 3S81A 3ZOKA 2HA2A 2HADA 4Q5IA 4JBXA 4XTTA 1XAHA 4LCEA 1DAXA 5CVCA 4LF9B 4R8MA 1MOPA 1X0PA 3G8TA 3R5FA 1EK1A 1Q84A 3H5LA 3ZXWA 5JCJA 5HMXA 3TNVA 3NGTA 1ZBDA 5IVIA 4O4RA 3BM7A 3QITA 3KKLA 2QL5B 1T5LA 2Z4RA 2RHSB 2J1LA 1SC1A 4ZVHA 5CEJA 2XCRB 2R8BA 3Q8LA 3CLRC 3CUYA 4QRIA 2I7CA 5DYGA 1UVNA 4QEDA 4OL0A 3PEEA 1P5ZB 1JEYB 1AKEA 2NR0A 3G8BA 3ZV5A 5TX7A 3QE4A 1PJ6A 1PJRA 5BYSA 5LZ2A 1IQPA 4MK8A 1JIIA 1B0AA 4R8KA 5AJHA 3J7AN 1DTQB 1A76A 2R1TB 4DYVA 1JWWA 1Z4QA 1ADYA 1FKPA 1CJUB 3P27A 2VJKA 1DX6A 3IBTA 5DNDA 1E5VA 4IEIA 3ZOZA 5C53B 1E6MA 2FYTA 4NXNJ 4TU8A 4TOIA 3OC0A 5FIUA 1E8DA 1TK9A 4NCXA 2J6TA 3DLKB 2VA3A 2JPDA 5L3QB 2X3GA 3J81k 2JNWA 1C4XA 3ZE8A 2PUJA 3TVTA 3KLFA 1NK9A 4MS4B 3IXQA 2VF4X 3RB0A 5HMZA 3DG9A 1XR5A 4BAZA 4C3VA 1F8XA 4HB0A 5LD2B 2UXDJ 5TC4A 1EWKA 1LBHA 4PYNA 1YVDA 5JQGB 3GYBA 1PNRA 2LMIA 3PPWA 1LD3A 1NBHA 3UHFA 5DXFA 3KVRA 4ZT2A 4DSLA 2XUZA 4HZGA 1VJDA 1M5PC 2I2WA 3THWA 3D2BA 3JARB 3NFYA 5JWOA 3H11A 2E82A 3I2KA 1X77A 2BMEA 3VKVA 2PGLA 1K7YA 4EUVA 4D82A 3K2YA 3QFRA 2PZKA 2QJWA 1L1QA 4PC7A 2C4KA 3NO4A 4E5NA 4GVPA 3KAQA 2IIQA 1CQNA 1CTQA 1GYPA 1UKYA 3JQQA 2QS9A 3MILA 4KQFA 4KHMA 1ZIPA 2OV8A 4GE0A 5I7HA 5K8LA 4A1FA 2V9KA 3FTNA 5AKIA 5AOAA 3LBIA 3FUUA 1ZM4A 2LNDA 4IVNA 4LSMA 1BYIA 2CPDA 5D0GA 4NYJR 1NJZA 3D7SB 5IJ0A 3UJ9A 3SIPA 5BO5A 5H68A 1GO2A 2XCPA 1N4DA 3R6DA 5JAHA 2F55A 3H42B 2CFXA 3RFTA 1U4OA 3DL2A 3ET6B 2DHGA 2RGYA 1A9SA 1HFJA 4Q9JA 5LDDC 1M2EA 3M9XA 1L5SA 1JSZA 3WGYA 1NPKA 2F8EX 4HUTA 5D85A 1I5EA 4NA2A 3QMMA 3DC7A 2JFQA 3P0JA 5TPWB 1PS8A 3CF5Q 3NAGA 4B3JA 5TPZA 1U8UA 1X9GA 5UKDA 4FJ2A 3JATB 4CKCB 3EPRA 2IEAA 4DRZA 1CBUA 1WB4A 2H8GA 4IQ0A 1E2IA 1DC8A 5FTNA 4KO2S 1B3RA 3ZZ0A 1WEHA 1ESMA 4FLEA 1B26A 4EO4A 4Q19A 1OJLA 1N8SA 3G7NA 5FA6A 2EP5A 1PL8A 1IXRC 4WIQA 2OGTA 1WEYA 1S2OA 2C2BA 4LZAA 3BWVA 3KEGA 3CDBA 4YQWA 5THKA 1AV6A 5E7OB 4EJFA 3I2IA 4A8YA 2BMBA 3LAMA 4UEOA 4OLJA 1QO9A 1V1MB 4FZ5A 5GV8A 1UKUA 5JTUA 4GWLA 1U3FA 4I69A 5JMOA 1MDFA 2HU2A 3HYLA 5JAZA 1BE6A 3IAS1 3FSYA 1OLSA 3FZQA 1O08A 2AMLA 3LY8A 4PBSA 3EWAA 3AF2A 4CGZA 2NZWA 3TQEA 3AZQA 3HMQA 2QMUA 3MUVP 2JHGA 4KN5A 4I14A 2EZ4A 2G28A 4CIVA 2VQFB 3ZPXA 3G02A 2DPHA 4G24A 2GSDA 1LBQA 1FMTA 3WJ7A 4RHFA 4DG1B 2PQMA 4M53A 1NG1A 2QW1A 1DAMA 4JMPA 4V1CB 3QGIA 1CS4B 3O31A 1GT8A 3BGIA 1HBJA 2RQMA 2RNEA 4AUNA 3EDQB 1XZIA 3C3EA 1E1QA 1BC5A 1JQEA 2VTKA 4JBGA 4PAQA 4EECA 3P9YA 1R8PA 4NDAA 1L3CA 5ER9A 2RUGA 2JSXA 3R4VA 1PN3A 3MDFA 1SC1B 2WVAA 1DXYA 2QP4A 3HCXA 3N58A 2F9JA 2YWEA 3MEGB 3PC8A 4QBFA 1LV7A 3K9HA 2VG6B 5AJVB 3G8QA 2FZVA 2XLBA 3A06A 2VDQB 2P1RA 1S0OA 1KP6A 2XUQA 3GLHB 4OYPA 3ANTA 3N5KA 3NBUA 3B3AA 1WI6A 4ARCA 4RFLA 3U3DA 2O2YA 1QVGR 2HGZA 1BEUB 2NZUG 2C77A 3MS2A 3TOCA 4W9NC 4Y2JA 1XZBA 2CXPA 3RS4A 2ZRQA 4NJMA 4EMBA 5LYJB 3DRPA 1S8FA 1P91A 2H7YA 3U31A 4CKBB 3G5LA 3W60A 1RAAB 3MS4A 2FSFA 4EIWA 2GGSA 3GJSB 1GVHA 5CHYA 4BDPA 1UR5A 3STVA 4U7JA 2YJGA 5U47A 4BHTA 5KFXA 4MR9A 3S5JA 2ASLA 3WWYA 2C54A 2DNGA 2XLKA 1LPOA 2GUGA 5CXTA 2HTFA 1MFZA 3EOAI 3WLRA 4YY3B 2V9PA 2P6OA 2AOTA 3V55A 3HYTA 4JKIA 2YZ2A 3PA6A 4FDAA 2GO7A 4CMKA 2IU4A 1ULTA 5KWJA 3C16A 4QPPA 3VV2A 4MP8A 2HHVA 2I2AA 2JGDB 2QQFA 4ZVOB 3EZUA 1NZAA 2JW5A 3FMVA 3PKJA 1MA3A 4HKQA 1R6AA 4L15A 2UYOA 3NLCA 5DXAA 4RNMA 3GT4A 4TMFA 1S6PA 2HJWA 4X1IB 2GCOA 1JHAA 3JZAA 1WTAA 1QDLB 2B92A 3GVPA 1RWPA 1J5EJ 1IQUA 4K9KA 1DDOA 1MMDA 3LWNA 2QRUA 5LB4A 4NU8X 5J2TA 5FOSA 5KC9A 3MMBB 3A6DA 3L7MA 3SE7A 5HK8A 1U5BA 2QORA 4ZCPA 1HBMA 3SJBA 1H94A 2JJ2D 3EXEB 3QW2A 3ZJ5A 1QO0A 1XZCA 1Y3HA 1HM5A 2AJ8A 1RW4A 1S6OA 2IYYA 2ZUFA 4FCTA 2CNLB 1OSNA 3G9QA 4OHCA 3G8YA 1CP3A 1RK8A 3RPEA 4W1QA 3D7SA 3W9JA 1RYMA 1FX4A 1Y6ZA 4RTRA 1F60B 1TO1E 5ECGC 4HMPA 4E46A 2HRUA 3AQPA 5KT3A 3IDAA 3QA9A 3WLPA 4RPIA 1ORDA 1VE5A 1SOWA 3C85A 1M5OC 2FSUA 3TNLA 1I1OA 5IBQA 5K8UA 1YB5A 4TYWA 5FOQA 4ANCA 1JDVA 1HE2A 1NH7A 1T9HA 2MYFA 3HY6A 4L5CA 1L1FA 1CJTB 3RRYA 3IEIA 3BB1A 2DNPA 2MSCB 4CLLA 1PS0A 1WPGA 5KFHA 2C5BA 3R3XA 5KTTA 3TKYA 2X5KO 5BYQA 4AD8A 1KFKB 1HKAA 4BO3A 5LP6A 1PGZA 1CC7A 1YZQA 2GILA 4QQKA 2BE9B 1Q19A 3TX6A 3COPA 1C30B 3D0HE 1UJMA 5JARA 5BN4A 1EWRA 1HA1A 3CJQA 4JOUA 2RQCA 4H6PA 3PFBA 2J3IA 3RAFC 4WF9Q 3SF8A 1QIDA 2ZIVB 3OO1A 3BGOS 4Q47A 2VHXA 3CC4S 4KRXA 4B2IA 3DOLB 3P2MA 2H5JB 3VNVA 1A4IA 4WLUA 4CTKA 1I7SB 2XLIA 4LV5B 1KQNA 4JI4B 4OSPA 1D4ZA 2FN7A 3PQ2A 3B1XA 3OR1A 1SQ0A 3VU1A 2O2SA 4G89A 4HNGA 5EWFA 2OIHA 3ONDA 4ZANA 3ND5A 2JEGA 2OAP1 3D31A 4XPCA 1DBQA 1MXHA 5I7SA 4X24A 3IR6A 4QO7A 3VAYA 4P4LA 4BVFA 3U3KA 2FJXA 2ZYSA 3SXPA 4RW9B 2F59A 3TSYA 3F41A 2BCEA 3BKWA 1TYEB 1QGDA 4CXMA 1GJRA 2IU6A 4MS1A 1FTYA 1XQXA 2C7PA 3RZAA 5EE1A 5AIBA 5AM0A 1DZ3A 1ZR4A 1V16B 4CLEA 1V3SA 3EGWA 1H6DA 4CM0A 3F6SA 1M6WA 3A6KA 4A0RA 4P71A 3K0FA 4TKZA 2C2DA 1I94J 2XMSA 2QG9A 5LQAA 1D6SA 4JLWA 2V8OA 3VSBA 4O3SA 2ZJYA 1NSFA 1XZPA 2NW6A 3A4NA 1K7XB 3SLRA 3T94A 1ZJ4A 1V9OA 1VQMS 3UI3A 4EPRA 3AEZA 3GT0A 3LU1A 1ZQ1A 2QN8A 2FUG9 3CR8A 2ZBEA 1SQ5A 1V1RB 3WIVA 3V4IB 4FGZA 3JPWA 3OT1A 2BBWA 3ZVRA 4GVBA 1NF3A 3D3JA 4FXWA 2HNZA 3L8ZA 4M76B 1TUWA 3WC2A 2QVCA 2JGMA 4ZEOA 3OC6A 1FDAA 4MR7A 3BZBA 4QDJA 4H7KA 4AKSA 2N7CA 4LDRA 3Q3IA 2ADFA 4H3VA 2CEAA 3SHWA 2MMCA 1EARA 1XTSA 2E5IA 2VK2A 1P1RA 3ZUGA 3T1HF 3EBOA 4KQ6A 1KH3A 2BANA 3BD8A 3PX6A 3IQFA 4CKZA 3D4PA 4K4XA 1J9EA 2IUSA 3QE2A 2R7AA 2FZ4A 3G6VA 4RD0A 3FLMA 4TXMA 1Z3CA 1Z82A 3A8JA 2RIRA 1JQJC 2V7TA 4IOAQ 1EDBA 4QEKA 4LC1A 2FY1A 4DNXA 1UADA 4Y9RA 1NYQA 3ZU6A 1YWXA 1X4GA 3L7AA 3EF1A 4NEGA 2ZSIA 4ARAA 2ATIA 5HLFB 5B1IA 4KBIA 4CMEC 3RS9A 4DR7J 4CO1A 2UUBB 2V1UA 4C5AA 2QX6A 3QU5A 1R8SA 5KFPA 2NQTA 2VHCA 3W9SA 2WD7A 2E9SA 5HDQA 5FWXB 1N5RA 3N01A 4M5DA 2GZ2A 3QPBA 1A7UA 1Q7TA 1N2EA 2D13A 5J4LA 1ZI9A 1WQ1R 4M5MA 3MPOA 4BZWA 1BCRB 3P4XA 3RU7A 3UC9A 4DB4A 4X64F 1ZA1A 1TJ3A 3LQ2A 2EFGA 2ZITA 2IHNA 2WHXA 4F7DA 1UK9A 2WYIA 3WK8A 1M5SA 4F4UA 1QH1A 4BO2A 4Y0VA 1IB0A 5A0YA 3AYZB 4YIHA 2HCBA 2VQFJ 4O2BA 4MGHA 2J3MA 3FA2A 4KMOA 3KHUA 3DOKA 1KE2A 1XMQB 3RQIA 5DN9A 3D67A 3I28A 4TTSA 3L41A 5IYZF 5K5EA 2GHTA 1DX9A 3K9BA 2R1ZA 1H9AA 3ZLVA 4I4CA 4QHTA 5JLJA 2FWIA 4LEIA 3CCCA 2WYHA 4K5RA 5C25B 4RIIA 4FFSA 4OXNA 4YCMA 1Y6JA 1C3EA 4XQGA 1R8AA 1F9AA 2B4KA 1UODA 1M8FA 3KPJA 4NYMR 2EOAA 1DIAA 3ED5A 1XIQA 3CUKA 3MINA 1U7LA 1GYRA 3AKDA 1CERA 3RW6A 1TEHA 3AFNA 4GC6A 3UKDA 4L74A 2VK8A 1VYTA 1FEHA 4RKQA 1NASA 3R2DJ 1PWHA 4G4GA 1E61A 2GK7A 4YRBA 4ZVUB 3KWFA 5EE0A 3U0BA 3IM9A 3GFRA 3X0DA 4G0UA 3LGHA 2RRAA 3QXXA 1LPAB 4F50A 4U7GA 2QTWA 5T3UA 5I9MA 3NNNA 2GXAA 2MIIA 3ERCA 3D1VA 3E1GA 4TXHA 1QZXA 2ZZTA 3Q5DA 5GMEA 2AG5A 1UBJS 3LBNA 2JFNA 5C2JB 1YZ7A 3R0XA 2GJSA 3JQAA 4HVZA 4OATA 2GJKA 3RB3A 4OZNA 2FSVA 1R3UA 3FR8A 4FSXA 5ICSA 2XGPA 3ORHA 1WUTA 5LMUF 5HZMA 4F3OA 4R71A 1KZ7B 3UJ7A 3RVPA 3QLTA 1NYRA 3K6JA 1HNIA 2PLRA 1MLAA 2PKRA 3T5JA 2D4AA 4K6CA 3ZBUA 4CI0B 4YAWA 3CO9A 4A8TA 4WCEQ 1U1QA 1HH4A 1NUSA 3NBQA 2XVXA 3II6X 3Q7QA 1PLLA 3AD7C 4U8YA 1LVUA 2Y66A 1G4CA 3RYIA 2QG9B 4TRRA 4IPTA 1XPOA 1U0SY 2W4MA 3PFOA 3D9BA 3DYIA 5F8JA 1W87A 4P38A 1QTRA 5K0SA 2G3YA 4KV8B 4HNTA 4BLUA 3AL0C 3JASA 3ID6C 1T1RA 2ZWIA 3CH4B 3LCUA 2A0WA 2PUCA 2IAJA 4Q5VA 2AZXA 2R65A 2WNSA 3Q8YA 1LUAA 2A59A 4XWYA 4FVCA 3OM8A 3W8RA 1Y1SA 2YJ6A 3CCVS 5AJTA 5AKEA 3GUHA 3ISVA 1ZSVA 1V3ZA 1SWWA 5A0VA 1CF9A 1Q20A 3WQHA 1OZ0A 1UZAA 3B38A 4INOA 4XVHA 2R66A 3OOHA 2PZBA 3OIVA 3EW7A 3O90A 3FR7A 2CE7A 1L4UA 1YB6A 3TRIA 1KYVA 4GDMA 2Q5QA 3JV7A 1U8SA 7FD1A 4QPXA 5IS2A 3SJAA 1DBDA 4QIVA 1Y1TA 2NTVA 2B7BA 1M0TA 2OCBA 5F8IA 3OOEA 4A8WA 2BKLA 2VXBA 5ICGA 2EZTA 5KT5A 4V0OA 1LXNA 5IM0B 4AZ0A 1SC3B 2FLPA 3UR0A 2N1MA 1CETA 3EFOB 1CQMA 4IICA 2V9WA 1LK5A 3ZQUA 4ZFNA 3HU5A 5DP2A 4K1LA 1NJWA 1Y89A 4ZYWA 4YI3A 4MPPA 4FFBB 1D0EA 5LLTA 5KUTA 4HEA1 1QU2A 4DI6A 5I47A 3AWDA 3KMQA 3IMFA 1Z63A 3A9SA 4AFNA 3CZPA 3E7PA 1ZL2A 4LVUA 3IDSA 4F9EA 2YVKA 3O91A 5AM4A 1YLXA 5JVHQ 1VKZA 3A4VA 2KRBA 2Y93A 3GCXA 3CRNA 2RHOA 3E3LA 4QIEA 2W9BA 1HWLA 2LP4A 1KI1A 3MTKA 3NG8A 3TPCA 3VGTA 3SIXA 3IIEA 4JFRA 4TY8A 4NS4A 4OHZA 4JI0F 1BEEA 5A3RA 4QPDA 5H3CA 4K50A 3CZ5A 4IUYA 3SJUA 2PCLA 3M6LA 3CNBA 4O4JF 2H2DA 3PG9A 3ZGOA 3S4YA 5HM8A 4Y9TA 5DEOA 3IO1A 4P86A 5ESXA 3AM4A 3TEMA 1MGOA 3HHEA 4NBUA 3IEVA 2HBRB 5LL6P 2Q43A 1BQMB 3LPLA 1R0SA 4CF4A 4XDHA 1YIOA 2OKCA 2OTCA 1GXUA 1NCLA 3ZZOA 3RD5A 1JL3A 1QCZA 4OX7A 3E23A 1A9YA 5DFAA 3LC7O 4HWOA 1I94B 1W94A 1FVQA 1SCIA 3OPYI 3F8TA 3HLUA 1VK8A 3UMYA 2H3HA 4DA6A 4QDZA 1JIJA 4Q93A 2VG7B 3NGKA 3UAZA 1A9OA 2HHHJ 3OHBA 2GYUA 2O3SA 3AL3A 2X86A 4ED2A 1NJ2A 2VBCA 3VJMA 2QR3A 3X44A 3IQXA 4CV1A 3HP6A 1S3FA 1E9BA 3WIDA 1KY2A 4YACA 3N8NA 2QRQA 1M8JA 5A02A 4DMLA 4MTCA 5EESA 2EC5A 1LPMA 3K8OE 5BN5A 3E8MA 4MPRA 2IJGX 2IHBA 3K2IA 4EPTA 5KHLB 3I8SA 2JWNA 5KJFA 1OXSC 1X8XA 2XCUA 1JFVA 4LF6B 3KTFA 1G8HA 1W19A 2IPAB 1P5JA 2B1GA 1QVVA 3RSGA 1I0LA 1EHCA 1Y48E 4K81B 4H08A 2DUUA 5AKZA 3FWZA 3G17A 4HVTA 2YIVX 3INRA 2J9DE 2R7TA 4IOMA 3B3FA 4XGRA 4Z37A 2XYVA 1ISHA 2Q6OA 3KUEA 3KUXA 3VISA 1I3CA 1V6HA 2VH5R 2I2FA 5FYQA 4BJ3A 1VRVA 2OC4A 2RHJA 3SFVA 3PL1A 2B5WA 1U7DA 3LPEA 1EQ2A 1YZ6A 1WHSB 1TCUA 1M1KT 4TZ6A 3NEPX 3E01A 4YV1A 4RNFA 2R44A 2R6GA 4ETNA 4WXYB 1OBFO 4AKTA 2XSZD 1TAGA 4A8PA 4C8OA 2ZYWX 2QUIA 2Q1SA 5K0BA 1ZQ9A 2ZJ7A 3H3FA 2GZHA 2M52A 3TZEA 5TV2A 3TUZC 3PHBE 1RTDA 1CY7A 2DHSA 3KTOA 3SC2B 2XY5A 3QELA 1DQNA 1O94A 3EIEA 4PWZA 3IPLA 2YZNA 3COWA 1NLFA 2V8GA 4NENA 4F4JA 2PAAA 3M6MD 4YRQA 2W6JD 1HPZB 2BEFA 3FTDA 3ZNQA 3WTBA 4E2XA 4AZ3A 2O2DA 1Z6ZA 3FE2A 3TLXA 1GDDA 1O3YA 5BSFA 3FFIB 1L7VC 2JGDA 3NTRA 4P0QB 5J2NB 1D0IA 1WQ4A 1YAHA 4BECA 4TSFA 1KSJA 3IA2A 2JCGA 3H2BA 4KWCA 1EVKA 2ZUCA 3DBIA 3SHOA 2MYNA 2MZQA 4WIAA 5K7SA 4U2DA 3GU3A 4HGQA 4FTWA 5EHZA 2WD7B 3C4VA 4P7VA 1SKUB 4F04A 4FX2A 5DBGA 3T7EA 5BW8A 1FFWA 3HN6A 4J1TA 2I87A 2XUPA 4H15A 1NF8A 5AW8A 2FNAA 3TIGA 4H0CA 3PRHA 1X4BA 2IP4A 3M9WA 3OL7A 2PNJA 2YRWA 1L7XA 2HRQA 4ZCRA 3KQLA 1KK0A 4PYMA 1S1TA 2AG1A 4OUDA 3WQRA 5FPTA 4IVRA 3PWZA 3ZDAA 4GLJA 3GCWP 5A0YB 4CLTA 5FO0A 1RTKA 1ZOSA 1LV8A 3HHPA 3AOEC 4MQEB 3P1JA 2WZ1A 1SXJD 4K5QA 2XI4A 5F8HA 2ZAOA 2D1FA 2FOXA 1H6BA 4ER5A 5CB4A 3DLEB 1JX6A 2P4UA 6FD1A 5DO9A 2ZH1A 2GVZB 4AROA 3WA6A 1DKLA 2QLJB 2HGSA 2A6PA 1P6UA 2CXTA 4ZDJA 2OC9A 4HJXA 2IZ6A 3AR3A 3BIJA 4B7XA 4ZJPA 1T4MA 4TTRA 2BIFA 1XJ0A 2QTCA 4MUNA 1E2UA 4HTFB 5JC8A 3MA0A 5HNKA 3TEJA 2ZPUA 1NA5A 4JLBA 2HHUA 3AU8A 2FMFA 1L5UA 1R6XA 4Q9KA 1HI8A 1PRYA 4RH3A 1OZAA 3CUVA 3ELUA 2NAPA 3VDQA 4UTOA 2VFSA 4ITVA 1EXWA 2RIPA 3SX2A 1SBQA 4KKXB 3V4ZA 3R6LA 1JIUA 2VRBA 2Q5OA 1SG6A 5IH7A 2BKXA 3O3OB 4NFHA 2IHTA 4PXSA 1THZA 3D4OA 4JVOA 3ORRA 1Z6GA 1ZG3A 2BHLA 1NUTA 2E0IA 2BY4A 4QHSA 4MVJE 1TZKA 2HJSA 4P58A 4D9EA 1Q2XA 4HPXB 2ASVA 5FJIA 1U0OC 3H98A 3OR1B 3KLOA 4Q9IA 4KXVA 2AG0A 3DAFA 1TCCA 3UHAA 1VC5A 1IQ0A 5ERYA 3NMRA 5ELMA 2CKDA 2HCFA 2OCKA 2QTMA 4RETA 3DFKA 3GRVA 1FJ7A 4E6EA 1YDWA 4GIBA 1RXSA 3PRBA 1ENZA 1LA2A 5BYBA 4OLFA 1T4CB 5J5VA 3UT6A 4DFPA 2YXNA 4R9RA 5F21A 5J4VA 4N5IX 1EFKA 2VOEA 3OTCA 4Q0BB 1RFLA 5JZMA 1IMOA 1PZEA 2C95A 4TLEA 1M2VA 2RH5A 4YQYA 2YH2A 1UKEA 3NGLA 3KUCA 1MEOA 3MJTA 1PV2A 4AKIA 4JI3B 3OG9A 3K4HA 4A8MP 2E49A 2B98A 3C87A 3W65A 1VSTA 4EK9A 2XBUA 5F7XA 1QIIA 1U28A 2CNWA 5CYJA 4BFTA 3SZMA 2HK6A 2Q3CA 4TMXA 4U95A 1P9OA 4GI7A 2DNLA 3KHGA 3RS5A 4CTJA 3DRYA 3J7YI 4JLUA 1I51A 1V25A 1CR2A 2J9FA 4Y9DA 4DR7F 1XG5A 2PGXA 4WXWA 4IFIA 2ECOA 1D6JA 3EDRB 5A5VA 4P80A 1HE3A 3VDXA 3I5BA 2DSNA 3L7UA 2LZ0A 4WZMA 1K6IA 4RJLA 3C16B 3PYDA 3W5YA 1NZJA 4D0GA 2HVIA 1UT8A 4M5NA 4F85A 1TR0A 4XWOA 2PD4A 4KAXA 1RQNA 3HCOA 2BQUA 3DXXA 1OFGA 1HE1C 4NXNB 3ON5A 1GFWA 2ZSJA 1BXRB 3LTEA 4EZEA 1VE9A 1WBDA 3S1AB 4CM2A 1FU4A 2YHIA 1VRWA 1URPA 4ZJUA 3BEDA 4ITUA 4WXPA 4ND4A 4L3KA 3DCNA 3ZEAA 5J2NA 2C03A 2WVGA 1WOMA 2AJ0A 2IJNA 4Y6IA 4CDRA 1EFTA 1Z36A 5FPYA 4Y67A 2CXEA 1HBNB 3AGPA 4B83A 4CEHB 4N01A 2W24A 1UVJA 3N53A 4RAOA 1VIOA 1K68A 2D0IA 3ENQA 1O9HA 1MMFB 2H1FA 3PCXA 4ND3A 3CEAA 1FMJA 3B60A 3G6WA 1W0JA 2VSOA 3UG6A 2XJ9A 1YQQA 4WY2A 4AJNA 4I5DA 2X22A 3GJTB 1YRQA 1CF2O 2AT1A 4R2LA 4Z4QA 1IN4A 4L57A 5HL7Q 5HQJA 5HSPA 1D8TA 5K5MA 1KZYC 4FKZA 2MLZA 1UOPA 5JZBA 2H9YA 4F3QA 1ZWKA 3JSYA 2J6BA 3GWGA 3KKEA 4KK4A 3NHFA 2FVQA 4MW4A 4HC4A 2Z1MA 5ICCA 3VX4A 4XSVA 4HAWA 3TXYA 5P8WA 1G60A 2PBLA 4LRBA 2O07A 3DZBA 1V9CA 3R5JA 3UAGA 1GL9B 4R8LA 5BYJA 4ZVTB 3B1VA 2VODA 1GXSB 2VKQA 3RSCA 2PX4A 1P4AA 3BHMA 4HLNA 2YXLA 4M1SA 2JIOA 3ISZA 3TF5A 3CSDA 1I7LA 2XRMA 3UUFA 1N78A 2DNKA 3BS9A 1KAEA 1Z0AA 2O3QA 1Z0KA 3G8AA 1RIIA 4RF4A 4S2EA 4ZO4A 2XYGA 3UT5A 1A2BA 4K9OA 3DE0X 2W2PP 1MBZA 5E2BA 2V8BA 2QD3A 2PBZA 4M0KA 2W4DA 4Q12A 4R3WA 1F5BA 3OESA 5A2QA 1AMOA 5DLFA 5LM3A 2VYND 4XYGA 4R6XA 3K32A 2OLKA 3TZYA 1JPNA 3CCJS 1AYEA 4I4TB 2BJ1A 1CC1S 2OBYA 5F1PA 2ZQZA 2PH3A 4JKYA 4LOHA 1QUEA 4X20B 4FYDA 1Q8KA 2GEUA 4G9EA 4OZLA 4Z7QB 3CD6S 1CJVB 4BLGA 3FPKA 2BGNA 1EP3B 2BEKA 2JVOA 1GSHA 3CCUS 2G06A 3OTQA 4ZP1A 2YHSA 1LC0A 4D80A 4P32A 1L3IA 3WNQA 1E3IA 5D1NA 3DFFA 1L8XA 5J43A 1GZ5A 2XHEA 4K7QA 1L3UA 1WEXA 3DZ8A 3M30A 4ARBA 3N2KB 4URFA 3NIDB 4O4GB 1NW6A 2PXXA 1KPIA 4TWJA 2IITA 2EATA 4MB2A 2HQRA 3BH6B 1GU1A 1XCJA 3IOBA 4GYWA 3GLFE 4H7HA 3DYVA 4UTGA 5FDLB 2CWWA 1KC1A 1QP8A 3FWPA 4GBED 2A84A 4P73A 4GLLA 5ALSA 1ANKA 2VBXA 2Y1XA 3KR9A 1JI3A 2W2XA 5C3MA 2CMHA 3KJXA 4JT4A 1XELA 2YFYA 5FBWB 5AMXA 1JXVA 1BXNA 3RK1A 2ZUUA 1Z39A 4OM7A 3ZHZA 2AYZA 3FDSA 3N2EA 3RABA 2P7HA 4M63A 4ZALA 1BWEA 4UD6A 5BUCA 2I1RA 5EQJB 2ZBCA 3P2YA 2XBMA 2R1VB 3HKCA 2E44A 2JKZA 2XWPA 2NUTB 3L3BA 1N9KA 1DEOA 3QO9B 4MJ7A 1XJCA 3FDJA 3L79A 5EEGA 2W6CX 3VWSA 1P4HA 3D5EA 1YQXA 5BWOA 5M04A 1W5SA 2LEBA 1E79A 2Z8XA 1REGX 2CQPA 1RT4A 3MGJA 2J6SA 1CUBA 3MOSA 3IUSA 1PG5B 4LSZA 1EYZA 4YMIA 4M37A 4LISA 1GNLA 4C7XA 3S28A 2Q2VA 4YR2A 1I3KA 2H54A 3NGXA 3N9UC 1JPJA 3PIOQ 2ZATA 3LVFO 2ZD1A 2DVMA 3OOWA 1AJEA 3B1YA 1VHQA 1R66A 1SH7A 2VJUA 4CQMD 3VAMA 3OLCX 1MW7A 1FVXA 2BPOA 4D8TA 2VWQA 3R0JA 4X61A 1F6DA 2VFUA 1W85B 2JZ5A 3I6YA 1ID1A 4CO2A 4ZTUB 2CQ3A 5DDIP 1QS0A 4II3A 3MHTA 1YO6A 4Q3KA 3EFOA 4O29A 3M5DA 4BZZA 1JUDA 4I5GA 1NDCA 1MW8X 5JAMA 4DLGA 1DBSA 3GWZA 5AOCA 1MB2A 2Y0DA 2FZCA 1A88A 4JI5F 5AD1A 3MM6A 4QWDA 4DR6J 2QZZA 2O20A 1WKBA 4KBFA 3HZOA 5JC1A 5BT9A 3OZAA 3V7UA 4W7IA 4FQ7A 2GZSA 3G88A 3QBVA 9MHTA 2ERXA 3N0XA 3DJFA 2AJLI 3DGPB 2NSCA 3DFEA 1AH2A 2Z1DA 3PCOB 2VEOA 3EZYA 2BP7A 1QXSA 4NCNA 4B40A 5I7OA 3JZMA 4D3HA 2IRUA 1NULA 2QL6A 3C8HA 3GILA 1A5TA 4YFUA 1OHHA 4GGMX 4QBKA 1OPIA 3BCHA 1VKJA 4A73A 3R5DA 3B1JA 4ERNA 1ZJWA 3I5CA 4GUDA 5KYVA 1ADJA 1U1LA 3KEFA 1K0VA 3T19A 4CQJA 1AK1A 1K5DA 3KX2A 1TMJA 2WMOB 4BV3A 5ES3A 1KPHA 4GAEA 2EKDA 4QJ3A 3MEQA 4QGHA 3AR8A 3TFQA 1DJQA 4IDAA 4OH1A 2DO4A 1TVMA 1WB9A 4YRZA 2HLDA 4TY9A 3A7DA 3L8DA 3CD5A 1Q95G 5KBYA 3N8GA 5I7RA 3LKDA 4PIPA 3IAM1 4KXNA 2KH9A 3NHPA 2V96A 2IF2A 3NC1C 3PXCX 2QSZA 4ON9A 4BASA 4P2GA 1YD7A 3EYZA 3WX8A 2HHJA 5TVGA 4GFDA 3D3EA 1T34A 4BN5A 5KFAA 5HZHA 1JQ5A 4OK5A 2J3JA 1J99A 2AOXA 2OUGA 1H2BA 1CY0A 1QAJA 4HZUB 5D4LA 4AXIA 3ULKA 2X13A 3PQ4A 2W48A 2FDXA 2WF7A 1QMPA 1TAQA 3HDGA 1SZPA 1TMYA 2WJAA 2JAHA 2GNKA 4AO8A 2IXDA 4TSRA 4F2PA 3GRYA 3WC0A 3X1DA 5C8VA 1RB0A 2V7XA 3ESRA 4J9VA 5HGJA 5EY5B 3PW2A 2QUBA 4DOZA 1OY6A 2I2DA 2C2KB 5K8JB 2HNYB 2J7UA 2BFEB 3ZYCA 2WSCC 2QVGA 4UQOA 3KHRA 3W6UA 3I01A 3FETA 1XZJA 3GU0A 1MU2A 2EBFX 4DWJA 2D3O1 2CLOB 2FDCA 1A71A 1F6BA 1ZNWA 2G8LA 2JC1A 4ZN6A 3UH0A 4GMFA 2P91A 1O6ZA 2CB0A 2QPOA 5FL7A 1J0EA 4NSNA 2F63A 1JIHA 3DMJA 1MOSA 1W76A 1GTEA 4QYIA 4LR9A 4WU3A 3BT7A 3V5NA 2RKBA 2VC2B 3HSYA 5FDLA 3CLUC 4OJNA 4Q4DA 5A5EA 3I62A 1TU0B 2VZ8A 3DZJA 2CDRB 2ORED 2QRPA 3KYBA 4JLOA 3TB6A 1W88A 5H16A 5D3MB 3M33A 2Q5IA 3AI2A 4BEJA 1G8FA 3HCRA 5CB6A 3M5WA 3GPLA 4MPJA 3V8PA 3AUYA 3BK7A 5TB5A 2H0AA 5EQTA 4ZV4A 3KK2A 2ZBQA 5DZSA 4ZTZB 4LF7F 3PDNA 3ADKA 5AXLA 5K4GA 1FSSA 1KQGB 4O23A 4DZZA 1PR5A 1SVNA 2CV2A 1PI3A 1WS6A 3FNRA 1MJNA 1P61B 3QEKA 3LC0A 3IQEA 4W7SA 1XFAA 3E5NA 2DNYA 1H66A 5B0FA 1PCXA 1R0BG 2ACYA 2MZ1A 4G0QA 3OFSA 3KQTA 2DUWA 1O9BA 4C7QA 5C34B 4ZJYA 3UUWA 1N8KA 1K6MA 4H2DA 2C4VA 3BVPA 2Q8QA 1HORA 3IJRA 4IG4A 1O6GA 3WE7A 3HLTA 3TZ6A 2DTXA 2H1HA 2AYBA 5GY7A 1KDOA 4WKYA 4ER3A 4G6VB 4JLDA 4UVHA 1CEZA 1PSWA 3G0CA 1U3DA 3J80Y 1MB9A 3PJWA 3KTAB 1CY4A 4W5OA 3AOAA 2DFPA 2WSLA 5BR8J 4M83A 2B8PA 2ZOGA 3AETB 3SC3A 1P0MA 3NOXA 3W2VB 2VLIA 4ZCTA 4CFSA 2HLNA 1Z8NA 3CEDA 3MFIA 2HRCA 1DTTA 2OO5A 2QA4G 4IYJA 2GCNA 2B51A 4JWKA 4HFRA 1T9UA 2MHEA 1DDIA 1MWZA 4EATA 2Z2ZA 4MIOA 2R62A 3UUEA 2JJYA 3A1DA 3UQYS 4DPUA 1PBAA 1KJJA 2FEKA 1L3VA 3IWNC 1RMYA 4QREA 1S1TB 2NU6A 5COQA 2QM3A 4PTYA 2RDJA 2GD1O 3FAKA 2ATCA 3X1JA 3FI9A 2AC4A 1SKBA 4C3UA 2QGZA 1KH2A 5ALEA 3BGSA 3NALA 1X8DA 5G1PA 2EWMA 4OJGA 4HWTA 5JS1A 4YBRA 1KBRA 2F8HA 3KETA 2OPRA 5FBZA 1MAHA 2I03A 3EDOA 1ND6A 3IMCA 4DPLA 3TVDA 4UHHA 4Z4HA 4M94A 2FPHX 3OHSX 5KEIA 4J0CA 3B3GA 3JQEA 4REMA 5B30A 4IOLA 1MP0A 3WLHA 5LLSA 2ZU0C 2JH3A 4QUAA 1N36F 1RKUA 2VUTA 4BEVA 1Y8CA 1Q0TA 2BFWA 2CVEA 4ERDA 4H3KB 2JEZA 3AEYA 3I3OA 4EX6A 4IMRA 3KSBC 2GKSA 1S3SA 2A33A 4OI3A 4JLJA 2IHVA 4M7OA 4QWMA 3B89A 5EWLA 4JBWA 3F3YA 3TLCA 1EZ4A 1G8MA 4EPVA 1P81A 3M8PB 2YYYA 2C8LA 2W2PA 3UWPA 3ILLA 1V35A 3A11A 1NY5A 5A3SA 1N6NA 1BHO1 1SB9A 4OBWA 4QPCA 1EJ7L 4B3FX 1TZCA 5J1PA 2KXNB 3VVBA 2OCAA 5AVJA 4WBNA 3H9EO 4RIHA 1WG5A 1NK4A 3IYLW 1DU4A 1Z4UA 2V3WA 4ZYLA 5DNCA 2FOIA 4LIPD 1D1UA 8RUCA 1Q6YA 2GC8A 3PZRA 1T3HA 1CDDA 3I0RA 4BTLA 1TV6B 3C39A 3CIOA 3DL7A 4YMGA 4CCSA 2EV9A 2H2FA 2VNSA 2Y99A 2ZRGA 4DLTA 4YAEA 4LRUA 4UATA 4DV5B 3JYPA 3VKFA 2Z9DA 4GI5A 4UMFA 5LOVB 1T6NA 1RQRA 4B71A 1NSAA 4DLAA 1DTSA 5F77A 3DO5A 3W0LB 3T4EA 2CQ0A 1T4CA 3PU6A 4GMDA 2BE7A 5I7WA 1E7QA 1UPAA 4XM0A 4DCNA 3A05A 1K0UA 3GARA 1S3IA 2FVSA 1GUBA 3GV5B 1ZMTA 2VJNA 4JDPA 4UCFA 4ZP7A 3TJAA 3M3PA 1G8KA 2WBRA 2RU9A 4YCLA 2K87A 2D54A 4DV0J 3HVHA 3JS9A 1S1UA 1KJZA 1KSGA 4RNHA 3LUBA 2GEJA 3IVRA 1TL1B 3EAFA 3A9UA 2ZPAA 2ZB7A 3E9RA 1DUIA 4XQ9A 4ITRC 3KDAA 5AI9A 5LQMA 2GVDA 3M8YA 4N40A 3RC1A 3NY0A 3EGXB 5EXDA 3P0IA 4MVJP 3O8RA 3AJAA 2DFVA 4O2AB 3U4AA 2YWFA 3OPNA 4RJJA 4U8HA 1YGYA 2X9LA 2PJDA 4I50A 4KFTA 3EEQA 1O03A 1KQGA 3TOSA 1KY5A 3CLHA 2VZ0A 4J0HA 2BGWA 2DIVA 1DSSG 1XQ9A 2P2CA 3SSRA 3TVKA 3TSAA 1L3KA 3FPGA 1I6LA 3DVQX 4RPGA 2H54B 4B3RB 1BD4A 3K2QA 4EUSA 3DMDA 4ML3A 1QIGA 4UEKA 2B8QA 3CDUA 1WEKA 2QMYA 3NDPA 1AC5A 5FA8A 2WVFA 2NG1A 4HFJA 5L3RA 3ZGNA 4ALZA 4TM8A 1NBMA 3WKAA 1VQSA 3PNMA 1CRQA 1H0KA 1W85A 1UWAA 4KL8S 3EDQA 3UGJA 3OKAA 1FJXA 4ZLLA 1X39A 3H11B 1CUFA 1RAFA 4AJHA 1GFSA 3BOSA 3C48A 4JP8A 1WPXA 3TW0A 1D09A 1P7VA 3V48A 3S7RA 4CR6A 4J6FA 1BXZA 4US1R 3P9CA 4N0DA 2VHTA 2YKOA 4J9PA 3ZK9A 1CDZA 5KFIA 3W2VA 3UD3P 4OUDB 1IN6A 3D3NA 5IV4A 3M5CA 1IJBA 1DC4A 5C42A 3RGIA 1GKIA 1RT5A 2IBKA 4RZSA 3RAPR 2QL7B 2L9NA 3MWYW 1RKJA 1STOA 3U9SA 2RI6A 3H59A 1AY0A 1NR5A 4CETA 4YWHA 2IU3A 4KXUA 3F7NA 1TCVA 1E2FA 1GT91 1G2IA 4OXQA 3BE6A 4MGKR 1H0HA 1DBRA 3GJSA 1NPRA 3IC1A 3A1SA 5CA0A 1QSGA 5AW7A 3H40A 1SEPA 3JAMY 2KPOA 3WWPA 1FRQA 3GZNA 1N1GA 5LZ5A 4UPEA 3D9QX 1AUPA 2W6MA 1JALA 2J3EA 5D00A 1YB2A 2HXSA 3V6MA 4WZBB 3W3AA 3MR2A 2PT9A 4P7KA 3GCGA 1IDOA 4USJC 3R0QA 1VS3A 3GEEA 3BMQB 2C3YA 3KHHA 1OGIA 5EVCA 3OX4A 3I2GA 3PPYA 4U2FA 4HH0A 5FR2A 4B8ZA 3MWGA 3L7CA 1Z0DA 4RM3A 5E3AA 3E22B 1QANA 3W61A 1T0HB 4LXTA 3VSEA 3D2WA 3T7KA 3VYUB 1XKTA 1QHEA 4P33A 2ZIEA 3KLPX 1IHPA 1W4LA 3FCOA 3GLVA 4D9MA 5IK2D 3VPAA 4LMBA 2QQEA 1YA4A 5JCZA 4UHBA 5JY6A 1BGXT 2IIPA 4V03A 5T41A 2D2XA 2V0CA 5JOQA 3MOGA 3RVSA 1BW9A 2FTRA 5AP9A 1PQPA 5BVHB 1YJWS 4UBKA 3RREA 2ZGVA 3FPFA 3FUTA 1AHPA 3K9GA 1KA9H 4NTZA 2HFJA 5L7YA 4NBTA 4HLUC 5E3CA 3DZFA 1J2EA 4LJ6A 1R0CA 3B6JA 3D43A 3U7RA 2CNKB 2JGJA 1J33A 4BX3A 2XQGA 1TUBA 1HRDA 4ZCQA 4CN8A 4LDNA 3TEHB 1V16A 4PQUB 4OL8A 2KLBA 3KR1A 1TL4A 3V7YA 3CYFA 2XLJA 3G5UA 4DX5A 4M88A 4X62B 1OLUB 1EKSA 1OILA 5GMOA 2QT1A 4WK1A 2K06A 4P92A 4BVJA 2G9VA 2AWZA 4GOLD 1QJ4A 1AB5A 5ER6A 4ZOCA 1H2VZ 4QEZA 1EK2A 1X74A 2Q3JA 5E9QA 2RGWA 1NQWA 2M9KA 1IUJA 3O1LA 4BBYA 1PK8A 4PR6A 2Q3BA 1ZAKA 3K70C 3IA0A 2HMVA 4OMFG 1GPKA 3L7BA 5A8RA 1Q92A 4QWWA 4EMTA 3CXCR 1Q0QA 2B25A 3E9ZA 2PKYX 4A92A 1ESDA 1NGSA 1X1SA 4P08A 1XNJA 1DAFA 1FXUA 2NXNA 4F02A 3GWCA 1WJ9A 4B76A 3M6XA 3Q8SB 3ZWAA 4YO8A 4EMSA 1Q14A 1U6IA 4O1MA 1VFJA 1M6NA 3GFFA 2AFIE 3MGAA 4BO6A 1OR8A 2Y1LA 3C8UA 5KG6A 1WG8A 3KXLA 1RJGA 1IK4A 5DGXA 1WMSA 4MPDA 4CMBA 1W5FA 1W5EA 2WOMB 1I6JA 1I6MA 4W99A 2VI5A 2O3DA 1IUPA 4HWSA 3BH7A 7REQB 4LN1A 1NRKA 2PVSA 2GBLA 2OM2A 4K3VA 1ZNZA 1QFXA 4Z0PA 3ZWVA 3PW5A 1WUYA 3ROMA 1JLAB 3QFTA 3TSOA 3TTTA 1S3GA 3RJ9A 5ALGA 5D6OA 3W8PA 4A5SA 1PVDA 2YVAA 5CW1A 4MRMB 1YS7A 1FDSA 1LB1B 3BTSA 4BV8A 3TPZA 4NLTA 1R0WA 1DRZA 3WTCA 2I65A 2PI5A 4NXMJ 4YQFA 1U94A 1U02A 5FEUA 3LF1A 4EKEA 3SNHA 3DLLQ 1UJ5A 2HI0A 3KB2A 1Z7GA 5B7GA 1JS1X 3AM1A 3UKJA 2VZLA 3NYIA 3CDEA 4JNCA 1CEEA 3IKJA 4F5ZA 5CNJA 3SIWA 3CRQA 3O4JA 4Z1MA 3KK3A 2YBVA 2VC1A 1RAJA 1NIJA 4OV6A 4QQ8A 5A0TA 1IBKF 1C1CA 2ZDQA 3W4KA 5AW4A 1S2DA 4AMVA 3ETOA 1DXHA 1QC5A 2JD1A 5L95A 2CNNB 1G5QA 3DAGA 3I56S 1KJ8A 1LK0A 3NMUF 1T3SA 1YITS 3R0IA 4OMUA 1E2PA 1NSKL 3TOXA 4CDGA 1MC5A 3Q88A 4YN3B 4WL0A 3AVOA 4DUYF 1CJKC 5AKLA 4MO2A 2N4CA 5LMNB 3T1NA 2ZBIA 4Q7AA 2B6AB 2K5UA 3WLAA 3GA5A 2XMBA 1QAYA 2GERA 4ENSA 3IKVA 4X45A 2M8HA 5BQOA 3M6AA 3BWBA 2ZJ4A 3RSLA 2F17A 2VSQA 1A2OA 1WUJS 4YX9A 3RB4A 3JWIA 2H5EA 3I9OA 1U3UA 4ZGGA 4GC9A 3W8GA 4PU0A 1OSDA 3H2SA 3ZI7A 1HSZA 4DL0C 3K0SA 2NSJA 3TI0A 1G7CA 1VLQA 3U4MA 2C07A 2BKAA 5IT5A 1XU7A 2R5NA 2WAXA 5FLYA 3OJWA 4BBJA 1FP2A 3CRMA 3NORA 3Q9UA 3HKDB 5DTQA 1J27A 3CF4G 5IZCA 3F0NA 5DNAA 3R5CA 1KJNA 2K7JA 1NV9A 4JODA 4CJXA 2D59A 4LBZA 4KB7A 2FX2A 3AONB 3D6TB 1JI0A 3SSMA 1G6OA 4AAYA 1UDWA 1BROA 3H3XA 5JEEA 4CNZA 5DRTA 3SG0A 1JG3A 4YJHB 3FZYA 3NAMA 4QM6A 2UYQA 1E6LA 4MYHA 3OD2A 1AQJA 4AO7A 521PA 4DV3J 4KGXA 3ZCQA 1DGQA 1VBNA 4Y2QA 1H9BA 4HZUA 4CLXA 4D97A 5L4NA 1U99A 1YUMA 1E1RA 2J85A 2XMPA 3O2IA 5HF5A 3A4LA 2YQ3A 3N0TA 3FK4A 5FUXA 5LXTF 3AEKA 4IW3B 1TL7A 2C9OA 4U8VA 5IT9A 1T2CA 3PE6A 1D3AA 1LNZA 4D2IA 4IDQA 3GPIA 4OVKA 3I0MA 5KYXB 4RIFA 3QEBZ 1IBLJ 2G5CA 2MSNA 3KHTA 3DPIA 2O3JA 1ZD4A 3RHFA 1RLMA 4DEVA 3R3JA 4WY5A 3HR4A 1N5OX 2HT6A 5D6GA 1Z4KA 3OPXA 3A1CA 3BQ1A 4KLRA 4MS1B 2DJ5A 2ZETA 1QH8A 3SSSA 4HYKA 1CSEE 1S1CA 4DA0A 5EWEA 5CVEA 5EP4A 4FW9A 2VH1A 2FLVA 2O19A 4C0AC 5GAGU 1GNPA 2BF7A 4CDIA 3A0UA 1ZJZA 4RTQA 4TLLB 5TQ2A 1RYZA 1BVYF 3KVOA 2JJ8A 5C25A 1S01A 4GD3Q 3RASA 2VXCA 1SVDA 4BVKA 1T03B 1W2HA 4F92B 2ZBRA 4K9MA 3GT7A 3FBCA 4M8LA 5E4TA 2QV6A 4AMBA 2VU5A 5KG7A 4QUBA 1Y7LA 1E98A 1GUYA 1N1EA 4EGLA 5CIWA 2ZJAA 3DBHB 2HPHA 1JHXA 2HYDA 2JFXA 3KIPA 3DMFA 3CKYA 5IANA 1JF8A 2DPYA 1C3XA 3BJYA 1M1ZA 4B6GA 1IHUA 2ZR9A 2XUOA 3AUXA 3EUEA 1SXJE 1X13A 4X4SA 5IEBA 4QYTA 2HVEA 2B8WA 2Z8YA 2DXEA 4HNAA 2O5DA 2J67A 4BO4A 3CX7A 1V3VA 4Z7NB 5CAEB 2CFOA 3JQ9C 3P0FA 2P7IA 5M2RA 1U9IA 4DM7A 1YAJA 4DCVA 4ZHQF 2CV0A 5C1PA 3MBIA 4M0PA 1FRFS 2ZM6J 2IT1A 3CWQA 1O5OA 2XS7A 2C59A 2DHXA 4HDKA 2LKZA 4PTZA 2KSQA 3L4KA 2G2OA 1QYXA 3E2EA 3PM9A 4AW9A 1A5SB 1MNQA 3PQCA 4WFYA 2GZAA 3G5AA 3U1TA 3HSKA 3L0OA 4PS0A 1WZNA 2WF5A 2J7KA 5KG1A 3UYLA 3WQPA 4KUEA 3L8EA 4G8DA 2E7XA 2OSRA 4GSLA 2D1SA 4ZHRB 5KFKA 3W2TA 2AUTA 5T4HA 1BWVA 3JVUA 4WEQA 2I76A 3TANA 1BAPA 3VHXB 3EAGA 3D5TA 4RWZA 2DH7A 5C1IA 4DV2B 2W8BB 1VYUA 4RNNA 3L1KA 3LFHA 1VKNA 4P4GA 4KE5A 5CYMB 3ICLA 2ZVIA 3U49A 2CHUA 5IXYA 2HBRA 1KIAA 3IAUA 3OBBA 1DJPA 1OZHA 1QWOA 4X3PA 1SJQA 2OBLA 1SOUA 3M4JA 2VT7A 2ZHOA 5F98A 4KSEB 5K8VA 4KTTE 3EGCA 1ZK0A 3D3WA 1A5AB 4UQTA 4US2R 2LDIA 2BE2B 4YRCA 2WLSA 3T7SA 4DCGA 3U1VA 1KDPA 4R2IA 4CCWA 4N39A 3FUYA 1X4HA 3IV7A 4EY4A 1NX9A 3NBKA 2BR4A 3QX7A 3OXGA 4LQLA 1J49A 4DR4F 1N7GA 4OYWA 2R7XA 1HDCA 4FF4A 4Q4CA 2O8DA 4TM7A 5A4DA 3FYUB 1U11A 1HLPA 4S1OA 2PRKA 5LMUJ 3NYWA 4HVLA 5JAPA 1NJSA 2RGUA 4RVGA 2CHFA 1Y5NA 2O52A 3SV3A 2MLYA 4NMWA 5ETSA 3PTLA 2O5VA 4G65A 1U7OA 2ZHBA 1YR2A 1JAIA 5KHOC 3FWKA 2ZRIA 3TRJA 3FB4A 1H73A 3UCUP 3C15A 4C4XA 4G07A 3I73A 1OGJA 1Q0ZA 2DT5A 2NZ2A 3EGDA 4EO9A 1NNSA 4ZLJA 4C4WA 3ONQA 4EPXA 4DC9A 4JI6J 1E3LA 3A70A 4MGZR 1A82A 2CNOA 3DP9A 2Q6TA 2D2IA 5L51A 1EVLA 3QW4B 4LWQA 1L5GB 1N2CA 1Y5LA 1RWNA 1Y82A 3PV8A 1YZNA 4DLPA 4HDAA 4TTQA 4NNJA 1CDEA 3RODA 3B9PA 2F90A 1BFKA 3SCLE 1I9CA 1DBVO 2ZBDA 4PUOA 2J8AA 2YMQA 4AIIA 3OZBA 1CHNA 5BMOA 4MDEA 2QLTA 4YTEA 3N6NA 1GZ6A 1E9DA 3R09A 1W88B 1RYRA 5KNBA 1U4SA 2WBMA 1Z4MA 1M0EA 4RLFA 2A10A 4FW8A 4AK9A 2DQSA 2ZK7A 5TQ2B 4B3HA 4H77A 5I5EA 4LFCF 3OY2A 1KQSR 3O74A 4OQFA 3BO3A 3OQIB 4C04A 3Q3VA 4IJVA 4UOHA 4QU9A 3LBHA 4UNSA 4HUQA 4IFVA 2L3MA 1LPPA 3AJEA 3MCOA 1O87A 1UMCA 1OIVA 1S9EA 4A8JA 3MI7X 1U3CA 4OQ4A 4FFWA 3CH7A 2PDAA 1PR4A 5FI1B 1PBUA 1XVIA 4KO4S 5TJHA 3TX8A 2A3NA 2XA9A 1RHKA 3T7IA 2J0QA 5KTKA 2NU9A 1UZDA 4GLFA 5ALQA 2VHZA 1H7WA 4AUEA 1SHLA 4MIEA 1APBA 4M21A 2I3AA 1Z0FA 2M4MA 1ABEA 5EIAA 2BW0A 1R8YA 1K2WA 3L4BA 1HFKA 2FQ1A 5FLXU 5TS2A 2FDRA 3PEFA 2X42A 3JYHA 3ZH9B 2JFVA 4UPDA 4U7WA 3RUHA 4QUKA 2YHIB 3GRFA 4TQUS 4QIWD 5F7ZA 2JX2A 1MU0A 2Q9BA 3D7RA 2IV7A 2P2NA 2JVKA 5LOQA 2P2YA 4K8OA 3D0RA 1EB0A 4FMCB 3PC4A 1CUZA 2XQIA 4XEUA 2I5PO 1VPDA 5FB3A 4N0PA 5EDWA 3WNZA 4C14A 2Y2UA 4A6DA 3PUHA 3H16A 1E7WA 2Y77A 4I55B 5IJXA 4L6AA 4UFOA 3ONNA 1NN0A 1TQLA 4KFBA 2CFSA 5DGTA 4ENQA 3A1TA 1LLFA 1RT6A 3VO8A 2ZNZA 4RSHA 3OJEA 3JALA 1GNQA 4DCPB 3GMGA 4Q0MA 3OM1A 2KB0A 4ESHA 3DBOB 3GCDA 2V0NA 1MT0A 3B1WA 1T1IA 5LQKA 5T7BA 4F06A 5JVDB 4WZ6A 5CT8A 4FUTA 4EK2A 3SZ2A 3QUAA 3ZI4A 4DYHA 3RJ5A 1CY8A 2DHAA 5IZHA 1KR2A 4MA5A 1M5KC 4IO0A 2FSHA 3VSDA 4BQRA 5D3KA 1C9NA 4HQOA 5K3EA 4CL2A 2O8FA 2DLDA 1NXXA 4LNUA 4XDDA 5HVGA 4QGFA 1WB5A 3WYBA 4NFLA 1HEIA 1CUAA 1EGVB 3A1UA 1Q1QA 1D1PA 2C5FA 3TZBA 4E8UA 3FVTA 2XCSB 1NOJA 2RAFA 2POCA 4Q6WA 3NPAA 3OIGA 3KQKA 3MK31 2DD8S 3OFND 2V5HG 1VPLA 2CQHA 4C9BA 4Q4AA 1U8EA 1E7RA 2ZM5A 4ZA2A 1RPTA 1SC4B 2R0QC 4M22A 1PJCA 5A8KA 1XAIA 4IIJF 1W2IA 3F2VA 1J90A 4W1SA 3NBFA 3ZV7A 4JLVA 1OWNA 4TXLA 2VOOA 2A5DA 1VL5A 4XB6B 1M2HA 1R8HA 1QGOA 3DXYA 3SLGA 3L02A 1RCTE 2DQZA 4MIKA 3M9MB 1Y6FA 2VRCA 1N36J 2IS2A 1P1HA 1OIWA 2AOVA 3KBOA 1HMVB 3R6LB 2IYFA 4M55A 5HP1A 3OP4A 4KE6A 1RACB 3NTQA 1EIZA 3WWDA 5FUWA 2UZ1A 2M1ZA 2PFDA 4HAXA 4DX6A 1B7YB 4N0MA 4G0NA 3RBZA 4K9DA 4V38A 4DZ6A 1HQYE 4QASA 3WMRA 2E1AA 1EWYA 4MS3B 4AZTA 4RLEA 4X20A 4D8UA 4OXKA 1RRKA 2VRCD 3O5AA 4ZCSA 2HA4A 3WSWA 2WF6A 2OXRA 5IKOA 2IW1A 4C4PA 1KVRA 5FEMA 1OFUX 1DY3A 4LKRA 1FFBA 4N8NA 4DG1A 1HBOA 2YUTA 3RBEA 1SQ6A 1P74A 2H92A 4YJGA 3L9WA 1T4BA 5B6IA 2AXEA 1E66A 3WVNA 1ZH8A 2BQRA 3IT3A 4AICA 4TT8A 5DYYA 3TYTA 1NLMA 3HFZB 1Z6YA 3LK6A 3NT5A 4JA0A 3AR4A 2BJHA 2CL5A 4CT9A 4AC9A 1N2CB 1F1BB 3HV0A 3WDMA 3WMXA 4F8YA 3LD9A 4K28A 4OQDA 1XCGB 3N2GB 2POKA 4XPZA 4TPKA 3N3BC 2HHAA 4DMZA 3ENWA 2QUKA 2XNJA 3M3HA 4F93B 4TKMA 3Q83A 2W8KA 4A8JC 1TTPB 2PRSA 3AK4A 1AFJA 3KS9A 4AF7A 1SJRA 2I8LA 3A3YA 1DV1A 4KLCA 4RHUA 4AB1A 4EELA 3V33A 4A0QA 2B82A 4AWXA 3ZHTA 5GINE 1Y6RA 2OCDA 4UCWA 3PW4A 1NKCA 3BMNA 4BLOA 1RQPA 4XCVA 3ONVA 4AN4A 1YZUA 3K16A 1B3BA 4V0NA 4FGWA 5B0BA 4PWWA 1HE5A 5HKBA 4NYZA 1IM4A 5IM5A 3ZHRA 1J5EB 1I01A 1O0CA 1B6GA 3IEUA 4JQOA 1E2EA 6CHYA 3LTOA 4U63A 1F0NA 5MF6A 2AE2A 3FEYB 4P3XA 4YXWD 2ZDGA 3P4UB 4KWEA 4QFDA 4Y2UA 2EFEB 3TRDA 1CQXA 5AFSA 3UJ6A 4D3SA 2HFVA 4DL2A 4DKXA 2VJAA 5DYWA 4Q4JB 3VV3A 5JSUA 4R0NA 4TUYF 1BN6A 3SJZA 1P5RA 2QSFA 2HIYA 4UXHA 3GJ0A 2A5JA 3RSQA 3IAM9 2X0EA 5KTOA 4WFNQ 3AVQA 3OVMA 4DV4J 1IEWA 1NBEB 4LDJA 2WV9A 5ALDA 3KJVB 5CYOA 4FDFA 3KCNA 3GSDA 2YNMA 3E9DA 4KQ2A 4RIEA 1P8GA 2OQIA 3OBIA 3IDZA 1A04A 4YPFA 3O4RA 4WTOA 1ZSNA 1D9FA 3BSSA 4LHXA 2NO9A 4G0OA 3NRJA 4F04B 1MVLA 3PUKA 2HXYA 3J81A 1I32A 5IKMA 2R4UA 3DKKA 4PZLA 5DI3B 3W1WA 4IH6A 3EQ7A 3RSHA 2I22A 4R54A 1C1CB 5EWJB 1QPZA 3AW8A 3H5RA 5HQ8A 1DC7A 4YJ2F 1SN7A 1L1EA 3VKUA 3DCIA 2CNNA 1W7WA 1WF0A 2OHOA 3FRYA 3TLZA 5BR1A 1O6FA 3KQVA 3OQBA 5EI5A 1TEXA 2UV8G 4MVJI 2F3RA 3MT8A 4GS5A 2VKZG 4EVIA 4HWPA 2ZFUA 3OP1A 5JBQA 3FB1A 3T1HB 1M1NA 2YWBA 1Q8IA 2KG1A 2ZJ5A 5C7IO 5CX1A 2XHWA 1E4EB 2HU5A 3P32A 1N92A 4KO1S 4EW1A 4LR7A 3AHEA 3Q8XB 3RC7A 4QKQA 1RYSA 1EM6A 3GA7A 2WSYB 4DMFA 3FPSA 3A12A 5CHCB 1YJ8A 2QUAA 4JI1F 1FVFA 3QWHA 1GA4A 3CEPB 3O84A 5AE2A 1GEEA 1P73A 3KU4A 1Q7BA 4GG1A 1PG2A 3SDBA 1S9HA 1FK9A 3OQHA 3WKDA 2Y6VA 2PM8A 3QRRA 1CPYA 4QNRA 2LXFA 4LFBF 4CM8B 5ENVA 3V2IA 5DH9A 4RU2A 4GKBA 1ZVVA 4TV9F 5HIJA 4IIFA 1SU7A 4DE5A 3FYUA 4Z2AA 2CQCA 1S77D 1PJQA 1F2GA 4ZI5A 1BW9B 3SF8B 2MZJA 3R7WB 4TYBA 3HX9A 3QWBA 5B2FA 1QVAA 1FDBA 2E5LB 4OLBA 2WONA 4PCUA 4BB5A 1HYSB 2ZH7A 3HYNA 4QRHA 1ENPA 4RXTA 1HF3A 1X7ZA 4PWDB 4I2VA 3EZGA 5A1TA 2HA3A 3ZQJA 4CO5A 3DBLA 2EFPA 4IDFA 1ZC3A 4B7AA 3R76A 5DM60 4CQLA 1OWPA 2MINA 4UDOA 3VU9B 3VVTA 1SA0A 4A4JA 3MYYA 4Q1AA 4JASB 1CVLA 2WM3A 4ZOLB 5DETA 2RJNA 3K1AB 1JLBA 4ED1A 4HLQB 2OCLA 2MR6A 2J0XA 3NHRA 4C1NA 4M8NE 3KT3A 1KY3A 2Z4TA 5ELXA 2Q4DA 5KVQA 1QRDA 2I99A 3W63A 3UO8B 1E2DA 2JLBA 5AR1A 3TAUA 1O5TA 3JQ7A 3THOA 5LMCA 4A0FA 4HLCA 4QTZA 4J2HA 4UQLA 2HY7A 1WDTA 1E0SA 3ZY2A 5JPIA 1BSVA 3H2VE 3I53A 4QRDA 1KZ6A 3HXOA 2DB3A 3KFWX 1RKIA 3U1NA 4POAA 4F9FA 2LPMA 5GMKa 2O8BB 1MRZA 1NI4B 4N7BA 5K8IA 4X94A 1S1VB 3FNFA 5HJEA 3L1HA 3MEEB 1EVYA 4CKBA 4A2QA 4BRWA 3EMDA 2ZIUB 3RG8A 2QX7A 1ZL0A 1VHDA 4ZV9A 2VUIB 4LZPA 2W2NA 5C8XA 3WYNA 1Q0SA 1U24A 1B73A 2VUHB 3E2IA 1O2DA 3REOA 2ATXA 3GLIB 1AUSL 3M1YA 3REQA 2X2EA 1I80A 4I1OA 1RQ0A 1YR6A 3QU9A 5B36A 5JJ5A 3QGMA 5ALUA 2JLQA 2AG8A 5FBVB 3CCRS 3MJRA 4OMCA 1CUEA 1GR1A 3DDWA 2FU5C 3U26A 5JZVA 5J58A 3QKRB 2AS0A 2JIZD 2XHCA 2JLVA 4NLQA 4U0JA 2KJVA 2W83A 3PFGA 4DKJA 1XF9A 1V4BA 1PW5A 4TTAA 2XNHA 4WUVA 3QF4B 3N9IA 3UN3A 5BPHA 3DXZA 1N2ZA 3GG9A 4PHHA 1Z45A 3CNOA 2GCOB 3KP1A 1M6VA 3AH6A 5ALXA 3VTKA 3O4VA 2ZSDA 1BX3A 4YCJA 2ONJA 5IN4A 2GZ1A 2NQ2C 4KO0B 5BNWA 1WY7A 2WWTA 4LXYA 2PEZA 3PXEA 1DCFA 1DIBA 2MJLA 1GCIA 3QVXA 3HEBA 1XZMA 1FU7A 2MZSA 2PUDA 1LWEB 3PDHA 4X97A 1QS0B 4KQKA 2QT7A 1JTEA 3BWYA 3EWNA 1A5BB 3IA7A 1LX6A 2XEDA 4RR5A 3GFBA 5IAGA 2R8YA 3LA8A 4AUKA 2ST1A 4MV1A 1NUPA 4Q18A 4IWNA 2YNIB 5ECYA 1AK9A 3MM6B 1EHWA 3E61A 4GZLA 3OTHA 1PHRA 1UMDA 4BV2A 4N5NA 4PXEA 3SS7X 2KBEA 1ULBA 1NXSA 4RQAA 4Z86A 2KI5A 4R31A 4EG4A 3NX4A 3Q0AA 2XNRA 3U48A 1CUSA 2HO5A 3CVOA 1IHOA 1EUDB 3X2FA 1S49A 3DRSA 2Y1IA 3A3OA 3KVNA 4MW5A 2HD4A 1AGNA 3DDOA 4Z6KA 1BKSB 4RO0A 1YI1A 4RZQA 4ZAWA 1GTJ1 3KQQA 2WFLB 3S8SA 4KH0A 3QLUA 4DL7A 1E0AA 1PGNA 1TQ2A 1EVIA 1MNAA 1GGMA 1FKOB 4KV9A 3MJ4A 4DMRA 2MKJA 3WKCA 3JATA 3WOVA 2KQUA 3ME5A 4MHOA 1XMOB 3E2MA 2OD9A 1DAIA 3ET5A 1PFGA 1PT6A 3OPYA 3QT5A 5KVCA 3OIYA 3CGWA 1EUYA 1ODSA 3F5FA 2P3SA 4G37A 1AHIA 3HFRA 4UJ3A 5ALYA 5EKTA 1O94C 2ZJBA 4FHDA 4FFDA 1OX4A 2BE9A 1G3OA 2HAIA 5E7IA 1CZOA 4MV3A 3TVZA 3BEGB 4HF7A 4NEZA 4ZT4A 4FC7A 4Q1BA 3NT4A 5B3LA 2EGHA 2UYCA 3TZKA 4YB7A 1OTHA 2FF7A 1RYFA 1C0PA 3AUUA 2GVZC 1EE1A 4HQ6A 2RD2A 1R9JA 4HV4A 5KTYA 3BF8A 1S72S 4Q9HA 4LMPA 3RUCA 2YY7A 1S5ZA 3R4CA 1OO0B 2IDJA 1JLQA 2PZFA 1JLEA 1EHYA 4ER8A 1RTJB 4GKKF 1CEXA 4AMYA 1BDJA 3SAJA 4CNBA 1C1DA 1I1HA 1U7ZA 2HFKA 3L5OA 4O2LA 5IDWA 4RA6B 3ZN2A 1ZBQA 5JMNA 3ZDBA 1Y5NB 3NP9A 4ILMA 1U8FO 2P30A 3GUCA 2VB6A 1YBUA 4R68A 1QTMA 5CU7A 2ACWA 4KPFC 3LUYA 3EXAA 4EI2A 5HQ3A 3ZGVA 3LF2A 2F48A 2Q1LA 5HKLA 5E3IA 2C94A 2Y4OA 3CCFA 3NAZA 3OUYA 4DL5A 2FPGB 3F6EX 2P2DA 1BWSA 3Q0IA 3BPSA 1P9NA 4O4IA 2N3ZA 5G0WA 1WVMA 5DWVA 1VL2A 3R7BB 3A0RB 2ZVSA 4YASA 4IR9A 3R6TA 3T7JA 2E1MC 2JGIA 2QUZA 4JX8A 5CPBA 3QMQA 1NXTA 3C6UA 4IG3A 2Y3IA 2IPXA 4HI2A 5BSHA 1NONA 3OFVA 4QDUA 2VP2A 4DDMA 2CJWB 4RV5A 5CNKA 4WJZA 4DUZJ 2JFOA 4YYZA 3ZD9A 1H2TZ 4K7JA 2GR9A 2ZH3A 4PRFA 4QWAA 2FJUA 4FZRA 3JQCA 1BMTA 3H5YA 1S99A 3W1YC 2OENG 4UVGA 2PU7A 4UZEA 3EZXA 1UL3A 1JIKA 1XXHA 2ALJA 3DH0A 2CUNA 2LW7A 3DSRA 2JFZA 3EOZA 2A92A 5FI5A 1F9HA 4B81A 4QUGA 4R1LA 4LX0A 5AI5A 4AQYB 1NDLA 2BOVA 3MTEA 1AE1A 4I8IA 1IOVA 1M1YB 1KI6A 3MEDB 2DY0A