4AUKA

Crystal structure of c2498 2'-o-ribose methyltransferase rlmm from escherichia coli
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
357
structure length
355
Chain Sequence
MNKVVLLCRPGFEKECAAEITDKAGQREIFGFARVKENAGYVIYECYQPDDGDKLIRELPFSSLIFARQWFVVGELLQHLPPEDRITPIVGMLQGVVEKGGELRVEVADTNESKELLKFCRKFTVPLRAALRDAGVLANYETPKRPVVHVFFIAPGCYTGYSYSNNNSPFYMGIPRLKFPADAPSRSTLKLEEAFHVFIPADEWDERLANGMWAVDLGAPGGWTYQLVKRNMWVYSVDNGPMAQSLMDTGQVTWLREDGFKFRPTRSNISWMVCDMVEKPAKVAALMAQWLVNGWCRETIFNLKLPMKKRYEEVSHNLAYIQAQLDEHGINAQIQARQLYHDREEVTVHVRRIWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Rlmm, the 2'O-Ribose Methyltransferase for C2498 of Escherichia Coli 23S Rrna.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords RIBOSOMAL RNA LARGE SUBUNIT METHYLTRANSFERASE M
total genus 118
structure length 355
sequence length 357
chains with identical sequence B
ec nomenclature ec 2.1.1.186: 23S rRNA (cytidine(2498)-2'-O)-methyltransferase.
pdb deposition date 2012-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01728 FtsJ FtsJ-like methyltransferase
A PF18125 RlmM_FDX RlmM ferredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2810 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4aukA01
3.30.2300.20 Alpha Beta 2-Layer Sandwich THUMP fold THUMP fold 4aukA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4aukA03
1AQIA 1RI4A 2R6ZA 5EG5A 3EVBA 4BP3A 2FPOA 1I9GA 5DWQA 5ERGB 2GH1A 5EMKA 3G2OA 2IDJA 1RI5A 3R3HA 4X60A 5EKXA 3OZSA 3G5LA 3TPZA 2PKWA 2FK8A 3IYLW 2H11A 4QTTB 4XUCA 3DUWA 3UJBA 4E2XA 1HMYA 4JXJA 3E05A 3I9FA 5ICGA 1BC5A 3PFGA 5CIYA 5HIKA 5KQRA 1PRYA 4PNEA 3JWIA 3EVAA 3R24A 5DPMA 2PY6A 3C3PA 3HCCA 3HCEA 2GLUA 1L9KA 1VE3A 4PYMA 5DM4A 5HFJA 5T64A 3SSMA 1H1DA 2BH2A 5CVJA 1G8AA 1P1BA 1X1BA 3BGDA 5HEKA 3NTVA 4PCAA 4CKBA 4GBED 3VSEA 4G56A 3JWJA 3H2BA 4RVDA 2EFJA 2QRVA 4M7RA 5EIWA 1JSZA 4DMGA 3EVGA 3HVIA 3KQMA 5GOZA 4RTPA 2AR0A 3BWYA 4C07A 2IH5A 3P2KA 4FSXA 4FT2A 4RX1A 4RTMA 2UYHA 3DXXA 4BP1A 4C03A 4FZVA 2NP7A 2LD4A 5B1SA 3UJ8A 5DXAA 2PX4A 3SVZA 3EPPA 3EVFA 1SUSA 2ZZKA 3KQQA 4OQDA 1G55A 1O54A 2XVMA 3DXYA 4M38A 5EGSA 3R6TA 1XVAA 4B17A 1IXKA 4KDRA 4PGGA 3EEYA 1BKYA 1EAMA 2PBFA 2O0LA 4DZRA 3EGVA 4F85A 1I4WA 2ZULA 3I58A 5FQNA 4PONA 5FA5A 3U81A 1XDSA 5EEGA 1D2GA 3B7PA 3OU7A 4AZSA 3GRZA 1YUBA 1JQ3A 2PWPA 2H1RA 4EK9A 3ANXA 3EMDA 1DL5A 3FTFA 1FPQA 5E8JA 2AN5A 5FTWA 5K0BA 2Z6QA 5CVVA 3FTCA 1M6YA 3TM5A 4KVZA 5K0FA 1BOOA 3GNLA 3SSOA 5C9ZA 4DCGA 3I5UA 4XCXA 5JR3A 1SKMA 4IWNA 3OCJA 2ZWVA 2YXDA 5EMLA 4QVGA 3DMFA 5FHQA 1JG4A 2EG5A 2QM3A 2P1DA 4MTLA 2BZGA 5CCXA 5HIJA 3GWZA 3DTNA 4R6WA 3HVJA 2P3LA 3KPWA 3P9NA 4YMGA 3LKZA 2EJTA 2OB2A 4PYQA 4RV9A 2ZWAA 5EPEA 3FPEA 1G60A 3E23A 5ICFA 2AVNA 4RVHA 3LDFA 3RW9A 5HZMA 5DRTA 3FUWA 3T7RA 4A6EA 3HCAA 2NXCA 1JG1A 2OBFA 4PYIA 2ZLBA 3EMBA 2ADMA 1P39A 4AX8A 3TRKA 3BKWA 4KW7A 1YB2A 2G70A 1R8YA 2PT9A 3KKZA 2I7CA 1Y8CA 3B3JA 2AN3A 2JHPA 2PXXA 3OFJA 3KQOA 5DX0A 4F84A 2C7OA 4A6DA 4QPPA 1D2CA 2I6GA 3HNRA 4AZVA 1QAOA 4ER3A 5DM0A 2K4MA 3SGLA 4YUYA 3SR4A 3GGDA 4K6MA 3SX0A 4RYLA 3KQVA 1NBHA 4M37A 3ELWA 2CWWA 3LCUA 5H02A 3Q7EA 2XVAA 1ZG3A 3MTEA 2G72A 4CWAA 1KPIA 2YXLA 5EC8A 5F2OA 2C7RA 4ER6A 4PWYA 3R0QA 1SQFA 1JSXA 1WY7A 5GM1A 1R6AA 3B89A 3IEIA 4P7FA 4AUKA 3TKYA 4X61A 5EOVA 5K0CA 3KPJA 2OYRA 1QANA 1P91A 5FADA 4CTJA 4DQ0A 4XUEA 2AOVA 4C08A 1JTEA 2ESRA 4PINA 3HCBA 2FHPA 3B5IA 3CGGA 3GIWA 3E7PA 1RJDA 1ZGAA 3TKAA 2WA2A 2WK1A 1NW8A 1EJ0A 1RJFA 1OR8A 3DOUA 5GIPE 2ZFUA 1X1AA 4GEKA 3NDJA 3C6MA 2EX4A 3G5TA 4R8RA 4E30A 2UYOA 4EMSA 2VP3A 3PT9A 4EVIA 4HGYA 3VC2A 2P8JA 3FPGA 2JJQA 5CVDA 1WXXA 2WA1A 2YQZA 3HCFA 4QDKA 3BT7A 3ME5A 2O57A 1N7JA 5F2KA 3UJDA 1IY9A 2JHAA 2N47A 4OBXA 4WXHA 3MTIA 1VP3A 2CMGA 5GWXA 1SG9A 3EVEA 2UYQA 3P9KA 2UYCA 3K6RA 4GUAA 4P7GA 2IIPA 1BHJA 3GCZA 3OU2A 5CVEA 4C04A 1ORHA 4HC4A 5EKUA 3DMGA 5EVJA 3AXTA 1RJGA 5DX8A 4RVFA 1RI2A 3HVHA 4U7TB 3FTEA 5ICEA 3QOWA 2ZW9A 3PS9A 3GJYA 3FTDA 1QAMA 3REOA 5HIMA 5BW4A 2P3QA 4M36A 4IKPA 1TW3A 2XYQA 1B42A 1QYRA 4KDCA 4YUXA 4HTFA 4P7KA 1EIZA 3V8VA 5LR6A 1HNNA 2OO3A 2YUIA 3LDGA 3T0IA 2BM8A 3EGIA 3M4XA 3NW9A 3TLJA 4YUVA 4GF5A 5F2NA 5KS2A 4MWZA 5CCBA 3P97A 1DUSA 3SSNA 2IBTA 2ZZMA 3A7DA 4LWOA 4R6XA 2G1PA 3DR5A 3G89A 2ONYA 2BR5A 1N7IA 1IM8A 4ER5A 1YF3A 2HWKA 3FUVA 4RVGA 2OZVA 2AOWA 4U7PB 1ZGJA 3OE5A 2YTZA 1V39A 3UFBA 2ZIGA 3TM4A 3ELDA 3ELUA 2AOXA 3HVKA 4BY9E 2BM9A 4CXMA 3GDHA 3OE4A 4HSGA 3THRA 1R00A 2HNKA 3JWHA 3MCZA 3HA5A 3G2MA 4MQ4A 1KPGA 2YR0A 4RTOA 4KIFA 4RWZA 4AZTA 2P7HA 1XCJA 2KW5A 3BWCA 2JG3A 5D1NA 2O05A 1P1CA 2HV9A 2GB4A 3CBGA 3KR0A 4OX9Y 3KQSA 3ORHA 4GC9A 1XDUA 3CVOA 5LQNA 3FYCA 1F3LA 2HMYB 4R05A 3S68A 2GPYA 1XDZA 2JH9A 2ZBPA 3G88A 1XJ5A 2O06A 5E9QA 5K8VA 1Q0TA 3DLCA 2Y1XA 2VDWA 2ZTHA 3P2EA 1R74A 3O4FA 5GP1A 3FPJA 3GRUA 5FA8A 1DCTA 2OKCA 3PFHA 4CKCA 1UIRA 2ZZNA 2YX1A 2Y1WA 1X19A 3P9IA 1VBFA 1YZ3A 2AN4A 4OQEA 2ZCJA 3LX6A 3P8ZA 3UJAA 4WVLA 1JR4A 3RODA 4HRAA 3UA3A 4YV1A 2AS0A 5E9JA 3OU6A 4AZWA 4MIKA 1KXZA 2C7QA 2IGTA 3MERA 4GOLD 3SM3A 5DTQA 3TR6A 3EGEA 3KQTA 3HP7A 3LBFA 4HGZA 4RTQA 4CKEA 4V0RA 1U2ZA 1ZQ9A 7MHTA 1TW2A 4PIMA 3GXOA 3CJTA 4EKIA 1Z3CA 5HIIA 3CKKA 3MGGA 4O29A 2ZIFA 1X1CA 2C7PA 4PCLA 3CJQA 3M33A 5GIOE 1VL5A 3LDUA 3T7SA 3VYWA 3UBTA 3KHKA 3M6UA 3AY0A 2VDUE 3CCFA 2P40A 4DM3A 3GRYA 3THSA 4RTLA 4RTKA 4ISCA 5FULA 3HEMA 3UJCA 1G6Q1 3FUTA 3KQYA 1NW5A 3LGAA 2NYUA 2V74B 4FR0A 3X0DA 1ZHFA 1PJZA 2DPMA 3HA7A 4X1OA 2G8NA 2VZ9A 1R18A 3M6XA 3Q87B 5LQCA 2HTEA 3BKXA 2B25A 4RTRA 5IH3A 4GOOD 9MHTA 4PYLA 3O7WA 5CM2Z 1AQJA 2PXCA 3OFKA 1NW7A 5LQJA 5LQRA 3AJDA 1SQGA 2AOTB 2B3TA 2PX5A 2XYRA 3EVDA 4E32A 1WZNA 4DA4A 5G02A 4MHTA 3I64A 1Q0SA 5DM1A 5E8RA 1YFJA 5EIFA 2P3OA 5FWDA 3KR1A 1X1DA 1WS6A 2A14A 4BLWA 1INLA 5EHIA 1NW6A 3WSTA 3BWMA 3FRIA 3FUXA 2PGXA 5K0LA 5K03A 3UWPA 3G8AA 1N2XA 1XXLA 3LCCA 2PSSA 4L7VA 2XYVA 3DH0A 4FP9A 4XUDA 4EKGA 4PYOA 3HTXA 2I9KA 5K09A 3ELYA 3AWIA 3C6KA 2F8LA 4NECA 1NV8A 5JUWA 4DKJA 1JG2A 4Y2HA 2NXJA 2HR1A 3GU3A 1MJFA 1ORIA 3EVCA 1T43A 2QRVB 3PVCA 2ZIEA 4DF3A 2AOTA 5GINE 5K0JA 3G2QA 2VS1A 3NWEA 4QVKA 2OXTA 2OPBA 3FYDA 5P8WA 2VDVE 2B9EA 5K0EA 5KYGA 2IH2A 3A25A 1O9GA 3T7TA 3TOSA 2IDKA 4E70A 5EEHA 4LWPA 3BWBA 5EQJB 1ZKDA 2FCAA 3UJ9A 2H00A 5CUQA 1JG3A 2P41A 3F4KA 1KIAA 4BLVA 4DCMA 1L3CA 4FT4A 2PWYA 5EZQA 1NE2A 3B3GA 2O07A 1FJXA 2GS9A 5M5BA 3MQ2A 5EMJA 3L8DA 5D1HA 3CC8A 4KWCA 4PYJA 2PLWA 4HH4A 4ER0A 5ICCA 3CJRA 4OA8A 4E33A 3B3FA 4ER7A 1UWVA 2P35A 3EEOA 3E8SA 5GM2A 3DXZA 2YXEA 1KPHA 1RJEA 3G2PA 4LECA 3AXSA 3KR9A 5DM2A 1EJ6A 3A7EA 1L3BA 2AZTA 1VP9A 2ONZA 1KP9A 3BUSA 3FPFA 3SXJA 2GAFA 3HCDA 2QY6A 2I62A 1JQDA 2EJUA 4OBWA 2Z6AA 2IPXA 4FGZA 4GOMD 1G8SA 1NT2A 3HM2A 4HTFB 4RSRA 5DSTA 2AVDA 3M70A 2ZBRA 2FRXA 3UA4A 5IKMA 3NMUF 2NP6A 3G8BA 5DX1A 5EHGA 5DSXA 2R3SA 4GC5A 2BR4A 1NW3A 4HG2A 8MHTA 3FPHA 4IV8A 1VLMA 5FWAA 1TPYA 5K0NA 2NXEA 5U4XA 4YUZA 4YUWA 1XCLA 2PJDA 4QTUB 1XTPA 4LG1A 5FCDA 5BXYA 4PYKA 3BGIA 3MCTA 4PGHA 3PTAA 4ATNA 4RTSA 4C06A 3C3YA 3R9XB 2JH8A 3LBYA 1KYZA 3LSTA 3P71T 3OZRA 1NBIA 3LHDA 4E31A 1EG2A 1EQAA 3QV2A 3MB5A 3KU1A 3BZBA 2IBSA 2IH4A 5KQSA 4PYNA 5BW5A 2YVLA 2ERCA 4ZTBA 2ORED 1G38A 4RTJA 1QAQA 1I1NA 5DXJA 3NVMB 3FRHA 5E1BA 1QZZA 5C0OE 3A4TA 2QE6A 3UJ7A 5K01A 2E5WA 2OY0A 2FK7A 3KR2A 2FYTA 2PV0A 5EZSA 3ID6C 5E2BA 3P2IA 1AF7A 1YFLA 4E2ZA 5LQUA 3EVZA 5DRYA 3ER9A 3M6VA 2G71A 3NDIA 5E1OA 3ERCA 2IFTA 3LECA 4YV0A 4QQKA 4X41A 3GRVA 5K0GA 1KHHA 3RIEA 4FS8A 3SMQA 4YV2A 5K05A 5LSAA 1NKVA 3BXOA 1SVUA 1FP1D 3TMAA 3IV6A 2P7IA 1RI1A 2QYOA 5E9WA 2Z6UA 4QPNA 1MHTA 3PX3A 5BP7A 5FUBA 1AV6A 3LKDA 1FBNA 4UOEA 5FQOA 5C1IA 1NV9A 1VPTA 1VIDA 10MHA 2V7EA 2B78A 4OA5A 5DTRA 2CL5A 5E1DA 3PB3A 4C4AA 3PX2A 3HA3A 1O9HA 2NXNA 2OB1A 4H0NA 3TFWA 4BLUA 3JWGA 1SUIA 5E2AA 3NVKI 4IV0A 2BR3A 4C05A 3GO4A 3BGVA 3ER8A 1L3IA 5EMMA 3LPMA 1M0EA 3KQWA 3V97A 3FZGA 5FHRA 3I53A 3DULA 2UZ4A 4PIPA 5T6BA 3NJRA 3LCVB 3VC1A 5CD1A 3TQSA 1YZHA 4F86A 2CKDA 5HILA 5LQKA 2ZVJA 2CMHA 4P58A 3UZUA 5MHTA 4KRGA 2AOUB 3KPYA 4GOND 1WG8A 2PXAA 2PX2A 2B2CA 1L1EA 4RTNA 2DULA 2JHCA 2ZSUA 4GQBA 2XBMA 1WXWA 3K0BA 1RI3A 3O31A 3LL7A 3FUUA 2PVCA 1D2HA 2PT6A 3A27A 4X63A 3PLAE 5DTMA 4Y30A 3MHTA 3G7UA 3OPNA 4P7JA 4CTKA 1JQEA 3IHTA 3P9CA 3QOXA 4POOA 3DMHA 3D2LA 4FSDA 1M6EX 4E2WA 3DP7A 4Z2YA 1KYWA 2Q41A 3A26A 5HOQA 4E2YA 4KIGA 3DLIA 5CVUA 5T67A 1JTFA 3OZTA 1KR5A 4EQZA 3GRRA 3C0KA 3UJ6A 5KVAA 4QQNA 4QDJA 3KPUA 4V0QA 2PX8A 2ZBQA 4YMHA 1R8XA 2AOUA 2NNWB 3KPVA 1VQ1A 4R8SA 5E1MA 3KQPA 3NWBA 2IP2A 5LQAA 2GA9A 5DT2A 1FP2A 5DLYA 1UFKA 1F38A 3M6WA 3MAGA
chains in the Genus database with same CATH superfamily
5FB3A 5DWQA 2GH1A 1MVLA 4TY8A 1T34A 1T29A 1PJQA 2OQVA 3VC3A 3ETOA 4GOXA 4HT7A 3CMAS 4M1ZA 2HREA 4UOGA 5HFJA 1A9TA 3TNYA 4CBVA 1XBWA 2D13A 2RNEA 1ZN8A 1J8YF 4DMKA 2PIAA 3TD9A 3HJRA 1W76A 3RC8A 3AA9A 1HNWJ 4XPIB 3EODA 1ST3A 4RPIA 2VJYA 5H7XA 4O2AF 1ZI8A 4Y65A 1G2OA 4AJ9A 4UTGA 3WAGA 4CQLA 3ROPA 1HNWF 1DL5A 3BRQA 1BE1A 1D4AA 2HWXA 4IQ8A 2HQOA 5DW0A 5BQ3A 4TKVA 2BJ8A 3L8HA 5B6IA 4IGIA 1Y7TA 4B6EA 5EZYA 1EWKA 2G70A 3EDQA 1NSPA 2B5JA 4W8HA 4QU0A 3PR5B 3QUAA 3MT9A 3F4LA 2DIVA 3EC7A 2Z4PA 4GPBA 3QWBA 1XPRA 2WVCA 2P0EA 4JUDX 2FG6C 3I56S 3W3AD 4EBFA 4D3ZA 4W7SA 3JTMA 3AWDA 1UP4A 4PINA 1VGVA 4OY3A 4H1UA 2HQBA 3N79A 1H5NA 1N2BA 2J3MA 3JQRA 5BT9A 4RW4B 1CP2A 3KAKA 1B43A 4RMIA 4NMXB 2XUGA 4XO0A 2EK6A 4IHJB 1RIIA 3DWFA 2YW9A 4NBRA 1N5KA 1FFEA 1I14A 4F6RA 2P3QA 5DYWA 1IEQA 2VRWA 2CFSA 2CPYA 4YUVA 3E5MA 3P97A 2FJPA 1WDKA 4NCGB 3DAHA 5L40A 1C2YA 4LC1A 3PXUA 4EUKA 4MQ4A 4RTOA 2WOJA 2CLSA 2FUKA 4LHSA 5K8VA 3TI0A 1MJ5A 3HB7A 4R8LA 5A3SA 3KHGA 1ZM7A 1DEXA 1ODSA 1J22A 4LAFA 2WWIA 5H8WA 5JJKA 3R9IA 2HFZA 4FD3A 3K94A 4WDQA 4HGZA 3ZZUA 2DHRA 2WC1A 3OWHA 5BQFA 3ZTTA 2DBBA 4L2IA 3FOEC 2VDNB 2ZIFA 3A1WA 2VHTA 3IIEA 3VR3D 4DIKA 3OKAA 4BNIA 1VHTA 3SBDA 4HUTA 7AT1A 3B54A 5A8RB 4XQGA 1PJZA 3DWGA 1NUSA 4DR1B 3DEIA 4CM3A 2DLDA 1GMWA 2R00A 1XLTA 3HCWA 3C14C 4Y1RA 3EVOA 3MAAA 3KLOA 4CH0S 3PSHA 4KYTA 2X1AA 4EPTA 3I9ZA 3D8SA 4OXYA 5DBIA 4XUDA 5I8ZA 4JI5F 1US8B 4N47A 4WPGA 1VHJA 3H9EO 1ORRA 1SA0B 1M34E 1EB0A 8LDHA 2JAQA 3COJA 2C4TA 3U4CA 1ZMXA 3QUCA 4PAWA 1L6IA 2EZTA 4YR3A 1RLMA 4BDPA 4U6QA 5EZQA 1SJ9A 3IE2A 3VOSA 3GCXP 4D9NA 5D3KA 2XY5A 3DLGA 3LD9A 1WF2A 1AKWA 2CVPA 3H0KA 4JB2A 2UUBJ 3H3FA 4DY6A 4M0EA 3DSRA 1KP9A 1KYTA 2A0KA 1E9RA 1KMMA 1OLSB 4RADA 2CXUA 2FZGB 5K99A 4C4RA 4L02A 2ZE2B 5KVVA 3JVVA 2IZ5A 1VCNA 3K5MA 5FWAA 2YJ4A 4YUWA 2RAUA 3QEMA 1XK7A 2ZSBA 2H9IA 4KR9A 4NBNA 4CM8B 3ZHSA 3HP6A 3GCWP 2EG9A 2FSSA 2R47A 3OM0A 5A4MS 1U8CB 5CPFA 3PJXA 3T6BA 3EFOB 3TAPA 1QYCA 2JDIA 2L41A 1S48A 4F2DA 1D03A 1IJBA 1GYQA 1GLVA 3DMYA 4HEQA 1AV6A 1U1QA 1KK3A 1TVRA 3M3HA 3IFEA 4NYIQ 2UXBF 2J3KA 1GN9A 4H0NA 4D80A 5F41A 4HL9A 2LDIA 1RYEA 5FJJA 1M9NA 4WERA 1IN4A 1KVQA 4QUIA 2H08A 4XFJA 2I1QA 2ZH9A 5EERA 3U17A 3LX5A 1L1EA 4WGFA 4X1YA 3DXBA 4BJ5A 3GYNA 1ZCJA 4HTIA 1RAGA 3C1OA 4LGMA 4LRBA 3X1LB 1R8HA 1QO0D 4I2VA 4RZRA 3UDCA 4B2LA 3TQQA 3MD1A 4JI0F 4FCTA 3KVVA 1JLRA 5J63A 3V81B 5JCJD 3L7IA 3RIMA 1YONA 3BH0A 4Q9KA 1KVKA 4EI8A 1YULA 1T8TA 5HTKA 2ATVA 4M4SA 3EAQA 3ZZZA 3R24A 3WBFA 5B55A 4DA9A 1MMLA 5KFAA 4IMJB 2IEGA 1ZAVA 3S0JA 1PJRA 4TLQA 5EWEA 1HNZB 3KKLA 1HT2E 1BCRB 3R6TA 1XJQA 3NALA 2ZIXB 1EAMA 1S3FA 5KKAA 5ISMA 4YI3A 4C4ZA 5E3QA 4UHEA 3DM2A 3UWMA 5CFRA 1TKAA 3IA2A 1Y3FE 1U2RA 3I0SA 1D2NA 4QIVA 4GPZA 5C9ZA 2H5IA 2WP8J 4JR2A 4HZUA 3LY5A 3AY3A 1O97C 3FROA 4A8KA 1S1MA 4HDGA 1LDNA 4GXQA 4DQUA 1X9HA 4KC5A 2PSFA 2ZH4A 3OSZA 1S6YA 4O02B 2VBYA 3V42A 2FDRA 4QFBA 1FDRA 3NS6A 3KEOA 1G9SA 1EEXB 2GN1A 5IWCA 1X9IA 2VHUA 5I45A 4DL7A 2ZH1A 4HQLA 5B0GA 3MM7A 1ZN9A 3PNVA 5KNDH 4AW9A 4E5VA 1MRZA 3P4XA 1SBNE 2WLSA 5HFAA 2YASA 3HSDA 4V0ME 4R8RA 2NR0A 3W2IA 3HCFA 4JITA 4Y9RA 3VVLA 3DLBA 3R7NB 2N47A 2CMGA 3BFVA 1XQWA 2XWPA 1KLNA 5IAAA 3OU2A 3KJVA 4M0DA 4YOEA 4HNQA 3L3BA 3REOA 3RTGA 1KNZA 4XWKA 3QU9A 2ALJA 3H87A 4J16C 2AKWB 1L7PA 3LHFA 4HEJA 4X44A 1GPUA 6REQA 4LHYA 5AM3A 1ENZA 1GR0A 4DR6B 1CJUA 2OBNA 4QUEA 3WQPA 3KLNA 4IH9A 2VPZB 2Q3PA 3JASB 4RVCA 4YJ3F 3T7AA 1YZ6A 2ZSJA 1G2PA 1XX6A 2YWFA 4L08A 1TT5B 1YZ3A 3PTWA 2DR8A 4C6TA 2HQGA 4WVLA 4YV1A 5NULA 3RIXA 5K0SA 4GX2A 2HRDA 4BPBA 1U2ZA 4OK5A 3SBOA 2C7PA 3DF7A 2BQRA 4RDXA 1F1BB 1EVJA 3INGA 3RS7A 2WZDA 4ZDKA 3IKTA 4Z4QA 2AWZA 1X5TA 4USIA 1PCXA 5KFRA 2HM7A 3DDOA 4NRTA 4TTQA 2YFYA 2FSPA 4LFCB 2K1RA 1DRUA 1XMBA 3CNQS 3WZLA 2C5FA 2WUGA 3MS2A 2FPIB 4FYYB 1XF1A 5B08A 4WUTA 1UJNA 2BACA 3T5PA 3CLSC 2FJDB 3CUEF 2VDVE 4YT8A 3DOJA 3QUBA 1AC5A 1S5PA 4L6CA 1NP7A 1QK5A 1DRZA 4BTVA 1SBZA 4UD2A 1W85A 5KFDA 4LF8J 1WIWA 3M8SA 1FXWA 2VLBA 3VJKA 3TZYA 3FSGD 4LECA 1VLVA 4G1FA 3U7GA 3ANMA 1E7WA 4DJAA 3UCZP 4IIBA 4L22A 4LDAA 3C48A 2E87A 2B4VA 3COPA 4H4OB 4F3NA 2VJPA 2DH5A 1VRUB 1JMTA 3C6TB 1NSKL 2VP5A 2V3CC 1CLEA 5E0KB 1TUGB 1SKWA 3O4VA 4IIHA 4D42A 5DRYA 4PY2A 3U4QB 1JHXA 1OASA 2WG2A 4P2SA 4XX1A 4DCTA 1AMOA 1G18A 2H92A 2ZOGA 4EUEA 4C7OA 4BVKA 4K46A 1JNYA 1TADA 2EBGA 4Z1OA 4PEVA 2R7XA 4FLFA 2OCDA 2OCPA 2DZDA 3L01A 2ZJ1A 3UTDA 3DO6A 1OLXB 1WV1A 4HDSB 4KGMA 4CO0A 1DAXA 1OTYA 1WBJB 3KE8A 1EX1A 4NH0A 3MVEA 2K6GA 5D2CA 5FL7A 4ND8A 4U7JA 4DV5B 2JA1A 3HKBA 3BIOA 5KNBA 5FIIA 4B9NA 4C20A 3OZ7A 4M9SA 1JTFA 1FWPA 3F8SA 2R86A 4NJOA 1N0WA 3F74A 1I1OA 2XB2A 3WYCA 2IS4A 1Z15A 4B3FX 5E1MA 3DE6X 4DS5A 4IFTA 2KLBA 4GNRA 1EHYA 1CIJA 1FWLA 1T9GR 5F2EA 5ALTA 3SZOA 4QXPA 5KT6A 4TQUS 2O3JA 4GP9A 3G59A 4QBFA 4MO2A 4O2AB 3TSWA 2RHGB 2OK8A 2E5LB 1SVIA 3VQTA 1NKEA 4KPEC 2CF5A 5TEWA 3BBFA 3DE1X 4MDYA 1T6YA 5A8WB 2YVAA 1LW7A 4CP5A 5F8JA 1CQIA 1IUNA 1TB4A 1H38A 4QSMA 3UVJA 3X1MA 3DOKA 3DO8A 4Q02A 1WHWA 3ONFA 1S1VA 1T95A 4IJ5A 1ZESA 4F92B 1RYHA 1SZDA 2I6FA 2NAFA 2KYXA 3ZEAA 3R41A 1PNQA 5GVSA 2VHZA 2JI6A 2D3O1 2WM9B 4OI1A 3TMYA 3BK7A 4C7JA 3VV2A 3SVTA 3KC2A 5E38A 4I0WB 4RNCA 3FUWA 2YCLA 3Q8QB 1DQRA 1EP1B 4IQGA 1K5GA 5REQA 1TKBA 2XB9A 5I3UB 2X0IA 1MW9X 4OJYA 1K06A 2REQA 1WOYA 2YWHA 621PA 4Z3KA 5FJ4A 3I6BA 2I66A 4GVBB 4W8GA 2O59A 5E6UB 3RVPA 2VWGA 1WUTA 3WSWA 1YX2A 3KKFA 3A3OA 2D1SA 4G8DA 1X1SA 4KUEA 2QJOA 2WHPB 3TFOA 4QBHA 4DCOA 4LSMA 3CFYA 2OUGA 2OV4A 1OBFO 4WFAQ 1OY1A 2ZYWX 2QORA 2AH5A 2H1IA 3U4DA 1VGYA 3H5OA 3EWNA 4ZYLA 1TUEA 2HSWA 4DSUA 1B42A 2RGAA 2HC9A 2BM8A 3T0IA 4CKBB 1L3SA 5F98A 3CKMA 3MMBA 1N7IA 3LSYA 2VD3A 5C42A 4QVIA 1KZ4A 1YRUA 1OZFA 2NTYC 3H6KA 3FFWA 1M83A 1I7QB 5JCOC 3ZTRA 1Q1GA 4P5PA 4HUQB 1N5LA 3T4UA 3FPJA 4MHSA 2ZZNA 4S12A 3ND9A 1E32A 2O5DA 1O0BA 2HLUA 4LBVA 3HJAA 4RTQA 2UVQA 4BTEA 3K6SB 3F1LA 4B87A 4GP6A 4EFAC 1KS9A 1VISA 1ZGBA 1WABA 1ZHFA 4DJFC 3DRXA 2A86A 2IZ1A 1TVCA 1JDPA 3G6YA 2WOMA 1MB2A 2PXCA 5EJEA 3P2OA 1BC6A 4NASA 4YRRA 3PJGA 1PZNA 3GFOA 1XERA 1F14A 1S8NA 1MEEA 1U4BA 5EUMA 3G8TA 1BJRE 1N2XA 3BMCA 1Y9EA 2P67A 5BV8A 2WV9A 3MIZA 3Q3JB 1KDZA 3HJGA 5DM6Q 3PVCA 4WL0A 3NC1C 1RXWA 3LOUA 2W8KA 3VDXA 1QOPB 2WSEC 2FPLA 4RK1A 1FJ7A 3TH5A 4Y0NA 2VDRB 4EZBA 5EFZA 4YAWA 1SR8A 4LSZB 3K92A 2YZMA 5IAOA 3ABSB 2XQFA 4YP7A 1ECLA 2GNAA 2EERA 3F2VA 1E2IA 2DNYA 4CIYA 5ALRA 3SKXA 2ZG6A 3U19A 2ZYIA 4GOMD 4XIUA 3EY9A 1YKFA 1UWCA 4H0CA 3GQCA 5KZMB 2IQIA 1ZEMA 5DBGA 1XZEA 1U11A 3LGXA 3NCHA 1J4AA 3K1JA 1UM9B 4JL6A 1MT3A 4PYNA 1HL3A 4LYFA 2R8XA 5FNZA 1C7JA 1VIVA 2P5TB 5EWLB 4EKDA 3CR3C 4BJ3A 1OC4A 5DZ6A 1RZUA 5LMUJ 4ACAA 3RB8A 5E6SA 5D87A 4KGKA 1MC1A 4PLGA 3CR8A 1JLLB 4NYOA 3JQ8B 4LC0A 3U44B 3AEUA 2QMEA 4LCEA 4OLPA 4N56A 4HFRA 2I4IA 1C0KA 5JADA 1Y34E 5DTMA 1CHDA 3FNRA 4J3JA 4TL6A 4UPEA 2CSUA 3STTA 5KFTA 2Q5IA 3A6EA 5HGJA 4YJHA 2XMBA 1OLXA 2P1ZA 4MRNA 4RAQA 1ZGCA 2XLJA 4H7KA 1CJVA 2YNFB 3P0EA 4RD2A 1SKYB 4EA7A 4KCGA 4DR1J 4M0UA 3G9TA 2MSTA 1I4LD 5KSZA 1ZITA 5DYNA 1VJ0A 2Y67A 4DXDA 3QPIA 2JANA 1TO6A 1LFDB 2IZZA 4TV9A 1B93A 2VPYA 3BH6A 2HUNA 4TL7A 1L4UA 1DS6A 2B0CA 1NLMA 5F35A 1WZEA 4FT2A 3ZV5A 3D4JA 3IMEA 1YJ8A 5CABA 1N3LA 2AFRA 5C2JB 1RM5A 4FIDA 1UPFA 2Q8PA 2EX0A 1BRMA 2C22A 2NN3C 5K3DA 4HRYA 4M87A 2KWIA 4D57A 1QH0A 4KV7A 4DSIA 5FHQA 3L7NA 3O8CA 2W2NA 3GBSA 1U47A 2CZVC 1LBHA 2HK8A 3V80A 5LZ9A 3B70A 2O8VA 1KSFX 2YJ5A 1CPZA 3F5SA 2XTAA 4RE6A 1T4MA 4WXMA 2VOOA 3CWQA 4C21A 1CYDA 3LYUA 1MPXA 5FAXA 1UEUA 4WBFA 3HNOA 2GPNA 1CJUC 5C51B 2G28A 3HHLC 4RY2A 2G80A 5IDQA 4NMWA 1Y1TA 4IRMA 2GA7A 4OYWA 4RPCA 2GZDA 2JGKA 2CWXA 1GADO 3UAWA 3MRXA 1R64A 3TVKA 2G9UA 3DE0X 3DBRA 3H0EA 5BR7A 5IUJC 5HVFA 1JU4A 3G5TA 3GEMA 1WW8A 2W24A 2Z8ZA 2CHUA 3VAGA 1VMBA 4R8MA 4DSOA 4NG4A 4OBXA 2JC3A 1EQ2A 3BBPA 3LAMA 1W4RA 3H0PA 4XD7D 4EB3A 2ZB4A 4RVFA 2COKA 1GQQA 1C14A 1OQ3A 2EC5A 4UF4A 1FX1A 1U7ZA 4HRXA 4ICLB 3HWWA 2W2NP 2EI5A 5KG3A 3AIMA 1ZC3A 1MOQA 2W2MP 1FPMA 3P2YA 2IXFA 1W88B 1J8DA 2E37A 2HWUA 5A9SB 1SH7A 3W05A 1GTSA 3NRJA 3THVA 3JPYA 3K0AA 2HMVA 1ZPVA 5I7FA 1Z22A 3HC7A 2YR0A 1K6MA 4Y2SA 1HDOA 4OI2A 4B34A 1N52B 4Y7CA 2QFJA 1J56A 3OR1A 3U1LA 3W0LB 1YQ9A 2XJ4A 5JCPA 3OU6A 5KFCA 2EATA 2BT4A 3VR5H 1BVHA 2CDNA 5LB4A 3D0QA 5JZBA 1TW2A 3ZYCA 3BPDA 3RV3A 3E5RA 1UFLA 4ND4A 3A37A 3K1AB 2CQ3A 2QZZA 3DTVB 4FCCA 2W6NA 1SV5B 1US8A 1BG6A 1SUPA 4Y2VA 3R5CA 1QS0B 3FYSA 1O94D 3TTVA 2ZJ3A 3PTLA 3DI6A 1QE5A 1R6BX 1YGYA 3KHRA 2VC2B 2N7CA 2KXNB 1RCFA 4IRUB 3GAAA 1P4AA 3UXYA 1X7VA 1NAQA 3F6EX 4R1OA 5TQ0B 1RWNA 4UZSA 4CGYA 1VTKA 3N2ZB 3FWNA 3FNQA 2V4UA 4J2HA 1QTNA 1IBKF 1CLUA 3B3GA 4PLHA 4X66F 5CNKA 3QATA 1CNFA 4RF5A 2DHQA 4NLWA 3A58B 1BFDA 3VKFA 3UFXA 2DECA 2D7DA 4KBYA 2BVNA 1AKNA 5C8ZA 1VYTA 4KN9S 3ROGA 4EARA 2NP6A 1IWBB 5DSXA 2QZJA 1GT91 5U4XA 3MM4A 1PS9A 5DBHX 1ZVVA 1NVUQ 1DDOA 4KQ1A 3BJYA 4NFYA 2Q27A 1A95A 2Y4OA 2TMKA 1ADBA 3GLHE 1A2QA 1YGPA 4CM7A 1E8NA 1NGSA 1T4CA 1Y6QA 2QQFA 2BEJA 3BOSA 5LP6A 3HBNA 3NDIA 3LF0A 1YZYA 5LYJF 1E94E 3ZCXA 1J9EA 3IBTA 3H9GA 1XTQA 3RYHA 4M7PA 3OZBA 5FOSA 1ECGA 2ZNZA 1JDZA 3HFZB 2PUFA 4J8PA 1BLUA 2OB1A 3QYYA 1QIGA 2I4RA 2Z98A 1CUBA 1B15A 1KJWA 2QJTA 2PJZA 1URPA 2MYNA 4QYMA 1FUYB 2WTAA 4ZKDA 1YJCA 3EEBA 2OPRA 3A6FA 1U24A 2OHFA 1TKDA 2GX6A 2PAFA 4NDNE 4E2YA 3QX9A 4LHEA 1C1BA 3OX3A 3EXFA 3EA4A 3KPVA 5EIEA 4G0OA 5JH7F 1TU3A 2LEBA 4LX0A 4X97A 3IH5A 4DB2A 3PNBA 1IKYB 5FLXY 3E22B 3OE1A 1IUKA 4BATA 3N2EA 4UDNA 4C4PA 5JPIA 3HCEA 2X5KO 5BQPA 3P2MA 2P91A 3JWJA 4YPOA 1EM8B 3AZPA 4MQEA 1E6EA 2AZ3A 2BGGA 4G5XA 1FFGA 4G0UA 1QOQB 1P7YA 3W3AH 2DNMA 4CUZA 5F78A 1NQ5A 3JSMB 4JB8B 4I1VA 4K9PA 1NUAA 2O1PA 4NX2A 1NULA 3QX7A 4L4UA 1WXEA 1L4LA 2JAUA 3MUOA 4ZMSA 4YAJA 3HFRA 3SYNA 3JQKA 2DTEA 1MMDA 2RG7A 1DWPA 3DBRB 3FVWA 4KXLA 4X90A 3RQSA 5IP5A 4QAJA 3LIPA 3UAOA 3JAMU 3W9BA 2H18A 2JBAA 4G97A 4TTSA 4C76A 2CCGA 4PWYA 1GTMA 1VYHA 2R7UA 1R6AA 3QELA 3UCEA 3VR5D 1NJ8A 1SKBA 3OOJA 4MARA 1DEKA 4GRSA 5F1KA 4WNCA 5HJEA 4QW8A 2G4BA 5IM0B 3N6RA 4K4ZA 4JDPA 4UC0A 4LFCJ 3VKHA 4MOWA 1OFUX 3S5JA 1RAEB 2PTGA 1QK4A 2JHAA 4A36A 2FSIA 1GTEA 1HORA 1L4MA 4EGQA 4NJMB 4LFCF 2QT1A 3B1KA 1R15A 2PA8D 1QYRA 3DZCA 3QGHA 1L4GA 1YK0A 4QNRA 2YNIB 5LWHA 1NUPA 1IN1A 4DV5J 1HTWA 3PPIA 4RWZA 1O6FA 1OS5A 3BWCA 4GQIA 5HBMA 3EVNA 2HV9A 4UATA 1G0NA 3ORHA 4BV9A 1JEYA 4I14A 1SBYA 4OH7A 3VR4D 1E3JA 5HQLA 3PFHA 3JD2A 4DSZA 3T99A 1YRYE 3RODA 4CIBA 4XYEA 1F8XA 1YTLA 2WF8A 3KLHB 5J4KA 1VCMA 4QGHA 1GTJ1 3KQTA 2R65A 1DRJA 2SKEA 2PG3A 1K7EB 1WA5A 3GGOA 4CM4A 5ITZB 1A6LA 4RHTA 4AIRA 3D9QX 2KKHA 2ECKA 1K3TA 1JPJA 1WZ2A 3RIGA 3LBAA 5L4SA 3H8YA 1YA6A 3F7NA 3A8KA 4CO5A 2QVZX 4MCHA 4H4KC 5F3ZA 1F8GA 4YP0A 1DTQB 4C78A 3EIFA 3JX9A 4CO3A 5K0LA 4J9KA 1TO1E 1RT7B 2HRRA 3GGJA 2I03A 1QZ3A 5DHQA 1OV4A 3W66A 2VK4A 1M2VB 4N3NA 3K9WA 2KE5A 5DQHA 1F5BA 3SDSA 1U5BA 4OM8A 1ZH5A 1G4CA 3G0BA 3IAUA 3O5TB 4FUTA 5SY6A 2HJRA 5IW8A 4LVNP 1E2UA 1MP0A 4CV3A 3BE4A 2PZ8A 1SVDA 2C77A 4EZ6A 4YRTA 1R8BA 4JP1A 4TZ6A 3C15A 1LW6E 5C25A 2R7LA 4L9RA 1U8AA 1DX4A 7FDRA 2XH8A 5D4NA 1OYYA 1LDYA 2V7GA 2NVUB 1HNVA 4P4NA 3Q24A 5I9MA 2OTCA 4E31A 2W22A 1EQAA 2Y9PB 1FYVA 2O52A 4K9QA 1PZGA 1A7AA 1U0BB 1QX3A 4ED8A 1CZRA 1QHXA 1Y5NB 3ZHZA 3A3NB 1KI4A 4R2HA 4JX9A 4B5LA 2AQKA 4UNPA 1VYUA 3GR1A 3BB1A 1GNQA 2BJWA 3FDJA 5CZXA 5HS4A 3LA0A 2FEOA 4IDFA 2LLZA 3RVJA 1AUVA 3W77A 3W9HA 3RGWS 2OV8A 2QX0A 1IN5A 2XM3A 4DL9A 3GVXA 5KO2A 1X7XB 5AVSA 3ZV7A 3OOYA 2OR3A 4NHOA 3TFWA 4EGSA 2QMQA 1JLBA 1V8FA 2QRKA 2O5RA 4AVYA 3DFUA 3UW1A 4Q44A 3IV7A 4IDAA 3NGRA 3WRYC 2B4OA 3OIWA 4TQSA 3UG7A 1AO3A 1B74A 4U9UA 2O2HA 3OPNA 1CQJA 1TUBB 5K2MA 3L9ZA 2XW6A 4RGBA 2GKOA 1SJ4P 4YTEA 3IVMA 3H5UA 3I83A 4MRSA 3W6OA 4J4TA 1EQUA 4DG1A 2DXIA 4YMLA 4F9GA 2DOKA 4RIFA 4RQBA 1PIWA 1D9ZA 1RGVA 1OWNA 1MQ9A 4U7WA 2FFJA 3IXLA 3DE4X 4P4TA 4BU0A 1XL0A 3I1IA 3JQ6A 4GZ5A 4D9FA 1MU2A 1ENOA 3CCVS 1PWZA 2NG1A 5CFPA 1NC3A 2AP6A 3UATA 4HKQA 3MEEA 4IDEA 1WDLA 2PEHA 2R8EA 1VC5A 1TKZB 2VRNA 5C5EA 4H31A 4TVOA 2FPSA 2ZZKA 3NEJA 4CG0A 4LF9J 3LK7A 2A58A 3T52A 2XTZA 1JLCB 3EYWA 2CD9A 2VCEA 4JI4B 5HYVA 3KUGA 3U1MA 4R40A 4H4MB 5FTWA 4E3ZA 1GP2A 2DBRA 3EM1A 1BN6A 4EBEA 2LQ9A 4ZU6X 3Q6IA 3PDCA 4NAUA 1KDPA 2PZLA 2GNPA 2BOVA 1R8YA 2P75A 4S2UA 2FRVA 3KVNA 4DMZA 4RSMA 4QHYA 1DAPA 4WOCA 1E1QD 4TTAA 3MPYA 3OXLA 2XB2D 3UTCA 3NYRA 4C97A 4B6GA 4L9SA 3MFHA 4B3MJ 4KXXA 5KYWA 3H9QA 3ZNJ1 1JSXA 5IASA 4B2PA 2V5UA 1XNQF 3QRPA 4ARVA 2XEXA 2JAPA 1GD1O 1WSVA 2HA0A 5BXQC 2J6UA 1QHGA 3DEYX 5JNWA 4MMXB 1S7CA 3PNPA 1U7PA 5K8JB 2OYSA 4YVFA 2QP3A 3FGOA 2CWDA 4DV2J 4MUYA 4U2GA 4B44A 4C04A 1Q0LA 3I5CA 1BROA 1RLTA 3QOWA 2BUNA 1RBQA 1YR6A 1U1IA 3B1JA 1F7VA 5EL0A 4MK4A 1HNNA 4TXLA 4NS4A 4EG3A 3ZJVA 2FWPA 2C9YA 4FW8A 1ZGJA 2BKVA 4YA6A 3UFBA 3ICLA 3OR2A 3A9RA 4NYMQ 3RRFA 3ZGLA 3QVXA 4PRFA 4LF6B 2YWCA 2MZJA 3TD2A 3X1JA 3MTKA 3QXHA 5IT5A 3IAM6 3GEBA 4AS3A 2F3QA 1OUMA 2BX6A 3BRWD 1QH9A 4MRVA 2WAYA 1LNZA 5ES3A 3IUEA 3BREA 3HHEA 2FSFA 3M4YA 2XGQA 5TQVA 2VP2A 5LB2A 2XWXA 4ZP8A 1KEVA 3NWGA 4YRGA 5JDCA 4L85A 4LZWA 1HYQA 1KJQA 5G1OA 3ZQJA 2PGJA 4UZCA 4ANCA 3CM0A 1IAVA 3P32A 1QV9A 3ZCQA 3N3BC 1Q0UA 2VNSA 1EA5A 4IG3B 4Z0HO 4LJYA 2AQHA 5HCNA 3RK0A 3O74A 1AB5A 1KMNA 6FDRA 2FVQA 3ZR4B 1U28A 3KXLA 4AFNA 2XWJI 2VZEA 4IIGA 3WXMA 2B1QA 4BNHA 3EPGA 1VJGA 4DA7A 3O9VA 4JI8B 3N2KA 2V7WA 1GAXA 4B3RJ 2G7MC 4LF4J 1FB5A 4DREA 2B6HA 4RHCA 3M4ZA 1KPHA 3KZMA 2ZRCA 2WJPA 3RWOA 3HSZA 2RHMA 2KFNA 4N0PA 4B3RF 4EG8A 2OGTA 3B53X 3OR1B 5EP2A 2J0SD 1X8DA 4PXEA 2I78A 2QROA 4R84A 5IMBA 5LN1A 2SCUB 1XMXA 1NM2A 1EQ0A 3KOOA 3AVTA 2QS9A 3O90A 3JTPA 1TECE 4D9MA 1X4BA 1SHJA 3RVKA 1ILWA 5ELLA 2CNKA 2E5WA 2MIIA 4FYKA 4DCOB 1TU0B 3TZBA 2IUSA 3TXAA 3HGQA 3HO8A 3OICA 1D09B 4O2LA 4AUEA 1Z0FA 2C9BA 1M0WA 4A8WA 1JSCA 4JV5J 5BN3B 2EKPA 4LFBB 3DD1A 1RHUB 1QYIA 1Q3KA 2QSJA 4DLYA 2BCGY 1KDOA 2Z5FA 3IQDB 5ALOA 1PUIA 1YR7A 5C7OO 3K7EA 1KVSA 9ATCB 3M8ZA 4PZPA 1T1RA 1BEZA 1B00A 4Q7LA 3AF5A 3DYIA 2SXLA 1MROB 2Y1KA 2W4IA 4WZBA 2HU8A 4YMGA 4ZYXA 5TQ0A 4CGZA 1MJGM 3F7MA 1NJ1A 1LI7A 1OQ6A 1PYOA 4BNLA 3DUWA 4KE6A 3RUHA 5JNSA 3OE7D 1OLUA 1P6TA 5K51A 4YN3A 3HKBB 1H1DA 1ZMRA 4LOIA 4YQZA 4OX9F 4E08A 3RVSA 3TYXA 3ZGYA 4MW1A 3DZDA 2J0SA 5HVHA 4M38A 4J90A 2OBXA 1BKYA 3D7MA 3FYUA 1GTZA 3MF4A 4GPTA 1M66A 3E48A 3WGHA 4DR3J 1K7XB 1SCBA 2W93A 4J0EA 2XYPA 5E4JA 2EP7A 1W2IA 3KK3A 1YACA 3B2QA 5HIJA 1QQ5A 2X3YA 2BVZA 2ZWAA 4UTZA 2XA9A 1UJMA 3GLGE 1MF7A 1FNBA 1Y6RA 3S7TA 3U7HB 3R75A 4YRPA 4U5XA 2FYXA 2SKCA 2D0IA 1SUEA 1E3QA 1WXGA 4YUYA 2WNHA 3KQVA 4B6OA 4EKYA 4JSYA 3AIIA 2Q2QA 3ND7A 4ADSG 1ECFA 1RXIA 4NPHA 1V8ZA 4Q3CA 2OYRA 2OAQ1 4HYEA 4RFSA 4WOPA 1YRQA 3AI2A 3EQ7A 4QUDA 4NZNA 2PMKA 4YHHJ 1OH5A 1FE4A 2OSQA 3ENNA 4IKOA 4HDOB 4UAGA 4EKNB 3NM6B 4UBJA 2W2OP 1R6VA 4U7UD 5J2UB 1IMJA 2YQ4A 1YR9A 4KBFA 3VOBA 1JU9A 1ONNA 4HFNA 4MCJA 5JPDA 2KVQE 4Z9YA 4DARA 2MKIA 5A0VA 1VYAA 3G8DA 3PWTA 4B33A 1NASA 4RHXA 3FEZA 2B37A 1PTJC 4JYCA 3MCUA 1U6FA 1YQWA 1IEWA 1ZL2A 1HV8A 1V9SA 4DWVA 3K5WA 4Q1CA 2R7KA 2CNOB 4MVJE 3TIFA 2FOIA 4QJVA 3G2LA 1V3TA 1GZUA 3UIEA 1H8HD 1VQSA 4RL6A 1S6PB 4CTAB 2E48A 4MV1A 3ESZA 1BRTA 2CNNA 3KSAC 2BMEA 2YNMA 2Q8QA 4CLWA 2BD0A 3W9IA 2BQUA 1G6Q1 2C2HA 1J23A 1GXSA 2CZ4A 5ETLA 4ZJPA 4LRSB 4EPRA 2XR1A 5CYQA 4CL3A 2F1KA 1DCKA 3F6CA 5MFZA 4D96A 1KTVA 4BFTA 2HWWA 4JI1B 3QJJA 3FUXA 1V3RA 1T6BY 2MTLA 1NSFA 3KHUA 4C8LA 2PYZA 3O03A 4Q39A 3UPTA 4F6CA 1O94A 5L6LB 2X1LA 3WLIA 2J30A 2V7VA 2PLRA 1DFGA 5CUQA 1OB2A 4OHRA 5BUZA 5B64A 2WMYA 3WYDA 3UPDA 2YN0A 1SHKA 1N5DA 4X64J 3CVVA 1F3VA 2AV6A 4DNPA 1PG2A 4WH0A 4F4CA 4BNNA 2V5HG 3DXZA 4HYQA 1VC6A 2KYRA 4ZI5A 4JVLA 1JLMA 1V2GA 2HBZB 2FW9A 5E33A 2IQ5A 1L5HB 1W0KD 4G2TA 4COKA 5TT0A 3JTEA 2DCUA 3R9XB 5J4HA 1Z2EA 4V0SA 1CTQA 2XMVA 2IZ6A 3UUFA 1GCAA 4BAZA 3OQOA 3TI7A 1QZZA 3WZ2A 2Q4DA 5THXA 2EWWA 1QX4A 1E92A 2IHZA 3D54A 4Q3KA 5EQTA 1J42A 4J7XA 4B6QA 1YZLA 1LC3A 5B1IA 4WI1A 2IITA 3RS8A 3WZMA 5I4IA 3G82B 1NNSA 1NOJA 3L46A 2Y3IA 1JBQA 3T06B 1KU6A 4Q4DA 1LPMA 1FIUA 4YRJA 3KB1A 4C0SA 3NVKI 1PZFA 4HWSA 5JD4A 5BSFA 2B4UA 4N9QA 1JA9A 2NO6A 5CT4A 2IZ0A 1P9NA 3W5ZA 3HWSA 4XIIA 2QX9A 4CMCA 1BDHA 1II0A 1C1DB 2V4MA 2GK4A 1FRKA 3FSRA 2YIDA 3GMTA 1LD3A 4CNYA 2GK3A 1VBYA 2II6A 3HFSA 1QM5A 2GHVC 3C14A 4EVQA 4KN8A 2A10A 3MAGA 5BWBA 4DA8A 5IKEA 4UUPA 2M9KA 4X7PA 1OB5A 5CCMA 4EAAA 3OTIA 1H85A 2EGHA 2ASJA 4E5UA 2IYSA 4Y6LA 4KYUA 5FRDA 4H3KB 3KFWX 2R8OA 1V9LA 2YKQA 1RYFA 1T9GS 4LTMA 3D5TA 4M5DA 3E7WA 2ZITA 4IDCA 4KOEC 2U2FA 5HSGA 4IJVA 2PDAA 3BCRA 1TMOA 1CY8A 1WE2A 3BBCA 2ZXUA 5AW6A 3I96A 5K3SA 1M1ZA 3C3BA 1YL7A 2ZCUA 1F6BA 5I3QA 1B8PA 4XYBA 2CJQA 2Q5OA 1APSA 3PEVA 2ZS8A 4WNAA 4RAOA 4HKTA 1LEOA 5K4HA 2ZTUA 4MS4A 2NUTA 5G53C 3UV3A 5HA5A 5IN5A 2HHWA 2OB2A 1FI4A 2V8DA 3LBIA 1QUPA 2YVKA 5NLLA 5AJ3J 4B6FA 3UN2A 4WVFA 4PRYA 3RC7A 1XRJA 4TU7A 3W8EA 3E22A 4D25A 5B3JC 1VOMA 1QVAA 5IABA 4UY85 1QNLA 3DNMA 3K9FC 3LYAA 5AW3A 3VTFA 2O7NA 1F5SA 1KAHA 4BQIA 5GZ1A 3ASVA 2ZC3A 4BRWA 4JK3A 1K5DA 5EJMA 2GIFA 2R7SA 1AFIA 1O5TA 3ZWYA 3OL6A 4TXMA 4BQRA 4ZYYA 3DHXA 2VUTA 4MI1A 4BKMA 2WTXA 4DU8A 2MLZA 2DHCA 1NW4A 1KFEB 2O57A 4GMGA 3D6FB 5F2KA 4K7JA 5EJGA 4N3GA 5ULLA 5KCMA 1UMKA 5CCDA 2D00A 2E9TA 4JB3A 1EJ7L 1ICEA 2HJGA 3DMGA 3HDYA 3RADC 2GF2A 2AMCB 4UE2A 3GJQB 3KZ1E 1GPNA 3ADCA 3LPEA 1P18A 5I8PA 5AVZA 4WZAA 1D1SA 4GF5A 2UUOA 3UI3A 1W36D 4LDPA 2CBGA 4QWMA 4U7PB 1IXSB 3H5TA 3M9WA 3H5YA 1YWGO 1JFFB 3LT2A 5C80A 1TC2A 4OL9A 3DD5A 4L6V3 3FR7A 4Y1RB 4HATA 2PMWA 1LZLA 4YJ2B 1Q1BA 2H5IB 4OSEA 3AB8A 4XWGA 5FA8A 2HB6A 1V5IA 5AHXA 1JHUA 2WM3A 2F62A 4ZRDA 3IVRA 2EP8A 4KU4A 2RONA 3I5AA 2BSXA 4FI3C 2CQDA 4QFDA 5BRAA 2LXUA 1M1UA 3V4VB 2EW8A 5GMDA 3LF1A 2I1WA 1P9QC 3OY2A 5JLAA 3BF8A 1E7YA 5A3VA 4ISCA 3CUSA 3OTCA 2OAEA 4QHTA 2J85A 4EYGA 3RARA 2YHBA 5DHFA 3WL6A 4GZ3A 3FN4A 4TZTA 5TJHA 3M2UB 1G21A 4P83A 3NKYA 5LQRA 5F3TA 4GR9A 3M82A 4A8TA 3DMJB 4JV0A 4ZREA 2XIQA 5FAKA 5JXSA 4EG6A 1TDJA 2CUTA 1JQKA 2ZR0A 2FR1A 3HPRA 4XAKA 4I8DA 3PYMA 2PVSA 3OAAD 5BO5A 2PSDA 1AHHA 3QPCA 3ZWKA 3BULA 3D8TA 4CM8A 3IALA 4ZITA 1DTSA 3TQHA 4BLVA 4DCMA 1FFYA 2PWYA 3N28A 1XZLA 1CS0A 4LOJA 1U8YA 1V26A 3F3KA 3SS7X 2D9OA 3AZQA 1T5LA 2BI7A 1X3LA 4IUDS 1PYSB 1KI6A 1VP9A 4KR2A 3IURA 4KDFA 3BR8A 3AIOA 3TRFA 1B99A 4DT1A 2B1IA 4A2WA 1IZZA 4EO7A 1E6YA 1B8VA 1S0UA 5BXYA 2Q5JA 4RTSA 4AS2A 1U8ZA 1YZNA 1NQXA 2C31A 2AEEA 3U1TA 3MTQA 5E1BA 5BYJA 5MAOA 3N7TA 5JJ5A 3DQQA 1M34A 4YMTA 1D6MA 3MB8A 3SLGA 2HV8A 4XLZA 3OX1A 1X7YB 3TEMA 2MQPA 1CZUA 3A11A 3MCAA 4JV2A 4BV3A 1FYDA 4MAMA 3W5XA 3IVAA 5ITSA 4YCJA 2NQTA 2F3UA 1VPTA 1J2VA 4GM0A 1PW7A 2BSQA 1YUMA 1MX3A 4N76A 1WDWB 3K35A 5EUQB 2QWXA 3AONB 3HFKA 1I6JA 5ARDA 1AW0A 1IG3A 3S2YA 3IR5B 1M2GA 4GXRA 3ANYB 3G82A 1WG8A 2CJPA 1Y1PA 2RGCA 4B84A 3KKEA 4MV4A 1VBXA 4PO1A 4LHWA 3W9SA 3IP0A 2QU7A 2CE2X 5T67A 3AJEA 3LUGA 2BM0A 1MMFB 3OFVA 1Z74A 1P2BA 2V9KA 3NBXX 2E5IA 1VPDA 1ZQ1A 2CAJA 1FMCA 4W1PA 4Q82A 2ROEA 3T5TA 2HRQA 1I6WA 3AMVA 3UD5A 4MI3A 4C3UA 3BKFA 4XUCA 4X45A 4DQIA 3OTEA 4E2XA 4NWBA 4P3OA 5IZCC 1BC5A 5MLCV 3KHTA 2FR8A 3C6YA 4WDRA 1ODTC 2CMKA 4BECA 4GLBA 3QMPA 4USWA 5BSMA 3I05A 1FP6A 4OFBA 1YRLA 2W2KA 5HRCA 2OMEA 4LXXA 1DX9A 3EVFA 3ICCA 4DX5A 2GK6A 1T5DX 3DXYA 4MVJI 3REGA 3M9MB 1U26A 3T1TA 5ECDA 3W3SA 1V1MB 3Q5GA 1SXIA 1H2WA 1YUBA 2G5CA 3PFIA 4LRXA 3IAHA 1M2EA 3EQ6A 1Q22A 4PZVA 1LLQA 3IBYA 3NWOA 3WHPA 2GBPA 1VE7A 3H7AA 1KWGA 1AZSA 4K4UA 1PZXA 3GZTB 1VKJA 3SPXA 3OLVA 3ETJA 3NHKA 4PX3A 2VUGA 2OPQB 3KDOA 5DGCA 2IYEA 3WLKX 1ZHOA 3H5WA 2PUJA 2WPDA 2IHKA 3V7YA 3SS9X 5LJ3Y 3GP9A 4D98A 3HJBA 3PEYA 8ATCA 1GXUA 5A2QA 4OHKA 4C89A 2GQ0A 5BV7A 4ZJLA 2H63A 3O2IA 1Z38A 2UYOA 1SXJB 3BMCB 2IUFA 3FSIA 1Q19A 2PKQO 3DKIA 4KGZA 2IYGA 4P7GA 1NVGA 4QWAA 4HEA9 4JI7B 4H4MA 2GSDA 4MICA 1TT7A 4QO7A 4ZVTB 2SNIE 4J76A 3ESQA 5GMEA 5F2NA 4DJBA 3NBZC 3N58A 1X9GA 4BRUA 3CGIA 5J1EB 2PRSA 4PAGA 2Z5LA 3BICA 4TN1A 1RT4A 4KL8S 2JGEA 1UBGA 1QRTA 3TM4A 3EDOA 2XNCA 2GJSA 1FKAF 2Q7OE 3JAWA 4KGXA 2GJ9A 4AZTA 1UMCB 2RK4A 1XHEA 1VLYA 3C5EA 3KO8A 3EPRA 3HXQA 3UT0A 3N5CA 3OWXA 2JIPA 1QP0A 1SHZA 4H08A 2CJFA 1R8PA 4XB2A 1CNMA 1GU0A 1K97A 3HLUA 1IDN1 2HZ7A 4CM1A 1EWQA 3W4IA 4G1QA 4MX8A 5G40A 2JDJA 5K8CA 1P6QA 5AE2A 3T95A 3IQGX 5A7HA 2Y99A 3PNQA 1GPAA 1YA4A 2ZUWA 4DV7B 5G3YA 2XRFA 4U6SA 5KTSA 1C4XA 1Z6YA 3H5RA 1G63A 5A3RA 3RB6A 4WTYA 5A4KA 4KQ2A 4OGLA 3ABZA 1XMPA 4IOLA 2CYCA 3H2UB 1WHTB 1ZNYA 3C6UA 1M6NA 1SK8A 3B2EA 2VJOA 4W9NA 5F12A 3TDMA 1MFPA 4KJXA 5C24A 5CW2A 1NWHA 3H4IA 3BHMA 2ZIEA 4BLQA 1KO8A 1F6WA 1V1MA 1FTCA 1U3DA 1M1YE 4Q37A 3JQGB 3W5CA 2GYUA 2B9YA 1CF2O 1QKIA 4OHZA 4H1HA 3VVMA 2YKAA 3ILXA 3IP1A 4Q1EA 3D4NA 3FMPB 5FH9A 5HQ8A 2RGUA 4R1QA 1A9YA 2J5BA 3ISTA 2P4SA 2GQ2A 3FMIA 1EX9A 3TVDA 1MCZA 1SIBE 3D7KA 1CEYA 1FXWF 4LV5B 1N33F 2FPPA 8MHTA 5T14A 2C20A 3UWDA 5SUHA 4I99A 5ECWA 4X1YB 1SH0A 4ZT2A 3VO1A 1J2EA 4IJMA 1EUQA 3P1JA 4HNSA 3KU1A 4NBWA 4CT9A 2KG1A 4H7PA 4EX7A 2Z08A 3O1IC 5CJPA 3G8CA 4HAXA 1NQUA 4BFLA 3PNLA 1WO8A 2I2YA 3GEPA 4LMRA 3LP1B 1DBDA 4BGDA 2Z6UA 2ZUTA 3DVQX 2V8GA 4QYRA 2AYZA 2DPHA 1CJKC 4RWEA 5DDRC 4DGQA 4X4UA 4HWOA 3ITHB 2BFPA 4WN9A 2VXBA 5I51A 1GTL1 1DRKA 2AMVA 1A9RA 5C34B 3KCNA 3T12A 2HJWA 1I3OB 2J3IA 4N0EA 1C1XB 4HEHA 1OO0B 4LZNA 4F7VA 2QUKA 2ACMA 2VYCA 5LQKA 3WLMA 2PS0A 2WHYA 2X0KA 3R3JA 1IPFA 1PEDA 4NLUA 4ZOAA 3QE0A 2R66A 4I2QB 3OTGA 2XC9A 3RSQA 4MA4A 1KR5A 3M8PB 1I3CA 1BW9B 4ETZA 4EDFA 1AYEA 4P73A 3COYA 2B8TA 3FOFC 4XGRA 5LQAA 4KR7A 3JQCA 4N82A 4GYJA 4Z99A 1U3VA 3PIDA 5EHHA 4XGIA 1SZPA 2AJFE 3ZD6A 2YPZA 1VA4A 1SKUA 5FR1A 1NZJA 1QP7A 3EOAI 1E6CA 2GUGA 3IMQJ 2FZWA 4DDFA 2ODNA 1P1BA 3V32A 4UTXA 2O23A 2ZKTA 2PCLA 2JFKA 5KOJB 3UMRA 3CZCA 1I94B 3BCSA 4AJ1A 1S6OA 1NSAA 1NJSA 4OQDA 4CF6A 4O3QA 4WXWA 2O6HA 2FNAA 3EGVA 4XTTA 3O3LA 1GEEA 1SCAA 5EFOA 2G09A 4A5OA 1OY6A 4S35A 4JH0A 3QFCA 4D26A 1F9EA 1NAIA 4DNXA 4TRNA 2JFXA 3U4IA 4C8YA 4YRCA 3W6NA 1W4CA 2HGSA 3IPLA 1ZD5A 1UZUA 3TAUA 4X62B 3OM1A 3K1AA 3PIPQ 3PD1A 4R83A 1J8MF 5BOSA 4D9BA 3QT8A 4QYIB 1O95D 3ANTA 5D4OA 1GYPA 4JBNA 4LYGA 3WDOA 4H27A 3RWBA 4UAUA 1WOSA 5BR1A 2VF3A 1MG0A 1W44A 2ZYHA 2D0PB 2O8DB 3NAZA 1UDXA 1FE0A 1CF9A 3G0OA 3PJDA 2BLNA 5D6GA 3RGIA 1RADB 1PK9A 2P8JA 3OPYB 5HQMA 1Y10A 1A2BA 3VSDA 4U8YA 1UBUS 2BRKA 3GCZA 2I3ZA 4RZXA 4JI4J 4Q9AA 5BW4A 5DDQC 4I1SA 1NRWA 4AXIA 5GADl 3GLJA 5JNUA 3JXEA 4JI4F 1Y5IA 3FUVA 2QN7A 1Y3BE 1NI4B 1XLUA 4JYAB 1GLGA 2QSUA 2RJ3A 1OLSA 1OWLA 3GFXA 1Y0BA 3CXCR 1VJDA 2X9LA 2X1VA 1KOOA 1FDNA 2AX3A 3FDXA 4BWFB 1X19A 4HR7A 1UXGA 3CUKA 4AWBA 3GG0A 4KH1A 4DEZA 1W0JA 4FF2A 2AC7A 3D2CA 4H3VA 5J2PB 2ILZA 1WKJA 1RKJA 1JFTA 2WU0A 1OPIA 4E15A 3UWOA 4MYSA 1SPXA 4UU1A 4OAOA 4XM1A 5IT9U 1LQUA 3DWEX 4IDNA 1NK7A 2PYDA 5DLFA 4OL0A 1EIWA 4GKVA 3GH3A 3RHZA 3TTXA 5TPWA 1U6JA 3ZKWB 3NXKA 4JBWA 2FMTA 4RJIA 4BO9A 5EIFA 5FWDA 3CKYA 2WNSA 3B1YA 3E6AA 3DFKA 1RT1B 4CIOA 5GZ6A 2JIDA 2UZIR 3E2MA 1RKIA 1KQGB 3LCCA 5BR8B 2DITA 1KSPA 2C3MA 3E9DA 1H2VZ 1X1TA 2PL5A 2NUBA 3FSEA 4F9FA 1IBMB 3O2JA 4J9MA 2CDAA 5KJ1A 4QVKA 1GT8A 3J81U 1I1QB 3RSHA 3ZXYA 5CJJA 3MR6A 3WWCA 1ZM9A 4IF4A 1M10A 5L46A 3C4JA 9LDBA 2QNRA 4R2MA 1T0TV 1XN9A 1OJLA 2V6BA 4UU0A 2GN4A 5CA0A 3DLPX 1L3TA 3A32A 2HQCA 3EUNA 3I6PA 1GARA 1RJ9B 3Q40A 2DFKB 4N5SA 4L5IA 1SQEA 2RD5C 1NF9A 1DI0A 2ADFA 1DV1A 3KB6A 5KFGA 4NABA 1WQ3A 1TF7A 4BEJA 2DRBA 4AC9A 1GFWB 4TS9A 2BM1A 3ISJA 3ZXUB 1PVOA 4OUKX 5AI5A 4P74A 2F55A 3JQAA 4N5DA 2J9RA 3RHFA 4ENRA 3DLKA 5F3DA 3ZVKA 5KYXA 3Q1KA 2YIVX 1UKZA 5DO9A 5FLXU 1D3AA 5LQMA 2XHWA 3OEHA 5KQGA 3K9QO 1EE9A 3BXOA 3HM9A 4E88A 3OIUA 1SURA 4UOEA 1QDLB 3DXSX 4I4TB 1EM6A 2AMFA 2DSNA 1GGMA 2FWRA 3AFMA 3ROZA 4BLUA 3KSDO 3MPDA 4YMVA 3ROKA 3S8MA 4JI6F 1LKZA 4AQYB 3QVVA 3WV4A 2OOSA 1C3XA 5A7FA 5J1NA 3FHJA 1SC6A 3BDVA 5BSKA 4ML3A 4GQBA 5DOZA 3GP3A 1P27B 4JELA 2FJEB 4YP1A 1ESCA 1OCEA 1N5TA 3EMTA 1PN3A 4FK8A 4JOUA 1QDUA 4NXMB 3BR9A 3GPDG 1NP6A 1VPLA 2GNKA 2ETXA 4Z4EA 5IQ6A 1ZOLA 5D6NA 2V9WA 2GZ1A 2Q3BA 5FIUA 2QIOA 4DQRA 2PX3A 4K6CA 2FG5A 4H7EA 4LZLA 1N36J 3DMTC 1QPBA 2DETA 3ISND 3K0KA 2CG4A 1AMUA 1XMOB 2ZUGA 2XMTA 1CRLA 4HYYA 1HWLA 4LYEA 2KZMA 2FVRA 4C22A 4BB9A 5AESA 1V4BA 3FW1A 4FGKA 1ACJA 5LSLA 3U31A 4JEUA 4F0KA 1TM3E 4IYJA 3KM0A 1X1QA 5A0YA 2W2TA 1IXZA 1JJBA 3ICPA 1T11A 4P4LA 1KNXA 4HN2A 2XTJA 2QLFB 3N2LA 2AN3A 1S1TA 1IULA 5C5CA 1L7XA 1T36A 4LN1A 3Q7EA 2HWTA 1NK8A 4ZV4A 221PA 3EAFA 3IAM9 4KFBA 2D06A 4BN5A 1S8OA 2ZYTX 1FFCA 1Q95A 1LV5A 4A3SA 2I2AA 4PTZA 4FC7A 2QVCA 5D7NA 2BFFB 3CV3A 3A1VA 1U9IC 5CVDA 2GO7A 3JQGA 5CHCB 5KT7A 4GAEA 2ZE7A 4EGLA 4F3YA 4JIMA 2J8AA 2LE0A 2C3OA 2N9UA 5L53A 3ZTQA 1I13A 4AO6A 4TS4A 4OBEA 5TDHA 2FPRA 2P68A 3E82A 4YK7A 2BDPA 2J33A 3MJSA 4JI8J 1XIQA 3GCWA 1TMJA 3PVZA 4GGOA 5FEMA 2OMLA 2AFHE 2Q5QA 2OZVA 2J7KA 3M7IA 2F9JA 1C9DB 2CQCA 5AR1A 1V8PA 4TQGA 3MCZA 3MTJA 2V2ZA 4IH7A 2OBYA 4JJFA 3VYUB 5IVPA 4EPYA 3HJVA 1HDXA 2IWHA 4NOKA 4OK6A 3TE7A 1G41A 3P9IA 3JARA 5HK8A 2ORWA 1UWLA 4OYBA 4JQSA 4A73A 2HU5A 5E41A 5J59A 5JXHA 421PA 3H97A 1SKYE 3CONA 4ZHQF 1CVJA 3IP7A 5FTKA 3S1TA 2OWDA 4KH0B 4KKOA 2XGJA 1I94J 2D59A 1P19A 2GKSA 2VZ9A 5KX5F 5H59A 1XEWX 2X8JB 3KBBA 3AF1A 5JWRA 1FRXA 2BGIA 4DA4A 3JU3A 2KT3A 2GXUA 2CZ9A 1I2ZA 1XXLA 3DEKA 4I6YA 1OXXK 1NDUA 4DKJA 4BNDB 2XXBA 5EHNA 2PMHA 2VG8A 1U8TA 1CP3A 5C5IA 5CNMA 3DPIA 1MX1A 1BS2A 1O9GA 2Q3LA 4RF3A 1UC8A 3LVFO 2XWBF 3AHFA 4MITA 2E1PA 2C2EA 4CT5A 1PDOA 3BBBA 1SFRA 3OMXA 3DBHB 2W8ZA 2ZUSA 4PYJA 1P0IA 3CJRA 5CX4A 3HCNA 2I8EA 1Y3AA 5HQJA 4M6WA 3PC8A 3GEGA 1Y3HA 4HFMA 4RIGA 5BSRA 3GJ8A 1Z47A 4DA0A 3OE7A 2WAOA 4LG1A 3CW2C 5BURA 1NYLA 4BKPA 1YR3A 5H70A 1HETA 5M7EA 1C3OA 4I1OA 1KYVA 1RKXA 3WGKA 2EHJA 1RCUA 1SOUA 1NU4A 4ND8B 1YFLA 2XMGA 1J2UA 2X77A 2CLDX 2G1KA 5JFOA 2FQXA 2KHZA 1SXLA 4EA6A 1N6PA 4NU0A 4JSTA 3UN1A 5CB0A 2OENG 1E69A 4WFBQ 1KMQA 3U3XA 3ZW8A 1RAAA 3WISA 1DTEA 1Z25A 2ZUUA 4D9EA 3GO4A 4F5EA 3QIPA 3UCXA 5EUCA 5FHRA 4NXMJ 4HNRA 4URSA 1BAPA 3FCXA 4WLNA 1BGXT 2J6BA 4L9WA 4O2AA 1L4NA 1V71A 1XCMA 1YZHA 2PPVA 3I5XA 1PK7A 2QUBA 3T3IA 1IFXA 2ZT8A 4HWRA 2HVDA 3MMSA 2D2IA 2LCFA 4PFKA 3GEDA 1TEXA 3LC7O 3IEXA 2MT9A 1RWMA 4BV8A 3CSKA 1FS6A 5FOUA 1V5IB 2QF7A 3VR2A 2IOHA 1O1YA 1VMDA 1QB7A 2DGDA 3P5BP 2OTLS 4M5NA 4K9RA 3IKMB 3DM9B 1VSVA 1EUZA 1FDVA 4PR0A 4K1LA 5HL7Q 2PK3A 1BHO1 4O4GB 3NLLA 4RESA 2EARA 5CVJA 2F9FA 4I5GA 3C66A 5K6RA 2OCIA 2Z57B 5C37A 5HDBB 1L7QA 2BV3A 1VQPS 1Y80A 2XHZA 3FRZA 2CDRB 3OESA 4ZZIA 3H13A 2PFGA 3N76A 5HXAA 5ESXA 5JC1A 4BO1A 2Q5FA 4TTJA 2I6UA 2O2GA 3WX4A 5EEGA 3BQ2A 1R0XA 1KEPA 4Q1BA 3ANXA 5JWHA 3PXGa 3DI6B 4TMZA 2OV1A 2Q28A 2ZOSA 4BX8A 3RT9A 3D7SB 3CF6R 3OZWA 1YG0A 2ZAGA 3X2FA 3JSRA 1T7PA 4HY3A 4X4RA 3O92A 2MMCA 4MVJD 1P45A 3SCKE 4Q7MB 1JMVA 1NFFA 3SOZA 1RM4A 1P31A 3ZWMA 4ER3A 3QTLA 4O44B 3NLCA 2HJSA 3FGVA 5EC8A 1C1XA 3AHGA 3EOBI 4G5OA 1KD1T 4L9AA 3WBJA 3LW5C 4D8XA 2DUJA 3PHTA 2R8RA 4WOBA 1P2GA 4QBTA 4B3TF 3L7DA 1E0JA 1JDBC 5DG8A 4EVIA 4C5BA 1TL5A 4ZVPB 1W94A 4OATA 2RIPA 4I19A 2HF2A 2E1RA 3TWZA 3FFXA 2AYMA 3I31A 1XRNA 1QLHA 3AXTA 2C4NA 3I6YA 1RAFA 3IT1A 4KQJA 3D4LA 2XYQA 4DCNA 5FPKA 2IODA 2BFDA 2F00A 1DUSA 1ZD3A 2BFFA 1XTJA 4JJZA 3TVYA 2OXFA 1JW9B 4J1NA 4WUVA 1UMBB 4MZXA 4WYLA 4M7OA 5AM0A 1JDSA 1Z4LA 3PHCA 1RZVA 3TNVA 2GB4A 1XJ5A 3MPOA 3Q83A 3GRUA 4X1IA 1RWMB 3D3BJ 1DUIA 4LZOA 4QNNA 3A4VA 2C7QA 2IGTA 1SH2A 3FCCA 2WZBA 3FKQA 2XYGB 5CW1A 2XKBA 3PPXA 1KMHB 4U8GA 3S1LA 3MECA 4HMQA 4DRZA 1F8UA 2ZM6J 1S10A 2B1JA 4JOBA 2P6RA 3LOQA 3N74A 3O93A 3CVYA 2OD9A 3OOHA 2KFYA 3CCQS 1QFMA 3ENVA 1DLJA 3FWZA 2E7VA 4ZP7A 4A6PA 4P0PB 4HZGA 1QPGA 3P0RA 1G59A 3HVAA 2HT1A 1SZJG 3PPYA 3VI3B 4OKIA 3VBEA 1Q0NA 5JUWA 3KWFA 3PZPA 4B3SJ 4ZEXA 2OEMA 1HOTA 2IM0A 1YE8A 1UAAA 1IM5A 4O0IA 4MULA 4CQNA 3KG0A 4MUHA 2GN9A 3MPUB 2J6SA 2P30A 2BW7A 3TB6A 3KX2A 3R8YA 4HLCA 4BDSA 1S3SA 5B3AA 1Q0PA 3LCJA 3CC8A 5CFOA 1JXAA 3HDHA 4URQU 4EHFA 2L19A 1XYVA 2B7LA 3GR0A 3CVUA 2Y66A 5F9LA 2ONZA 2QL9A 4LOKA 1JFRA 2ON6A 4YQEA 1HXHA 4LE2A 3PE4A 1YSCA 1NDCA 3VOTA 3HDJA 5IEBA 1IK4A 3DL7A 2YY5A 1V6CA 2QKYA 2NTJA 4QFMA 3K6KA 4AECA 5DLQC 1C0TA 3ELHA 1QKJA 3SOPA 4F5DA 1NK4A 1Z6GA 3OQ2A 4B2IA 5ALDA 3C3XA 3NBUA 4MLPA 2ISCA 4K26A 3DNFA 4QUBA 4JLMA 3AVUA 4FBTA 5CDGA 2FLKA 2QENA 5EWMA 2MSCB 4YAFA 3QV1A 3LECA 5EP3A 3LFUA 3N0VA 1E1LA 3OX2A 3B60A 5FUBA 2PX0A 1LV8A 3G8SA 5KT5A 3WIOA 1UFWA 3FHLA 2K06A 1P9LA 4MV6A 5KQMA 3EIQA 4M89A 1LWEA 1HEYA 3VZHA 3BFPA 2PQ6A 1ITZA 1M75A 2OA0A 3GBPA 1ZRSA 2HDNB 3UC5A 4J7CA 3ZC4A 3BXFA 3STXA 4HVCA 2W83A 3IIMA 2FPWA 4TKLA 2GQCA 1MQAA 4JJGA 3G7UA 4N41A 2FVCA 3QVTA 4N65A 3NPMA 2D2XA 2BQ3A 2MU1A 3AUAA 2UVRA 2OUIA 1FERA 1B0TA 3THXA 1XCBA 3SQGB 3E1KA 1U1GA 4WFQA 3ILYA 3TLZA 3DB2A 4KGVB 2DY0A 1DT5A 4XM2A 3HL4A 4PE5B 4TVBA 5LMNF 2WWRA 1N34B 1QHIA 5CIYA 5DK4A 4NMLA 4AB1A 3UXHA 2HA2A 2OXRA 1L9KA 5CAEB 2AQ8A 3SAJA 2EFQA 3RQIA 3OCUA 2FKAA 3KQMA 5A4DA 5IVIA 2YWRA 3QAUA 2PH7A 4MV3A 3SJZA 2CC2A 3FGNA 3PDWA 1PG0A 3MINB 3W1YC 2HK7A 4UQLA 5AKHA 2PS3A 1YWXA 3WRXC 1QIMA 1UQTA 1JV2B 3CJ0A 9LDTA 3SSOA 2M2IA 3DBIA 3VHXA 2BF7A 4WCFA 1VJQA 5GADI 3KALA 3ZE7A 3T7RA 2C83A 1HBOB 1ID1A 4MJLA 5KSOA 2SBTA 3TA1A 3EEFA 9ATCA 6AT1A 4YAGA 3SX0A 3VPDA 2AT1A 1NBHA 2VUIB 1E2DA 3FBGA 1QO0A 2AIRA 2Y92A 3J80A 1WCIA 1W88A 1S8AA 3NOVA 2KXHA 4FHCA 4ITVA 2AZDA 2GJIA 3DV2A 1Z4PX 5JSQA 4E0DA 4BNDA 1XDBA 5IYZF 1NNEA 2FP3A 4CF5A 4WJBA 3OFHA 1DJMA 1Q1ZA 3KOMA 1X5OA 3K5HA 3M05A 4DZ6A 1MC5A 4Q21A 2R6DA 4DMFA 2QLXA 3CNEA 3G0CA 2M1XA 1JA1A 4YRAA 4QOEA 2Y6VA 4X8LA 3J7TA 2GN8A 4WKRA 4DNOA 3LDGA 4D3SA 4JU9A 3EUWA 3GPIA 1QHHB 2VC1A 4DF4A 1IRIA 1E2KA 3SC3A 2BJDA 1ULAA 2ONYA 1X6VA 3W5VA 4MPJA 2V68A 5HP4A 4N3BA 3LY9A 4F96A 3WNDA 1UBKS 1GMUA 1JDTA 1OQAA 4RELA 2ENUA 4HVLA 5L4LA 2VL7A 3GJ4A 2QTBA 4D6XA 2RILA 3OJSA 2V94A 1BWQA 4C2UA 2BL4A 3CVOA 5JCJA 1S8FA 1HE3A 2YRXA 4EZ9A 3MMAB 2P62A 1MH1A 1EESA 3RLIA 1KBRA 1FMJA 4NC9A 3LTNC 4GGPA 5JJLA 3LGMA 1IKVA 4TL9A 3PIIA 2YH2A 3GRYA 4HI0E 1WOMA 3MMJA 2D5AA 2MJLA 4OZ3A 3L6DA 1FFXA 4XVUA 4ASUD 4M9QA 1CUSA 4LJMA 5EIOA 1S01A 1RRFA 1YRAA 3AVPA 3KHLA 3R3SA 4GPD1 1RRKA 1HKHA 2HFKA 1F8YA 3PF9A 2PMEA 3MECB 1EA7A 5DN6D 4CCYB 1J90A 2BHNA 2I9KA 5CAAA 3BGLA 1MRNA 1AK1A 3QXCA 3JQEA 2FQQB 1LSOA 1P5RA 5IDYA 5L7YA 2XZDB 5K0EA 2PANA 4DEVA 3K96A 4I50A 4K40A 1OAAA 2GRJA 2XUOA 2BRLA 1RT2B 4LF7F 2H4ZA 2LZ0A 1HE5A 4LJRA 4GRAA 4N5HX 5AKZA 4EWTA 4TS3A 5KDDA 2CJKA 4DYDA 3ZV3A 5KG2A 1V3QE 3PGVA 5HR5A 1NL3A 3HBMA 3TLMA 5DBEX 1IKYA 4V0LA 2A9KA 4JY7A 4XR9A 2ROGA 3LH2S 1H22A 3KAQA 3O1LA 2VA9A 3HJTA 5CB4B 4QREA 5K3CA 4OYOA 4CF7A 3ESCA 3JYTB 2QE6A 1XELA 2XOXA 3U9TA 1GGFA 4INPA 1IHOA 2PV0A 3GRFA 1LZKA 2JEGA 5AXAA 4D8VA 2C2MB 4BL5A 4FONA 4JI1F 1R50A 1XP5A 4QPZA 3IV6A 2HG4A 1R88A 1QM9A 2ZH3A 4MJ7A 2ZIWB 2J5KA 3OUTA 3ADDA 2VBIA 3PX2A 4DV5F 2ANCA 3B1XA 4P2BA 2GDZA 1N2CB 4G6ZA 1RVV1 1WEZA 2E6KA 1D04A 1TE2A 1ZM2A 4BB0A 2A0XA 1KDRA 2XSZA 2ZSFA 4BC0A 3A1SA 3O31A 2XMWA 4G4SO 4QICA 3DDNA 5HRUA 4RR5A 2JBAB 3LDAA 2NO1A 3P0FA 4C5AA 1CXZA 3HJNA 3TBHA 2VH2A 1XRPA 3VZCA 1NBOA 4DQSA 3L7OA 2F17A 4O3FA 3T3NA 3M1LA 4NH4A 1SCDA 3KYJB 1M2JA 1PKUA 4RENA 1U0JA 1MAHA 4DFKA 2R5NA 3V7UA 5C32A 4FS2A 5T41A 1LWNA 1DIOB 4ZAYA 5B7NA 2FP4B 1SL2A 3WLSA 1EK0A 4PQUA 1FK8A 2UYHA 1RTKA 4G07A 3JY6A 3K5IA 1SUSA 1K27A 5KG6A 1SB9A 1WPQA 3P9ZA 3ZY4A 1TKXA 2C95A 1L7RA 3OIDA 2HJ9A 1XDSA 2BGLA 3H90A 4INOA 1K1SA 4AROA 3ECAA 4WKOA 3E7FA 5BMVB 4OAPA 1TL3A 3DMFA 4LDQA 1J2TA 5L3SA 3KZCA 4CQ1A 4B3BA 2FOXA 4Q01A 2HN9A 2YWDA 4C8ZA 3LKVA 1Q1QA 1UC5B 3IJRA 2JJMA 2JGFA 2O2XA 5FI1B 4Y28C 1KHWA 3MHYA 5DM0A 1URRA 4CLYA 2J48A 4ER6A 4EITA 2NQ2C 4IX1A 4JLSA 1T2AA 4BP9A 2R3VA 3MEGB 5B1EA 3Q2TC 3H11B 1SO8A 3L6CA 1E1MA 4Q03A 5JBIA 3W2VB 1Y8RB 1I5OA 2PQ2A 1PZMA 2PZAA 3NORA 3OUUA 2BEFA 2EKYA 1JL3A 3OKPA 3HU1A 3AKDA 3EG9A 4OLOA 5K14A 2JNJA 3TF5A 2XZOA 3SC4A 3T3EA 2GZRA 5ICEA 3VMMA 4RHEA 2QAGC 3CQ9A 1REVA 3GJSA 5A2QY 1XMOF 3IMKA 3V4RA 4MWZA 3X43A 5BR8J 4ETWA 5A62A 3C1TA 4LWOA 2WVAA 3L7KA 4O4GA 5JVDF 4E0BA 2X8WA 4UBLA 1AKVA 3G96A 4PAAA 1J5XA 3EZ6A 2DYAA 1SG6A 4WFZA 3IVGA 3U56A 4CM5A 3CT6A 1X8LA 4LDNA 4OXNA 1T91A 4J9VA 4R01A 2PFSA 1YZFA 2YX1A 1AJEA 4ZA2A 3UJAA 3T7JA 2OHXA 4IGEA 4U6PA 4N6GA 3FF4A 2O54A 2AFVA 3OVMA 4ZWNA 5BORA 1JJIA 5T4HA 3CJQA 4TKVB 4U7DA 3O94A 1YJXA 1N3YA 4PLCA 1UVMA 4UEOA 1QSSA 2W4CA 2B25A 4PYLA 5AKKA 2IXDA 3MWEB 4YLYA 5A8RA 1KEUA 4H2DA 2E4ZA 2QLMA 2AB0A 3S44A 3VO2A 1CQXA 3BRSA 1CS4C 1CQIB 2W4DA 1V4NA 1IKVB 3TG2A 3R8XA 2Y0SD 4YN3B 3KJGA 2RHLA 3I52A 4ZCKA 3HR7A 6NULA 2W9BB 1ORIA 2YJTD 3OCWA 4AXBA 1DJQA 1XYGA 3MM5A 5F3WB 3Q7SA 4NQZA 1CG6A 5AICA 4P32A 2UXBB 3DLEB 2X3UA 2ZRFA 5G0SA 1VECA 3ZDRA 1EUDA 2GJ8A 4OHMA 2YS6A 3AUUA 5BOVA 3PU6A 4X6YA 3VUFA 3IPAA 1DC6A 3OLXA 2A3RA 3WG9A 4B3MF 3K9LA 6PFKA 4G4JA 3PNMA 1GAWA 1B7YB 4D9CA 2Y76A 1P9YA 5CYMA 1BE0A 2R3SA 3BH7B 4QYSA 1KZ6A 1J39A 1VJRA 4RD1A 1Q4RA 4K9OA 4RUHA 3L6EA 2QNIA 1PSDA 3PTAA 3W9UA 1BKSB 3TUPA 2WF7A 3RBDA 1EG2A 4ZN6A 4B3OA 1UMBA 4R1PA 1KQFB 3OQVA 4JUIA 5JSUA 5G4KB 4EYIB 2HHSA 2GCFA 3ZV6A 2VJUA 2L9WA 4OGKA 3VHXB 3UMMA 2Z2IA 1ADGA 3BS4A 1RKBA 2V9CA 5CA1F 1E4EA 1Q17A 5E3PA 4TPKA 3JQAB 1PW5A 4EOGA 1TKRA 5JV5A 4BWVA 3C16A 3CZ4A 4IO1A 3U4HA 2QSYA 2Q6OA 2C8JA 1CQWA 2YOHA 5TF4A 4EB0A 3DFFA 2PVCA 5AOCA 2QRHA 5EESA 3NXZA 5I4CA 4U67Q 2R0QC 5LPNA 3HCXA 1JXLA 4DRYA 4OLAA 2ZJRQ 3CVWA 3CDAA 2MZ1A 2ODBA 5AD1A 5KU7A 3GRAA 4QDJA 4XCQA 4Y2YA 1SBTA 1GGVA 3IQXA 1A8IA 3EQZA