4AUKA

Crystal structure of c2498 2'-o-ribose methyltransferase rlmm from escherichia coli
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
357
structure length
355
Chain Sequence
MNKVVLLCRPGFEKECAAEITDKAGQREIFGFARVKENAGYVIYECYQPDDGDKLIRELPFSSLIFARQWFVVGELLQHLPPEDRITPIVGMLQGVVEKGGELRVEVADTNESKELLKFCRKFTVPLRAALRDAGVLANYETPKRPVVHVFFIAPGCYTGYSYSNNNSPFYMGIPRLKFPADAPSRSTLKLEEAFHVFIPADEWDERLANGMWAVDLGAPGGWTYQLVKRNMWVYSVDNGPMAQSLMDTGQVTWLREDGFKFRPTRSNISWMVCDMVEKPAKVAALMAQWLVNGWCRETIFNLKLPMKKRYEEVSHNLAYIQAQLDEHGINAQIQARQLYHDREEVTVHVRRIWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Rlmm, the 2'O-Ribose Methyltransferase for C2498 of Escherichia Coli 23S Rrna.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords RIBOSOMAL RNA LARGE SUBUNIT METHYLTRANSFERASE M
total genus 118
structure length 355
sequence length 357
chains with identical sequence B
ec nomenclature ec 2.1.1.186: 23S rRNA (cytidine(2498)-2'-O)-methyltransferase.
pdb deposition date 2012-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01728 FtsJ FtsJ-like methyltransferase
A PF18125 RlmM_FDX RlmM ferredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2810 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4aukA01
3.30.2300.20 Alpha Beta 2-Layer Sandwich THUMP fold THUMP fold 4aukA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4aukA03
3OFKA 3B5IA 1X1DA 2NXNA 5D1HA 5BW4A 2FHPA 4GUAA 1IM8A 4CWAA 5IKMA 4RTJA 4RVGA 5HZMA 2QRVB 1O54A 5FHQA 1UWVA 4E70A 2NP6A 3PS9A 4R8SA 4CTJA 3P9CA 2FCAA 3EVGA 5DX0A 5K0LA 5DTQA 3FPEA 1MHTA 1JQDA 2ZW9A 5EKUA 4E2WA 2NXEA 3LCVB 3P2KA 4KWCA 1N2XA 3FPJA 2GPYA 1G38A 2B25A 3EVAA 3UJ8A 1XDUA 1N7IA 5DXAA 5C9ZA 2GA9A 2AS0A 1ZGJA 1P1CA 4AX8A 3LPMA 2ZZMA 5K0NA 3B3JA 5E9JA 2R6ZA 3EGVA 1RJFA 2OB1A 1XDSA 2OPBA 3DUWA 2C7QA 4HRAA 3UJBA 4OA8A 1RJGA 4MHTA 3KPWA 4OBXA 4ER3A 3AXTA 4PWYA 5ICEA 2EG5A 5EC8A 3LHDA 4GC5A 5GP1A 1NW6A 2UYOA 2FPOA 2O57A 1JR4A 1I1NA 4F84A 3E23A 4ATNA 4GOLD 4EKIA 4ISCA 5E9WA 1R6AA 3B3GA 3KKZA 3RW9A 4IWNA 3B3FA 2P41A 2GAFA 4EKGA 3UA4A 4RTNA 3A7DA 1KP9A 3A26A 4GBED 1T43A 1VE3A 4DA4A 2GH1A 1WXWA 1I4WA 4RTPA 2OYRA 4PGGA 1Y8CA 3NVMB 4FT2A 5LQAA 3VYWA 3FPFA 4FGZA 4YV1A 3DXYA 3LKZA 3HA3A 4WXHA 4E2YA 5FCDA 3P9KA 4QQKA 3JWHA 3NVKI 1UFKA 3DOUA 1G8AA 2B3TA 3HVHA 2O0LA 3I58A 5CVEA 2PJDA 4E30A 3UBTA 3G2MA 4GEKA 3TM4A 3V97A 3HTXA 3CJRA 5K0EA 2B78A 3EVZA 4PINA 5DM1A 2G71A 3P2EA 4V0QA 1AV6A 2ONZA 4AUKA 5FADA 3C6KA 3G7UA 1BKYA 4FP9A 2A14A 1JQEA 3FPHA 5DTMA 3LCUA 3PLAE 3QOXA 2VZ9A 3BGIA 4RVFA 4AZWA 2AOVA 2AOWA 3P97A 5EHIA 4BP1A 2JHPA 4GOND 5DTRA 4EK9A 2CL5A 3C0KA 5GIPE 4C05A 1NW8A 3EVFA 3FPGA 5ERGB 5LQKA 4U7TB 4GQBA 5G02A 4KIGA 1SUSA 4C08A 2PVCA 5DWQA 4RTQA 3C6MA 3PX2A 4IV0A 3KR2A 1ZHFA 2AOTB 3R6TA 4GF5A 1RJDA 4E32A 3ELYA 5FULA 3UJCA 4PYNA 4IKPA 2JG3A 3MHTA 2XVMA 3KQTA 3D2LA 1SG9A 2VP3A 3KHKA 4EQZA 5GINE 4RX1A 5D1NA 5FQOA 5EG5A 2P35A 5C1IA 2JHAA 2QRVA 5HEKA 2ZULA 2PXCA 1X19A 2ZBQA 2NYUA 3HCAA 1G60A 1NV8A 1XDZA 4DMGA 1NKVA 3MTIA 4M37A 2HNKA 3FTCA 3CC8A 4KIFA 3TFWA 1G55A 3ELWA 3A4TA 3GRZA 3LGAA 2R3SA 3FYDA 4RTOA 3GXOA 5MHTA 1WS6A 1MJFA 2AN4A 3C3PA 3REOA 1IXKA 1KXZA 3OZTA 1DUSA 4FS8A 3SM3A 3G2PA 2I62A 3M6VA 4LWOA 4XUEA 5K0BA 1WY7A 5CCBA 2BR5A 3LBYA 4V0RA 3EEYA 4XUDA 3UJAA 4BP3A 4OX9Y 3L8DA 5HOQA 1WXXA 4FZVA 3G5TA 5KQSA 1EJ0A 1HNNA 5EMKA 3UZUA 3MAGA 3P9IA 3BWYA 1PJZA 3G88A 3R9XB 1EIZA 1F3LA 1YZ3A 1NT2A 3FUUA 3MB5A 4HH4A 3LDFA 4RWZA 1KPIA 4R05A 2P7IA 3TKYA 3GNLA 2Z6UA 1L3IA 4X63A 5P8WA 4F86A 1AQIA 3TRKA 2E5WA 3SMQA 2AOUB 5EZQA 2XVAA 3ME5A 4LG1A 5EGSA 3M33A 2AN5A 4FR0A 4RVHA 5T67A 5K0JA 3G5LA 2YQZA 3P9NA 5CVDA 3KR1A 4P7FA 4X60A 1ORIA 2N47A 3UJ6A 5EMMA 1QAQA 2O05A 5CCXA 1VL5A 4PNEA 5LQJA 4YUVA 1R18A 1SKMA 2F8LA 2HWKA 2C7RA 3HVJA 2Z6QA 4POOA 5LQUA 3NMUF 2JH8A 2FYTA 3FRIA 1L9KA 3BZBA 3I53A 4KDCA 4PGHA 2UYHA 4E2XA 3MQ2A 1VLMA 2ZZKA 3HCEA 3IHTA 5LR6A 4QTTB 1JSXA 3HCFA 3B7PA 1D2HA 1ORHA 4EMSA 3DMHA 2YXEA 3KQWA 2PY6A 3EMBA 4GOMD 1RI1A 5DM0A 1VPTA 5F2NA 5FA8A 1SVUA 2IGTA 4M38A 5DRYA 3LDUA 1IY9A 4RSRA 5E8JA 3DMFA 4OQEA 3DLIA 4C4AA 2PGXA 4AZSA 2C7OA 3E7PA 3KPYA 3TKAA 2OO3A 2IH4A 4X41A 3MCTA 3DR5A 5FA5A 4RTSA 3K0BA 3P2IA 4L7VA 1EAMA 3R3HA 3M70A 4X61A 2O06A 1YZHA 2EJUA 2AOUA 3HCDA 4K6MA 5FWDA 5GIOE 3P71T 4ER6A 1QAOA 5FWAA 4M7RA 2PX4A 4RTLA 5JR3A 1FJXA 3AY0A 3JWIA 2PX8A 5K0CA 3I5UA 4CXMA 5F2OA 5LSAA 3ERCA 3BGDA 3HCBA 3R0QA 2OY0A 2ZTHA 3LKDA 1KPGA 3NW9A 2PSSA 2ADMA 3AWIA 4DZRA 1R8XA 3E8SA 2XYRA 2PBFA 5C0OE 3NDIA 3SSMA 2IDJA 3LX6A 5DX8A 5BXYA 3EPPA 4AZTA 3NJRA 2H00A 3KQQA 5IH3A 5EZSA 4YV2A 3FTFA 2PLWA 1XTPA 5ICCA 2CMHA 3BKWA 1G6Q1 3T7SA 8MHTA 3HEMA 3V8VA 3NDJA 5EIFA 3G2QA 3GRVA 3WSTA 1KYWA 1R00A 3B89A 1WG8A 2Y1XA 3VSEA 4IV8A 5LQNA 1V39A 3EGIA 5EVJA 1FP2A 5K09A 2I9KA 3IEIA 2V74B 3FZGA 4P7JA 3OPNA 4E2ZA 3G8AA 5GOZA 4RTRA 3I9FA 3PTAA 3G8BA 5ICGA 2PX5A 1QZZA 3UWPA 3H2BA 4CTKA 5H02A 3X0DA 5KYGA 3S68A 2PXXA 3CGGA 3HP7A 5DPMA 2UZ4A 2YUIA 1TW2A 2YX1A 2PWYA 3ANXA 3ID6C 2HMYB 2BM9A 2GS9A 2UYQA 3FRHA 3NWEA 2GLUA 3QV2A 4M36A 5E1BA 5E1DA 1XJ5A 3HCCA 5DM2A 3TPZA 1NW7A 1RJEA 2BM8A 2QYOA 1L1EA 3GJYA 3M6XA 4QTUB 2YVLA 5FQNA 1I9GA 4CKCA 2DPMA 2ESRA 3P8ZA 5DLYA 2BH2A 1BC5A 5EMLA 3TM5A 2OXTA 2H1RA 1OR8A 3T0IA 2BR4A 4RTKA 2QE6A 1YFLA 4XCXA 2QY6A 4FSXA 2LD4A 2ZVJA 4P7GA 3NWBA 3A7EA 4ER0A 3SR4A 3T7RA 1ZKDA 4ER5A 3OU6A 3ER8A 3KQSA 2P3LA 4YUZA 1D2GA 3SGLA 3DMGA 3LCCA 2CWWA 2I6GA 1KYZA 3LECA 3LSTA 4QPNA 4X1OA 5CUQA 5DT2A 2PT6A 3CVOA 3F4KA 2OZVA 3PT9A 4MIKA 2ZWVA 3FTEA 3KPJA 3LL7A 5EHGA 3DP7A 1H1DA 3UJ7A 1JG1A 4CKBA 3EMDA 1JTFA 1RI5A 4YMGA 2EJTA 3PB3A 3UJ9A 4AZVA 1Q0TA 5HIKA 1RI4A 2ZIGA 2H11A 1O9HA 3ORHA 3UFBA 3HVKA 4HTFB 2NNWB 3OU7A 4WVLA 1KR5A 1NW3A 1R8YA 3BKXA 1TW3A 1O9GA 5HFJA 1YB2A 2YR0A 4H0NA 5LQCA 4JXJA 5E2AA 2ZZNA 1AQJA 1EJ6A 2EFJA 2AZTA 3DLCA 4UOEA 5E9QA 2AOTA 1L3CA 4DCGA 2ONYA 1RI2A 3R24A 4C04A 4DCMA 2P3OA 2FRXA 1VQ1A 4E33A 1F38A 1FPQA 2OKCA 3Q87B 4DM3A 2NXJA 2BZGA 2ZBRA 2G8NA 3BUSA 5KVAA 2JHCA 3O4FA 2G72A 1KPHA 3QOWA 4A6EA 2ZWAA 1DCTA 2PXAA 3ER9A 7MHTA 1AF7A 4RYLA 4PYLA 3GWZA 1JG4A 1Z3CA 4PIMA 4Y30A 5DM4A 2P1DA 3LBFA 4BLUA 1PRYA 2PWPA 3PFGA 3DH0A 1KHHA 2ERCA 4PYIA 1INLA 1D2CA 1JG3A 1JSZA 2CKDA 3BWMA 3EVBA 3EVDA 5E1OA 3UA3A 5BP7A 3KQPA 3AXSA 3FUWA 3EVEA 4C03A 4GOOD 2PKWA 3SXJA 5K8VA 3CJTA 3CJQA 2ZCJA 3G89A 2IIPA 3BXOA 4DF3A 10MHA 2NP7A 1P39A 1Q0SA 2VDWA 3M6UA 3GU3A 3FUVA 3THSA 2C7PA 4R6XA 4MWZA 4PYOA 3OE4A 4LECA 4KDRA 2BR3A 5EIWA 2IBTA 1M6YA 5E1MA 2IH2A 2ZLBA 5LQRA 4QVKA 4RTMA 4KVZA 1FBNA 1QYRA 2K4MA 4BY9E 2AVNA 3PFHA 4QPPA 1SUIA 3OE5A 2VDUE 3TOSA 5T64A 2B2CA 1KIAA 1NBHA 1X1CA 2XYVA 1G8SA 4YMHA 4A6DA 5DSXA 3MERA 3GIWA 2XBMA 2ZIFA 3HA5A 3KPUA 1HMYA 5E2BA 5K01A 5EOVA 2Z6AA 1L3BA 3DXXA 3T7TA 4Y2HA 3A25A 1XCJA 1NBIA 2IFTA 1VBFA 4PYJA 3ELUA 2YXDA 4HG2A 4P58A 3MGGA 2IDKA 5DRTA 5GWXA 5HILA 3IYLW 5DX1A 4QDKA 5CVJA 4R8RA 1NW5A 3GGDA 5E8RA 2V7EA 4YUYA 3GRRA 3KU1A 1UIRA 3KPVA 2Y1WA 3VC1A 4FT4A 4HGYA 5HIMA 4PONA 3DTNA 3OFJA 1JG2A 1YFJA 2AVDA 3BWBA 1YF3A 3JWGA 1XXLA 1VIDA 3FTDA 4MTLA 1SQFA 1U2ZA 3GRYA 3HNRA 3O7WA 3OU2A 3PVCA 3DULA 3O31A 4XUCA 3RODA 4YV0A 5KS2A 3EEOA 3KR9A 2IP2A 4BLVA 2PT9A 4QQNA 4PCAA 3SSOA 3NTVA 5B1SA 3TQSA 4C07A 5K0GA 4Z2YA 4GC9A 4U7PB 2AR0A 2IBSA 4HGZA 3CKKA 4PYKA 3TR6A 1ZQ9A 2XYQA 1RI3A 2FK7A 3EVCA 1ZG3A 5CD1A 3GO4A 5F2KA 2UYCA 1BHJA 1FP1D 2CMGA 3HVIA 3LDGA 2B9EA 5HIJA 4F85A 5K03A 2P40A 3FUTA 5T6BA 2P7HA 2WA1A 3GDHA 4KW7A 4HTFA 5JUWA 2O07A 4HSGA 4EVIA 3CCFA 4E31A 4YUWA 4RVDA 3C3YA 4QVGA 4BLWA 5CVUA 1P91A 5EQJB 3HA7A 4QDJA 4ZTBA 1M6EX 1DL5A 2ZSUA 5FHRA 3KQYA 2HV9A 1EG2A 5DXJA 4C06A 5BW5A 3IV6A 4NECA 4PYMA 5ICFA 2IH5A 4B17A 1ZGAA 3MTEA 3KQVA 4PIPA 3M4XA 2ZFUA 3K6RA 4P7KA 2WK1A 4MQ4A 2VDVE 2YXLA 4OBWA 4LWPA 4DKJA 1R74A 2QM3A 1XCLA 2AN3A 1VP9A 1NV9A 3OCJA 2ORED 5U4XA 3CBGA 2ZBPA 5EEGA 3A27A 3OZRA 4G56A 3SSNA 4HC4A 9MHTA 1NE2A 2HTEA 5M5BA 1P1BA 5GM1A 3BWCA 5EPEA 2EX4A 1QANA 3KQMA 4O29A 4CKEA 2AOXA 4R6WA 3G2OA 2DULA 3JWJA 4ER7A 2JJQA 5CIYA 1JTEA 3RIEA 3UJDA 1SQGA 2G70A 1QAMA 2YTZA 2NXCA 3ELDA 3KR0A 2PV0A 2I7CA 1X1BA 2VS1A 4OQDA 3GRUA 3KQOA 5GM2A 2GB4A 4OA5A 1B42A 5K0FA 3Q7EA 5DSTA 1BOOA 1YUBA 2IPXA 3AJDA 4YUXA 3FYCA 3HM2A 4DQ0A 3TLJA 3VC2A 5FTWA 2P3QA 1N7JA 2KW5A 2HR1A 1VP3A 4PCLA 3SVZA 3U81A 1TPYA 2Q41A 3BGVA 3M6WA 3PX3A 4RV9A 5K05A 2ZIEA 3EGEA 5EKXA 2OBFA 5HIIA 5KQRA 1M0EA 3FUXA 3GCZA 3MCZA 5EMJA 5FUBA 2G1PA 5EEHA 1WZNA 5CVVA 3I64A 3THRA 2OB2A 5CM2Z 4FSDA 2P8JA 3DXZA 2FK8A 1EQAA 3OZSA 2JH9A 4KRGA 1XVAA 3E05A 3SX0A 1JQ3A 3BT7A 2WA2A 3TMAA 1X1AA 2PX2A 4PYQA
chains in the Genus database with same CATH superfamily
1UA1A 4G9GA 4UJ3A 4AJ4A 4INZA 1K1SA 3B6JA 2GZAA 5T4HA 1WKJA 4JSYA 5LVAA 4U7CA 1A4RA 1ZGJA 3R7WB 3U3ZA 2LCWA 4IKAA 2RB4A 3RSZA 3IS3A 4LQCA 4X1KA 4DWWA 3ABIA 5A76A 5GY7A 4PABA 2XCAA 3DNMA 4PYRA 2B4QA 2JIPA 1Y1SA 1CUIA 3KLBA 3OZVA 1WBDA 2VDNB 4MKHA 3PKZA 4H4CA 2ZDQA 3K0CC 3QKSB 4RHXA 2YYYA 3VNSA 2D62A 2RH4A 2ZB7A 4O3RA 3GAMA 1RQLA 1UW4A 1JIIA 4UHKA 3T41A 2JGDB 4P5EA 1U8XX 1KARA 1AZTA 4URYR 4MS1A 3UW1A 1ID8A 2IXBA 2XR1A 1I7LA 5IMBA 1K5PA 5K3FA 2C2BA 3UAOA 3A8IA 4NJOA 2QTCA 3SF0A 3HKEA 5JMPA 3OTOB 4XFDA 2GA8A 1FNSA 1C0LA 1SXGA 2DR9A 2QTZA 3UVJB 1R0BG 5CA5A 1T8WA 4ZV4A 2O2XA 2KM8C 2I6FA 1PGJA 4WOJA 1QVWA 4RD6A 5LR6A 1YA6A 2FVXA 1Q7CA 1TR0A 2D6FA 2FVQA 2HS4A 4WV3A 3LFTA 1LDGA 1K27A 4MB6A 1JLFA 1I5OA 1R9MA 4IZOA 2HB6A 3R0QA 1KPGA 3HPRA 2Y6VA 3DE5X 1VI5A 5BV2P 3KX2A 3P19A 2H00A 4P33A 3G6XA 5A0FA 2X4LA 4PZEA 1GXSA 4YRSA 3N8KA 4GKJF 2CJAA 3AF1A 3R2DJ 4FF3A 2Q2VA 2EARA 5K8CA 3ZH2A 1FVOA 3TXAA 4CM7A 5EJ2A 3TW8B 2IKQA 1FW8A 3PGA1 4LI0A 3FYUB 3QTLA 4H4DA 1QYIA 2CE7A 2GS9A 4LWQA 1YQHA 2PRYA 3RTVA 1PLLA 4ZYUA 2H1RA 4QNRA 2PSHA 3OQ6A 1YRXA 3R3TA 4Z4FA 2CHUA 4NCNA 3G96A 4FYHA 4BGDA 1QUFA 4UEOA 2PGDA 3A4IA 2FRDC 3IO3A 4WVLA 2CNKB 3R5CA 1FDOA 3LK6A 2YVQA 4PS0A 3SS7X 3RSGA 4ZVSB 3EXFB 1AF7A 3MYRA 1C1XA 1ZITA 1RYNA 3QRQA 1UFQA 4OMFG 5KYWA 3D8BA 3RAMA 1NUSA 3IODA 2Q29A 4BO8A 2OTLS 3TRJA 3QZ8A 1JJ2R 4IDPA 3HGMA 3M6UA 2WZBA 3FBTA 3V8RA 1VQMS 1PK9A 4EHAA 2FSHA 3O9VA 4MROA 2BYCA 3TOSA 2ZIFA 3LW5C 5EUBA 4NOLA 3CJ8A 4HR2A 1H2AS 3BFXA 5IJ0B 1GRRA 5KT4A 1OTXA 4P2GA 3QLVA 2NZXA 3H97A 2FDXA 4I99A 2G2ZA 3L04A 3FUYA 2EFCB 3ESRA 4CG2A 4U7PB 1Z4JA 1EGAA 3KT0A 4MA5A 3DKRA 4KTQA 1ZG3A 1A5ZA 2FEPA 2AW3A 2O2CA 2RMKA 2FHJA 3MQFA 4WNIA 2J0EA 1Z2CA 3LP8A 1E3MA 1OQ6A 2OP1A 3I0ZA 4HJRA 1T9GS 4IYRA 4CF7A 4OHYA 4RV5A 4LWPA 4ED1A 4J0FA 3W8EA 4TX1A 1Z62A 1ESZA 5AW7A 5H83A 5FT9A 1A4XA 1JH9A 3GR6A 2CJWB 3HS3A 3SEFA 2FUG9 2FZLA 2HQOA 3O21A 1Z13A 3CSKA 1IKXB 2C61A 2KT3A 2VYNA 3L01A 1NRKA 4HWRA 4TKMA 1UT8A 3WB9A 4M9SA 1UINA 1R0CB 2FZ5A 2QYCA 3LA0A 4YCBA 4IQ0A 4MYCA 1IBCA 2ZP1A 2DJ5A 1SIBE 1E9BA 4NCKA 1GDHA 2G06A 4PSAA 1JB9A 4ZKDA 1K8YB 2V1UA 4BASA 2GV1A 2E7ZA 1G9SA 3BSAA 1YK1A 1ZCFA 3L0ZA 2ZRIA 4E22A 5BUCA 2H3HA 2HSEA 3EGDB 2FC9A 3Q2OA 2V8DA 4DBZA 1CJKC 2ORVA 4ND7A 3UCEA 1S99A 1F2VA 1WTCA 1REQB 4PBSA 3E7XA 2RGDA 4N56A 1HQEA 3E2IA 2WYHA 2PJDA 3V97A 4W92B 1Y1RA 2KRBA 2JFGA 3ROGA 4C6AA 2JLFA 3DBLB 4KBIA 3TNDA 3UDCA 1ZTTA 4KPCA 1TECE 4BP1A 3MECA 4P36A 2DPGA 5AVUA 1M5RA 2BMAA 3ITHA 3RHTA 4N7RA 4PAMA 1UXKA 4OZ5A 1UFRA 2MZJA 4IIJB 2CPIA 4KQ6A 2OLJA 1WG4A 5BUZA 3UM9A 3QENA 4KREA 1AXEA 1UEKA 3W0LB 4BYMA 3S40A 3HXMA 1AX9A 2DERA 5DBOA 2WP0A 1YX2A 3NHBA 1AZLA 1L3IA 1W6RA 3FYUA 2XMKA 4P32A 2R4FA 1E9FA 2XMZA 1Z8FA 3SHVA 4JP5A 3WHIA 1KFCB 4F7DA 4O2LA 4WN9B 3ULKA 5KYTA 5CB4F 5C42A 2CPYA 1SEPA 3LP1A 1RHUA 3W6UA 1U1IA 1JHQA 3HCFA 4RXUA 5BYRA 4QYMA 4LGYA 5AHWA 1RADB 5AI4A 3LBIA 2GNKA 3T1HF 1V96A 4V03A 1Q17A 1F60B 3DR5A 1UXHA 2HXYA 4CL0A 1W1UA 4Z0TA 4ZXPA 1NVUQ 1E94E 1UF9A 2GYVA 1XAIA 2CUNA 1K6IA 5DLDA 2W48A 4B75A 2CHFA 1F0YA 5BXYA 3AYXB 2ZXUA 3IKVA 5KYWB 2ZAGA 1X31C 4JP1A 4BIMA 1XNHA 2EBWA 1N3IA 2R7SA 3KB6A 1PYOB 4HAIA 1NK0A 4M21A 1IKWB 3LIIA 1V5WA 1S2GA 2D2XA 4ALIA 2G88A 2UUOA 4Y00A 5NLLA 2BD0A 1PJ8A 3W1VA 1Y42X 2BM9A 5A4JA 1U5BA 2FJDB 4QJ4A 3ZE6A 3CF6R 4D99A 4M1TA 4QBGB 4YT4A 5LFAA 4LF6J 1TL3B 1PIWA 1NE7A 4R7GA 1LDMA 3T7RA 1EIYB 1HBJA 3UMFA 4RORA 2RJ3A 1BJKA 2R9LA 4EHBA 3BXGA 3FTEA 1GL7A 3R7NB 1RI4A 4YACA 2ROEA 3THTA 1DAXA 1IB6A 4XDZA 4EKDA 1RI2A 4TVKA 2PKQO 3JQBC 2HYIC 5LP6F 3H2LA 1N2CB 4DV5B 4PAOA 1B3TA 1PQ4A 4Y6QA 4EGLA 5L7WA 5GGYA 4P2BA 4ND2A 4J9PA 2GVZB 3C16A 2ORWA 4A91A 3NYIA 2OSRA 3K0EA 4NE9A 3DEHA 4HYYA 1OUMA 4KDEA 5LB2A 2HZCA 3UFXA 2N1BA 5E6RB 1E1LA 1TM7E 5AVTA 5JOQA 4TS4A 2XMTA 4ZZ3A 1RCOB 3A3NA 2FF5A 4QODA 4UHEA 3KOWA 1PZGA 1B0VA 1B6TA 4Y18A 1FVXA 2HA4A 4FI3F 4KSYA 1JKJA 2FKNA 2AJ8A 2ODBA 3E9RA 5D3GA 1GMVA 5C24B 5A7FA 1K9MT 2Y92A 3FWPA 4F2SA 4L15A 2H54B 1A97A 3Q9UA 3SFZA 4CRWB 4Q18A 3GMGA 1HR0J 3ZTYA 3D0HE 3TZZA 4CKCB 4CO1A 1JLBB 3LP2B 2PPLA 1ECGA 1UVLA 4ECQA 3KT3A 1G4UR 1JJ4A 4DR7F 3JVDA 2F3PA 2AJ1A 4MIBA 2DU8A 3VQSA 3MIZA 2LYVA 5C7PA 2ST1A 1T9DA 1U8UA 5U4XA 3C2QA 4D8UA 2R7NA 1CHNA 3KLHB 3F3YA 1FWKA 2LCIA 3N9IA 4ZFNA 5LNK6 2NTYC 2JD2A 4G36A 1RHRA 3MHPA 1KJYA 3U5ZB 1HT3A 2QUJA 3KR0A 4Y6RA 3ICVA 1CUFA 5EL0A 1JN0A 5AVRA 3VPGA 2G2YA 2ZT7A 2NT3A 1YJ8A 3FPSA 1Y1TA 2OBFA 2AHOA 2P6TA 4FILA 4ZT7A 4WY8A 4FKXA 2DGOA 3E05A 1ZJ6A 1ACMB 3E1SA 3Q2TC 4DS3A 1FSGA 3H1GA 3VBEA 2BFDA 4MVJD 4QFBA 1ZP6A 1UBHS 2ZB2A 2GR9A 1PF7E 1E0KA 4P80A 5EJ9A 3TA1A 1JV2B 3V6DB 1HETA 4LFAF 1NDUA 5C18A 4ATNA 4CPDA 1UK7A 3K1JA 1YSCA 4A8PA 4K9QA 2AUNA 4RTPA 1GGFA 3DVQX 1XHEA 1PO6A 1FDVA 3JWEA 2ZYUX 2L08A 3QVWA 2RHGB 3HFVA 2W2PP 2GHTA 3TW0A 4DQQA 3DOUA 4PQEA 4TY8B 3HTXA 3EEQA 2Z57B 1A9NB 2SBTA 1SBNE 3PLAE 3FNFA 4GR9A 4RVFA 1PR9A 5AVZA 5HR5A 2I8EA 2VNHA 1EE9A 1CP2A 1N5RA 4WK6A 3KR2A 3WICA 1LB1B 2CNWA 3MWDA 2D69A 1QGYA 3OQ2A 3BGOP 2FG5A 1JWAB 3HCAA 3P45A 5LMCA 1YACA 3BBBA 3GBPA 2B4YA 4JEMA 2PYZA 4G4GA 4MS4B 5AW8A 4E1VA 5DHRA 1M0WA 2BR5A 2QE7A 3WLPA 1S89A 2D3ZA 5CYMB 3NL0A 4Y6PA 3HVUA 1U1MA 4L4SA 2O20A 3TX8A 4I1TA 1CRLA 5TGZA 1N5TA 4ZEVA 1A69A 5CA1F 4F5DA 3W2VA 2JAUA 1IBRA 1P5RA 4FKMA 3U1MA 2D5IA 5LBUA 1SXJD 1ZOIA 3SE7A 5BUSA 3O8QB 2FWBA 1U8TA 3L0DA 4P2MA 1PZNA 3Q9SA 3TEFA 2QT9A 3EH2A 3C16C 2A1UA 4M7OA 3WL8A 8RUCA 3LP0B 1G5HA 4EZIA 1TDJA 1KS2A 3RNLA 4PF1A 4HLUA 4MW7A 4DRXA 2LLZA 3Q3CA 2CXHA 4A47A 3GA0A 3WDKA 4BKOA 1QIEA 4M0PA 5T6MA 4BFVA 3IVGA 4J03A 3WWZA 1D6NA 1TYAE 2Q4OA 3BVPA 4LRUA 1U0SA 1JSLA 5FF9A 3QPWA 2O7QA 4IH1A 5ER9A 1ZOOA 1DZ5A 2YZ7A 3WSTA 4JMLA 4HZIA 1LXCA 5I8ZA 4YEDA 3HE3A 4FHCA 1PBTA 3NAMA 3M1IA 1WW3A 2QLLA 3I9FA 5KYGA 4LXGA 3VGJA 4M88A 1F2TA 1G9XA 5DPMA 3MEDB 4BMNA 3K8ZA 2HQ3A 3CULA 3ABQB 1XJ5A 5JFGA 5CLFA 2DPMA 2PLNA 5FDLA 2H65A 4DXLA 1ANKA 1JHUA 1CDEA 1M5HA 2XTNA 2L2QA 1TMJA 4R1QA 1E2GA 3ESAA 1AKEA 2Z2KA 5A2GA 4YMGA 5K7SA 1FLNA 3RR7A 4K6KA 3MA0A 1QG6A 1EGHA 4AJ2A 1CZOA 3ROTA 4MWGA 2C3PA 2FMTA 5KFVA 3AHJA 1F38A 3D4BA 3B54A 1X86B 2HBZB 1DKUA 1YCFA 3PIOQ 1GR0A 4OK3A 3LPCA 3WK8A 3PHHA 4C2BA 2OLEA 3VVLA 3H87A 1QGUB 2RT3A 3CINA 1HC7A 4KN5A 1KWKA 1YKGA 2A9JA 4MGYR 1LWEA 4E15A 4CV0A 3LT2A 3PFBA 3W8DA 3K8QA 5D4LA 1SL2A 3KYIB 2ZH8A 3QE9Y 9ATCB 1I6MA 5IVIA 4BLSA 2YY7A 1YJBA 4LOAA 1QYRA 4BN0A 3IDAA 3RFUA 1CUYA 5JNTA 5C1BA 4UBMA 3E5MA 1FDWA 4RA9A 2P9CA 1IQ0A 1L3BA 4F5ZA 2W4DA 3LOPA 1B6SA 1Z07A 2O0JA 1V16B 1JLQB 4OZ0A 2ZRDA 2JJ4D 4GBMA 1U1CA 2JDIA 4AUMA 4KFUA 2G8LA 1XMBA 2CZ4A 2IP2A 1VHQA 4MHTA 1SV5B 2BEVA 4OXRA 4DDTA 3BEDA 1FW6A 3AF3A 3CDEA 3IULA 2J8AA 1ZA1B 4WT7A 5F3RA 3ZGXA 1DBDA 9ABPA 1NW4A 4DCNA 3O9MA 3LQ4A 1LA2A 4Z7CA 3PTZA 2PKQP 5DFAA 2I6TA 3M4XA 1MX5A 2QX7A 1KEEB 3PJFA 2UUAJ 4ITSA 3QLUC 3NS7B 4JI3B 4AY5A 3GP3A 1UMKA 3G5MA 1HTBA 3FJ2A 2BY4A 3CKYA 5J2PA 1EINA 2BHLA 3EG9B 3BSSA 1NDCA 4JB2A 1RKJA 5F8JA 2GVZC 4OQDA 3JALA 4CTAA 4KRXA 4V0KA 5CA0A 2B36A 2SHKA 2D1QA 3L1HA 1NPRA 2BM0A 1IK4A 1IJFA 1UIMA 2KDOA 1JDBB 4ENSA 1U1QA 1Y1PA 1V6HA 3QXXA 5FI5A 3BT7A 3OL9A 2Q8QA 5U9CA 3ETCA 4MZDA 3HFGA 3PJXA 3D6TB 2JB9A 2JL9A 1W85A 3MMCA 4U7JA 1CFZA 3ISND 2IE8A 1BXKA 1N2BA 2XB4A 1UMCB 1YAHA 1U1GA 1GQEA 1EK1A 4E1BA 1WW2A 4OMCA 2QUZA 3E35A 3EB9A 4NHOA 4GC5A 2I03A 2PLFA 4I14A 2HT1A 1GL3A 4YFUA 3CCZA 2GBGA 2XE4A 4OBBA 3FPFA 3WLKX 4JVMA 3EBPA 4AQYB 2WAYA 1J56A 3AF6A 4P71A 3L9XA 2ACKA 4A27A 2PU5A 3GH3A 1SURA 5BOSB 3SEZA 5K9FA 1E5TA 1SBYA 3EXHC 3WJAA 2EJBA 5EE9A 5BYBA 4EFAC 3A04A 3EC2A 4MV1A 4FBMA 3MTIA 1WZEA 2IZ7A 2QZPA 1YR6A 1Y4ZA 2LU2A 2X1AA 1IDOA 1D1SA 4JBXA 1VS3A 1S2DA 1PJ6A 3IMEA 1XYGA 3IOYA 3Q8YA 4FJ1A 4XWYA 3U62A 5T7LA 2XIJA 1KE2A 4ES6A 2G0IA 4LQLA 2IYUA 3THPA 3V33A 1YZTA 4MYHA 4EG8A 3C85A 1NDKA 4RLSA 3DLKA 2SKCA 2VQFF 4NLUA 2DBQA 5D51S 1WHSB 4EUVA 3L6RA 2E55A 3DG9A 2DR2A 1D8AA 2J8SA 2LU1A 4J75A 1RI1A 4W9NC 2BACA 4EEZA 3KPYA 5IXJA 2LECA 4J76A 3F6EX 4TV9B 5KINB 1MX1A 3I8SA 4JSTA 1S96A 4FDLA 3CUSA 3LANA 4KNVA 3PD0A 1WF1A 1SB9A 3GLHA 2QN6B 1T0PA 1LPNA 3HUTA 2O54A 1UETA 1SCBA 3CEAA 3LLMA 2GAAA 4OREX 3NJRA 1SC6A 3UR3C 1RAAB 2R97A 1LK7A 5EZSA 2J7PA 2G80A 5IM5A 1T24A 6GPBA 4FYPA 3SD7A 4RUAA 5K09A 1SFRA 4MDYA 1I5RA 3VOTA 2ZVQX 2P11A 3W4IA 2NZUG 1FRXA 1F9EB 1J5XA 2J67A 5LQSA 4RNFA 4YJHB 4RQTA 3BO3A 1KI3A 5LXRA 5LWQA 2E5LJ 3VDXA 1A2OA 1WNTA 5IAEA 4JZYA 4M8NE 3PE3A 1GPNA 3OU6A 1Q22A 3S27A 1A8UA 3RC1A 2E9TA 3A4LA 1OTHA 4YAEA 2O19A 1EGQA 1YA8A 3DBOB 1KR5A 1GH8A 3I56S 1AQJA 3QWAA 1IFXA 3Q1KA 1SUBA 5CYQB 1HDOA 3EY9A 1RM5A 1IULA 1KPHA 3HJTA 3ZKWA 2PMFA 2IVMA 2EX1A 2JAWA 3MJCA 1G2QA 3FMFA 4PGAA 5JWRA 4HHEA 2F1HA 2DJWA 4MVJM 4ZP1A 2EZTA 3NHZA 1UKZA 2GJAA 4WYWA 3VUEA 1SC4A 3LVQE 3UAYA 1QR2A 1JXEA 1FQOA 3WK6A 2VOEA 4LVOA 4NJEA 3ZI4A 1GCIA 5ILQA 4ZCKA 2H5JA 3RB4A 1VGQA 4BNGA 3F1LA 3RIGA 1GTSA 3O2JA 1QG0A 2MQOA 1R8HA 1PT7A 2ZSIA 2X0JA 4IG0B 3MERA 4WLFA 4ARSA 1T1RA 1GTG1 3Q0TA 2IDKA 5DRTA 4MVJF 4BPBA 2XY6A 3I9OA 2W2OP 2OXEA 4OL8A 3LOUA 1E9DA 1OYOA 3L8YA 4LMZA 2V0CA 5JSZB 2QTNA 3GCGA 2IW3A 4ZZIA 4XDCA 1W9HA 4BNKA 4ZOLA 4B2IA 4PYAA 4BTEA 3HGTA 5BRNA 5HMYA 3TE6A 8ATCB 2XS5A 4QEKA 1AB8A 3RC3A 4L73A 4CLFA 4MIAA 4AJHA 1HBOA 3ZXSA 4EG4A 5I3QA 1VJRA 3O3NB 1OHHA 1QORA 2WJJA 1Z39A 2BZ2A 2J5KA 3ZQJA 2O8DA 3THYB 4PXBA 4X00A 3JYHA 1MZPA 1G8JA 2R47A 4C8KA 1VPEA 1XZAA 5ALIA 3ILOA 4MVJP 3W05A 3ZE1B 5M7EA 4HR7A 3AVUA 4QGGA 2NZCA 2NXCA 1HKHA 3F3SA 4DLGA 4EYOA 3GJQB 3NB0A 1Q91A 3OPYA 2RJNA 4MQLA 2DCUA 2W2NA 3DV2A 4OJQA 4D9KA 5C8XA 2AUMA 4DIEA 4LW8A 2RVJA 5BSGA 4H35A 2N9UA 3QITA 1QOZA 5ALXA 1HEUA 1IJEA 2HRRA 2RBGA 4EG1A 8AT1A 4GP9A 4CWAA 4DB2A 4I6YA 4KT0C 4E70A 4CTJA 4LYYA 1N0IA 5EX3A 3BS4A 2OGSA 3FPJA 3M2RB 5ETMA 4QU6A 5DXAA 1LRKA 3OIVA 3FZBA 1K3UB 1Y3FE 3NPAA 3OOEA 2MZRA 5A5DA 4AN1A 1OXTA 3NHWA 2OECA 1Y3JA 3QVKA 4WK1A 4I55F 5B55A 2VO1A 1C1CA 2CPDA 2NSDA 5B3JC 1GPLA 4GMDA 4YNBA 4B3FX 2Y2UA 4JLMA 3RFFA 1R10A 2QL9A 1DAKA 4NCAA 1RBOB 2J5QA 4U6PA 3TW6A 2YVUA 3G49A 1P7PA 3DONA 2HBYA 2XNHA 1R27B 4LBYA 5JAMA 1EDBA 1TTPB 1U6BA 5HP1B 1TB4A 1KC3A 2Y3YA 5C8YF 3RRXA 1VKJA 4TYMA 3F71A 3I0SB 5JXWA 4DL4A 2HHQA 2GRJA 4WXOA 3PGLA 4JYBA 1F0XA 3CNHA 3E18A 5TIIA 1U0HA 1WS6A 3VYTB 2DQSA 4OAOA 2BKEA 5B0BA 4U7WA 2R86A 2J0XA 1G2IA 2C04A 3GUHA 1SH7A 5F8MA 3H5AA 421PA 1Y6GA 2HLTA 1U02A 2O67A 2CDQA 4FBUA 2ZBDA 4O02B 2BGRA 3VGVA 1C7QA 3RU3A 5KT3A 5DDOC 4TTAA 1ZX1A 4OYPA 2K1RB 3T3EA 4LJSA 4JGGA 5B4VA 1EUDB 3Q0EA 1JYSA 2AYXA 3A8TA 3T3DA 1BKDR 4DV7B 3M8QA 5A6WA 1WUTA 3L4SO 1BWVA 3ICQB 5JTTA 1T3TA 3MJSA 3NEAA 3JVIA 4QSHA 2YH1A 5D3KA 4WCDA 2R7LA 3TL2A 1UTAA 1IBLF 4EPWA 4QPXA 3ZCSA 2RCYA 2QG9B 1CLFA 3LPYA 4YDQA 1EGMB 1GQ2A 5JHHB 3NAZA 2OGZA 4URXR 4M8SA 3QVGB 1W5FA 1A5BB 2C2RA 2O1SA 3UMSA 4R0EA 2BAGA 1TYZA 4XAQA 4NBNA 3DT9A 3GIDA 1PWXA 1NP7A 1E9RA 3TA0A 1QE1A 5A6SB 4CLRA 4IFYA 4MVXA 3TNJA 1JHMA 2XQFA 5G0RA 2PX3A 4ZI3A 1K08A 4DV4F 4ZVQA 4PUOB 4K4UA 5FWXB 1EFPA 2ID9A 4FNHA 2A1TS 4LXIA 4XX1A 1UK8A 1R16A 3UH0A 1EARA 4PCUA 1TVCA 2Z2LA 2DT9A 4ZEMA 1I9CA 1P4SA 4O1IA 3W5XA 1NH8A 5DQIA 4L0MA 1U0GA 4G01B 1GTJ1 2QS9A 3HVKA 4JQZA 4D46A 2CXEA 1N77A 4I66A 4QDXA 5DETA 5KAPA 3QX7A 1Y1LA 1RAHA 3C7CB 1PAEX 3CN9A 2F40A 3RB6A 2EKDA 2CKWA 3GCWP 3EGZA 3PFFA 2PXAA 4GOKA 2BRLA 4ZCMA 4BBAA 3EGWB 2C97A 2OMEA 1NATA 2VWHA 4RIEA 3GJ8A 3T5LA 5C37A 1TP7A 3IQEA 2Q2OA 2ILTA 1EQUA 2MDTA 1CY4A 1SBQA 3CX7A 2BFPA 4RQBA 1MA3A 1O08A 1L3KA 4CM8B 5JAHA 3R1HA 1XMPA 1II8A 4HTJA 3L7DA 4A8QA 1YRQA 1RMYA 4OHPA 3PWZA 4FOLA 1ZM3A 4X91A 4IDAA 2HK9A 1Q7TA 3D28A 3H2YA 3BSOA 1NMSA 3U7HB 3RH0A 3NV7A 2D3UA 1NW5A 4A73A 5FTMA 1T36B 2FSVC 5LU9A 5LT5A 2QOEA 1IOLA 3TCXB 1S0OA 3GRYA 4LF7J 1WP9A 4QW8A 3KK2A 3KR9A 3L4JA 5IBCA 2HI0A 1X13A 5F8IA 4MP6A 2VNKA 4H4KC 4DQLA 4WZ6A 1LQTA 3RAPR 1BHJA 5FAXA 3WIOA 1F3FA 3NMRA 2Y1KA 4C2MA 3OPMA 3ZIUA 3MTEA 4AM8A 5DASA 1T0TV 4F4FA 1XCLA 5BSEA 4FMPA 4HC4A 3JS9A 3G2JA 4IIJF 4EG5A 1FF9A 3R3UA 1J22A 3K9GA 3GPDG 3LDHA 1JA1A 3M82A 3C4QA 1ZYUA 1SHUX 2CHEA 3TJAA 4LS3A 4OBEA 3T5CA 4UM7A 3V8NA 1YZYA 1NVEA 1GCOA 1L7DA 4D3DA 1CUCA 1NPKA 3RYHB 1UWCA 5FIIA 2P8JA 4U4AA 1XVAA 4MKFA 3CO5A 4FWBA 1U65A 1KYVA 1X1DA 3C3WA 2UZ3A 1XPUA 3CT4A 3RUFA 1W87A 1J0AA 5JCOC 4HT5A 4ZPCA 5HF6A 2PE5A 3C14B 4TLRA 2CQHA 2EG5A 4EYSA 2J3DA 3C5HA 4U8HA 2P41A 4D3ZA 4W5WA 2ZD1B 1DTEA 1ZGGA 4DQPA 3E01A 2VPZA 1A9SA 2E4UA 3PGKA 5HO4A 4PINA 3H42B 1M5OC 5AQEA 3W5ZA 1RZVA 2C94A 2TRSB 2GO7A 1I7SB 3GZNB 3U0VA 1MRNA 2Z1DA 4KWIA 3MXTA 2HMIA 1K6EA 2RQ4A 3MVEA 3UE2A 2X5JO 1CFJA 2RBKA 4DG9A 2A2ZA 4JLDA 1CJTA 4O4IA 5C5JA 1BCRB 3IBSA 1PV2A 2AYZA 1NV8A 5CT5A 1W44A 4QHTA 3KJNA 5KDOA 2GIRA 5GAHU 3ZU5A 3US5A 5AHOA 4EG7A 3L8DA 1LK5A 2HVHA 1HNNA 2UUCJ 4QIFA 3P9IA 1JKHA 1SQ6A 1MH9A 3F5QA 4BNTA 1QGUA 4X65J 1HV8A 2WWIA 4LUCA 4ZV7A 1XKLA 2CNNA 1KI4A 1FMFA 4Q1FA 4Q2MA 4K4TA 4LOLA 4F4AA 1BE8A 3MJ4A 2OPPB 2XDAA 1N4DA 4Y1GA 1PYDA 5RUBA 4NEZA 2Z30A 4AJNA 3ZE9A 2R00A 4E94A 5JNLA 1ZMOA 4JJFA 2OTCA 1EJ7L 2J9ZB 3AEUB 4TXLA 1GCGA 4RA6A 1VC0A 2XUGA 3PXUA 2KB2A 1ZA2B 4CMKA 3MOJB 4JYAF 3RYIB 1P6QA 4RIFA 2C2OA 2Q5CA 2JCBA 2KB0A 1KD1T 2HAIA 4ERXA 3K89A 1CNFA 4YV2A 2WB2A 2PO7A 2XB2A 2IHTA 3UK2A 4XTTA 1TX4B 3IEIA 3UHAA 4FWTA 2OQRA 2XGPA 3PT5A 1B99A 3GLVA 2JJ2D 2AZ3A 2J0UB 1PDOA 1PI3A 1ZPWX 2AEFA 2IUEA 4BNUA 2JBAA 3S3TA 1LFPA 4IQGA 1THMA 3NOVA 1MX3A 4NCJA 5I9IA 5J4HA 1OA0A 4YHHF 2KXFA 1CJKA 1H72C 1Y10A 4YDDB 2DXDA 5ALRA 1QRSA 3G71S 5KG2A 2GCEA 1SRQA 3QT8A 5L1JA 4A6EA 4F9EA 3QFRA 1PIEA 1UWBA 3PYEA 2G28A 1XA0A 4UUPA 2BEWA 3IA2A 3ZJVA 1RLCL 2W2VA 4MQEA 4ZOBA 3CRQA 1XROA 3BD7A 1DJMA 4NWIA 1DEKA 1J90A 2R7MA 3LYAA 2GMWA 2HFVA 4BTLA 3OZXA 3TSCA 1N5YB 2R2TA 1XX6A 3S44A 2B9WA 5LOVF 1JDTA 4QA9A 3FCCA 4UPEA 3ZJTA 1X5TA 4ENOA 2XYVA 4Q05A 4CF3A 3J7YU 1VBFA 3IQXA 2YBVA 3H4TA 2YFYA 2ILYA 5AM3A 3RR2A 4MRMB 3C6UB 1XVTA 3OVBA 3BZQA 3NM4A 5CYJA 4LF9B 1DQSA 3DBRA 5GGXA 2RF2B 3RW7A 3DHVA 3VO2A 2WSSA 1KFJB 2XY4A 3FGOA 1G8GA 3OKPA 3D2WA 4XEUA 5KFPA 5AW5A 2REQA 2NQ8A 1TUEA 3KVOA 3TSAA 3F7MA 4LHEA 3KQYA 2CL6X 5JD5A 3R6DA 2QRRA 2I6UA 1PG5A 4OX9B 3KHUA 1GG9A 1V7ZA 1J70A 2DE0X 3E81A 2YKGA 1XWIA 4IZIA 3RIEA 3V1MA 3NCQA 1JXLA 3SCJE 4CIAA 2A10A 4P86A 1VMDA 4AN0A 2WIGA 3ACDA 2EKLA 1Z6GA 2X8WA 1XG5A 5KCZA 1E2MA 3K35A 1OX4B 3Q7QA 1UBTS 3BB5A 2I3GA 5BJRA 2YHIB 4W5HA 4KPGA 3V4OA 2J9FA 1CUWA 4IH7A 1M0EA 1KO4A 4M49A 4QSMA 1EXVA 1YDGA 3E22B 2RU3A 3K0FB 4K1LA 2PX2A 4Z1MD 2KT5A 3QLHA 3A6KA 1ZJJA 4B6FA 4L5CA 3HB1A 4ILMA 3VGTA 5I9NA 3P9CA 4C7MA 3LAKA 3T3FA 3DM2B 3QYAA 3AJRA 4ZP6A 3G1TA 2IWRA 4KHMA 2VTBA 5ARCA 1XPOA 5HLFB 4TUYF 3JU3A 5DP2A 5AUNB 5L9XA 2Q6VA 2ZH1A 1KR2A 4MR8B 2FPOA 3T7KA 1QRRA 1DKPA 2CXOA 2GFQA 4PLCA 1RYYA 1DQ8A 4HACA 3VFDA 4KC5A 3FHJA 5BQ3A 4MHSA 1WXWA 2PKXA 2QVBA 2PYIA 3K6KA 2DPJA 4DFJA 4HYEA 5F33A 3ZLUA 1XT6A 1V6AA 3P2EA 2NV0A 3QATA 5KWJA 4PN3A 1C2YA 2G9ZA 1PEYA 4ON9A 4GZMA 4S1VA 1NZJA 5AHXA 1SJ9A 5GV8A 4BU0A 3AEUA 5EWEA 5DI3A 3OJXA 1U2SA 4K6GA 1YZ7A 2PVPA 4KAAA 3HA2A 5DHPA 3MAAA 2PRIA 2F63A 1Q81T 4HH0A 2Y1LB 1K97A 4H7KA 1C3LA 2Z58A 3TLGA 1I3MA 3PWSA 4QJ5A 2XT9A 1DAFA 4V0RA 1SBHA 4N48A 4FFWA 3OUTA 3EPIA 3OQ1A 1JRLA 3BGFA 4AJLA 2OHJA 1L6RA 2I91A 4EA9A 5GAHI 3FDIA 2XF2A 3HMKA 5KHLB 5K20A 3F0NA 2AJLI 2MCFA 1PT5A 4Z4IA 1EQ2A 1GEHA 4KJZA 1ONOA 5C1DA 3BGUA 2R5NA 4HS9A 2GQ2A 4AMUA 3CLSD 4EMSA 4IG0A 5HRAA 1X5PA 2LIVA 3N2KA 5F2NA 2RKIA 1YITS 2B1JA 3K09A 5JS2A 5LLSA 3G3EA 4MV0A 3GCXP 4EGCB 3CFYA 5JRDS 3KNZA 1R8XA 4L27A 3E0XA 2MTLA 4ZOLB 4CIDA 3NNCA 1IZ0A 2D7SA 3OZIA 3TZCA 2F4FA 1GLNA 2GEJA 1F2GA 3NDJA 3AEYA 3M1VA 3OWXA 3WHPA 1Z5WA 2EFOA 3V4IB 2O01C 2BGKA 3VH3A 3W66A 1JHVA 1QZZA 5J1NA 5B37A 1REVA 1TW2A 3MT7A 3F5SA 1AZSB 3DD1A 4O59O 2C2GA 3NXSA 1WC1A 2AHRA 2CZQA 1QOPB 2FGCA 2CLLB 3D6UA 2V3CC 2CRLA 1N34F 1FD2A 3ZV5A 1O5JA 1LPSA 3PT9A 2O6HA 3NT5A 4DT1B 1CWUA 4Q1AA 4UOQA 1Z8DA 1POXA 4DV3J 2WE7A 1UUFA 3S99A 4FE7A 4CCWA 4OVKA 4G5XA 3OJFA 2ONYA 2AKEA 4UQTA 5LJ5Y 4M94A 3C1TA 4DPYA 3DC7A 2CADA 4BJ1A 5LA6A 2NQ2C 4HB0A 1YJXA 5BN5B 5K4GA 4EUFA 2NU8A 3AINA 1NX9A 3EASA 1WSBA 3FH0A 4OYZA 5B4TA 3UT5B 1DG3A 2C2XA 1OASA 3AKDA 3AUYA 4U9HS 3JAMA 4HI1A 3CCCA 2ARKA 3ZWOA 4RS4A 2DGXA 2E7XA 4H0CA 1CY7A 2WHPA 3QJJA 1VL2A 3M9WA 4Q00A 1PFVA 2O8NA 1RTZA 4RIGA 1UIRA 3I76A 1CVRA 1OB2A 1HWKA 1P9YA 3MM5B 1JG2A 3GR0A 1MO2A 3UB3A 4FDAA 4UZSA 5C5CA 2FZWA 5DGXA 4QG7A 4LRTB 2WFLA 4RZXA 4PYKA 3S1AA 4OSEA 3PXBA 3EVCA 3AEQB 2H2FA 2PDAA 3NYQA 4LVCA 3HFSA 3OJCA 2NU7B 1GZVA 3A8EA 4RR5A 4XWGA 4Q4AB 3T1HB 4NEYA 3MZ0A 2HHPA 5BR8B 2ANBA 4TTIA 3UD3P 2QUAA 1VXOA 2H1IA 1Q3TA 3GV0A 3MMZA 3F2IA 2RH3A 5HQMA 1USWA 2EQ5A 4F0KA 2QNBA 3HSJA 3K0AA 4TY8A 4TMWA 2FZEA 3OCJA 4FEGA 3QTBA 3IMGA 1OH6A 3ZH9B 4F46A 4Z0NA 2PRKA 2V5AA 2EAUA 3WK5A 5CYGA 2B98A 2WC1A 2J9DA 1JE0A 3JQ7A 2QX6A 4ZOCA 2YZGA 4PRFA 5JZVA 3UN5A 1NI4A 2DUJA 3HJRA 3RRBA 1ZUD1 1ZJ5A 3SYMA 3BGVA 3ZD7A 1I0LA 3KYCA 4EIWA 5GVRA 4LOJA 2AG6A 1KI6B 2BFCB 5C1PA 2ZUEA 5IFMA 1I0ZA 4UUXA 4XCQA 4YRMA 2C92A 3GLSA 1OXUA 3C19A 1XGKA 1X7GA 1X9MA 2HA6A 4PSKA 2ISQA 3QKIA 2NCKL 2AYMA 4HVAA 4GX1A 4YJFA 1X7WB 4B3RB 2JLSA 4NS1A 3H7IA 3ANTA 2GILA 2MEWA 2IC3A 3VF0B 3DBIA 2PRJA 4B3MB 2O50A 5D7NA 5C9ZA 5DOVA 1IR1A 1GILA 2DWOA 4OBXA 1JYFA 3I2YX 4QBIA 2H2AA 4NONA 3F41A 1LLFA 1R31A 2ZM6J 2NO1A 4GI3A 1L8XA 2AHOB 2DRBA 1NQVA 3HA3A 3GB9A 3MM4A 3EPJA 1DO2A 2HLNA 2XGJA 3LP0A 1CQJB 2YV5A 2JRLA 2H4WB 3CYFA 4OY3A 3BGIA 1HKAA 1E6LA 3M7VA 3GFRA 2VBWA 3CDBA 2ROGA 2FPPA 4Q02A 5J9FA 1IVYA 1TFYA 1M7HA 1UWAA 4WX2B 4F50A 1V71A 1FVSA 1DGQA 5MFZA 3NG1A 3CD5A 1D9AA 2G5CA 4F3CA 3PUVA 3GRZA 2YYSA 2A9FA 3GRKA 2VJVA 2AB0A 4FB4A 1VYVA 2V3WA 3G59A 2WWWA 1N32F 4N8NA 2EL9A 5EXEA 1VG0B 1E2JA 4M5MA 2Z6UA 1P9NA 3H1BA 3IERA 3RVLA 4X71A 4O5OA 4DV2J 5EHQA 3EDYA 2BDUA 3HN7A 4NYJR 3N2GA 2R6HA 4LF4J 1YJVA 3QNMA 2Q4RA 4OTZA 5E4YA 2JARA 1X7XA 2ID4A 1UOPA 1R8JA 5E8JA 1OPRA 3R9WA 3D0IE 3HZRA 4KR6A 5KWSA 2MWMA 4MARA 4QPZA 5I42B 1NAIA 3NW9A 2QIPA 2OBLA 3HWSA 2PSSA 4Q3LA 2UVDA 1O0SA 4US1R 4X4NA 1CUJA 2W2MP 2FLPA 3H2SA 3ZZTA 2J7WA 1W29A 2NPIA 3UGQA 3GONA 2ODWA 3KBOA 2ZR9A 3CDAA 3EZGA 4BQQA 2XYPA 4KPYA 2WY2D 5C35A 1VRWA 1T5BA 1CRPA 3R5JB 4U6QA 1JLQA 4Q03A 2Z5GA 5DKFA 5B30A 4M9CA 2WBRA 5K03A 5FQNA 1N1EA 2FEOA 2BKNA 2LQBA 2A0FA 4L3VA 1VQLS 3T0IA 4XCXA 3L7PA 3HU5A 5AUOB 2FHJD 1D2GA 2QYGA 2C95A 5E6UA 4RULA 2WKWA 3M5WA 2QSJA 3BBLA 1JFFA 4QFCA 3R76A 2QV0A 5HX7A 3IH5A 1EJ6A 1QFXA 3IEPA 5AXAA 4HNTA 3IRXA 2FRXA 3SS8A 3OMWA 2B7BA 3WLFA 1XB2A 4DQKA 3R3ZA 4B2YA 1HYSA 4JFRA 3ESXA 1Q1EA 1E60A 4F4YA 2IDLA 4BVAA 2TYSB 2UVWA 2QZ9A 1WKKA 2B30A 3GYNA 2UU9J 3IM8A 3C15B 2F1KA 5KUTA 3MAQA 3THSA 1CT9A 1K75A 2RHTA 3TIVA 1ESCA 4IUCS 4ZIWA 5KWVA 4MMXB 1OGYA 4DC0A 1O7JA 2MLYA 2R48A 2B8TA 3UHFA 5IJ9B 3VU3A 4EHDA 3E3AA 1G59A 3A6JA 3EN0A 4YJ2A 3HB9A 3GLHE 3WG9A 4XARA 4YVFA 3K0SA 3TLCA 2ALYB 4KOEC 2HF2A 3WV4A 1N6HA 1I30A 2B56A 3SSOA 1S6PB 2GN8A 1NVDA 4HGZA 1PBUA 4GL2A 1BWRA 1LWFA 4E46A 3KZOA 2AZMA 4U95A 4ZJZA 2VDMB 1MAHA 3IMQJ 1MU0A 4E31A 4ALKA 1XZEA 4GNRA 1SU7A 5FOWA 2CFXA 4N0PA 1U0SY 2B69A 3NFYA 3P9PA 2YXLA 1KVSA 2IUFA 3HI4A 2FFJA 3E27A 2QRKA 1BZYA 3ELHA 3SJAA 2BL4A 3G0HA 1VJDA 4JYAB 3QBDA 4IFIA 1QAMA 4GZLA 4MKAA 4BPRA 2HPZA 4MFBB 4FBTA 2ONJA 5FTWA 4D4KA 3IUPA 3A70A 1US8B 1U11A 4WEOA 1Q92A 2OO4A 3Q8SB 2YJ3A 1T5DX 1Z5UA 1WKLA 1J8DA 2F3SA 3R9KA 4Z9XA 1E6MA 3O4GA 2OXIA 1J2RA 4ANDA 1VG8A 1TA9A 1PSZA 3SR0A 4P3KA 2GSDA 3GLGB 4KR3A 2VHXA 4RJJA 3MTDA 1V4NA 1AXQA 1YOVB 1C14A 4L3OA 3OQPA 2IDMA 4IWYA 2LRHA 3ZIAD 4E2WA 5KTQA 2J9YB 2ZKTA 1CVJA 3DM5A 4UHDA 5HWSA 4IDKA 4TLAA 5EC8A 2XSZA 4HWOA 1U3FA 1GA6A 4X6LA 6FD1A 1F8FA 1TIPA 4ZAWA 3NXZA 4Q43A 3PQEA 3IQHX 1FJGF 1CRZA 3EE6A 3IJEB 3PC7A 4WKGA 3I58A 4CG3A 3BC1A 4AO6A 5DYIA 4RW8A 2QL7B 4G3XA 4KFSA 3IPCA 2IZ5A 3U3DA 3GLHB 1JG7A 2JHPA 3L7KA 3L41A 4CT8A 4JI7F 2ZI7A 5IT9U 5FORA 2ZUUA 1JJFA 3PX2A 1QPBA 4MQMA 4CM4A 2DCLA 1VYUA 4TVOA 2YYAA 3WWOA 1YHYA 1EP3B 1E3QA 1ZH6A 2VDQB 2LXUA 2H29A 1BDJA 5LLTA 1E7YA 1ZIPA 3RGWS 4JI0B 1IBCB 3W63A 3UXHA 3IDSA 5EESA 2V6IA 1OLUA 4KC0A 1TZJA 2PN1A 4II3A 4P7TA 1EUZA 2V7PA 2O8VA 4RCZA 2CBXA 4HBGA 1BAPA 5IFKA 2VA9A 1YTLA 1QFZA 4KY3A 5G3YA 2R7VA 1M8FA 2ASEA 4XB6B 2WUGA 1SKMA 4D81A 1LPMA 1D7AA 5F76A 4KXVA 2MKIA 2LE0A 3PCRB 4BVHA 1BHO1 1A4UA 1Z0FA 3LCJA 2PQ0A 4GSYA 2B8WA 4RGYA 3AFMA 4Q24A 5FA5A 1JLRA 1WM1A 3AHEA 3RFVA 1XD9A 2ZUDA 1JLBA 3LP2A 1NF8A 2V9PA 3PYDA 3QUQA 3OOSA 2J4DA 2I4MA 2Z09A 2DUUA 2EGGA 1KNQA 3ASVA 1M9NA 4G1CA 4C3LA 3OO0A 4YT5A 4FZ5A 3H59A 1TQHA 2X0EA 1RT1A 4UVIA 2Y8WA 1BQ3A 5I4IA 1VL0A 1U81A 2FDNA 3FMOB 3TAPA 4LHXA 4FYKA 5DN9A 4F3MA 2DTXA 2OWDA 4Y9SA 5HQ3B 1XXHB 2G1UA 5K8UA 1I9GA 1EX6A 2WBMA 3UCFA 5CDGA 2XLBA 3KB2A 3ER8A 3WLAA 3PE4A 2G3YA 2QIOA 2QJWA 3GCWA 1SKBA 4I9GA 3U4QA 1A8HA 3ZK9A 4DNPA 5AK0A 2J6UA 1LDYA 1JU4A 3RBZA 3ZZYA 3QKRB 2A92A 3D4LA 2ZIGA 3Q11A 4DC1A 2NNWB 5B3JA 2VB6A 4KIWA 4HDAA 3I6ZA 1ZK4A 5BWBA 1VYAA 1PJ2A 5DM7Q 4F8JA 1WXDA 4GDMA 5IC5A 4OJ3A 3CURA 3TQIA 1QV7A 4PEOA 4LSMA 3BF4A 3X1KA 1KHHA 3GFBA 4EGJA 5ARBA 4C0SA 2A9PA 3OVMA 4AXIA 1VDZA 5GQSA 4BBYA 5KFCA 4H3SA 4MRSA 4P3NA 2FN3A 1JEQA 4XYGA 1LW0A 1NBWB 3KETA 4KAIA 4YHBA 3CX8A 5IUJC 1B8NA 1KAQA 1QRDA 1ULZA 4KQGA 3GIWA 3IGVA 1LX7A 1TU4A 2XA1A 2OQVA 5GONA 3OESA 1WOPA 5JS1A 1MMFB 3EULA 3GT4A 1AA1B 4EKYA 1FSZA 3BXPA 4UCQA 3KPVA 4OHUA 4NPCA 2P6MA 4WE1A 3NGMA 2NUPB 5IJAA 3IIEA 3AOCA 2DRDA 3GWGA 3H2GA 1PNOA 2FZGA 3AB2B 3KDPA 3ZBTA 1JDJA 3LDGA 2VA8A 4JLOA 2P40A 5T6BA 1JXMA 3JQ6A 1SXPA 4HSGA 2BELA 4MSUA 4L9AA 1FY2A 3W5BA 3U13A 3MR5A 3WO0A 3SSAA 4NZ7A 4BAGA 1FXWA 3ZKAA 4RELA 3ZWKA 1AH2A 4PCVA 4L22A 2HQ1A 3OPQA 3RHZA 4LR8A 3KLMX 3T19A 5AM5A 3DM9B 1FUUA 2DT5A 2EG1A 2AV5A 4JI0F 3P0FA 3K1AB 3TDNA 1KEVA 1HNIA 3QNWB 3GIKA 4USWA 1SCKA 1X92A 5L1LA 5EIOA 4WDQA 3VAHA 1QX4A 1RT3A 4ZAXA 1PWZA 4H6XA 4YMUA 4D41A 2ZSAA 4F8RA 4PZUA 3I64A 1BOFA 3TTWA 2J1LA 1XZMA 4LF6B 4TYPA 3KJHA 3OX2A 2Q49A 2J9GA 4DUZF 3ZV7A 3V4PB 4BE4A 3OT1B 4OIMA 3IR7A 1IONA 4JZKA 2B5WA 2DIRA 2RKIB 2X4GA 1A96A 3NTRA 4XB2A 1QIDA 1G0NA 4EVRA 4EO6A 4ELTA 3AEZA 3I01A 1J6UA 4PTZA 1TQ6A 4ZPBA 3I9JA 4IUBS 1WZ2A 5E9JA 3I82A 2N42A 2DITA 2VLIA 2NOAA 1QLWA 3DLJA 2Q5OA 3RW9A 4CLWA 3B3FA 4H1VA 4XOUA 3BE8A 4JI2B 5DIZA 1U31A 2GM3A 4CZCA 1PQUA 3VHQA 1JAHA 3HHLC 3QIAA 3CJKA 1J8MF 4FOSA 2IPLA 2WABA 2M6KA 2IBMA 3WMGA 5MLCV 4M4SA 2VZ9A 1W4BA 2B8NA 4Q4DA 2Z9DA 1ZCZA 3FLBA 4KDFA 5AUPB 3JTMA 4FYIA 4X66F 1SUSA 4YAKA 1SCIA 4QQBA 1NLFA 4GF5A 1C9DB 3C8DA 1N1MA 3E3XA 3MM7A 1DG9A 2C8LA 4CCYB 2ZSKA 3LK7A 2ZUCA 1GK8A 1ZESA 4DMGA 2HCRA 3ZHQA 4D98A 1NMZA 3UN3A 3V5RA 4JV2A 1ACMA 5CZXA 3DWEX 1N6IA 4ZEOA 2KN4A 1W52X 3V7YA 3WLSA 3PFOA 4CNZA 3T6BA 2QAGB 3P27A 5HDBB 5K9ZA 2A9OA 5EZQA 2EFGA 5I7FA 4RVHA 2ZJAA 1RA6A 2HSGA 2C20A 2E7WA 1PR6A 1U0TA 4DHEA 2DUWA 2X3GA 4V0ME 2O8EA 1Q20A 4N77A 4X7MA 1XMSA 3PCTA 4OFXA 2HU8A 3COWA 2CQ2A 1XVUA 1UBCA 4QU5A 3SZOA 4V2UA 1C9NA 1Z2NX 2XKAA 1KTVA 2P90A 1Q8BA 2YVAA 3OLAA 3M2VA 3LYLA 2ERYA 2WZQA 4ICIA 2Z2ZA 2JGFA 3S81A 3ZXIA 3W5SA 4DLWA 1WO8A 1M10A 1RLOA 1R9JA 2FZ4A 2WYIA 4DL2A 4G4IA 5FPQA 3SSMA 1IIRA 4GPTA 3SS9X 1DE0A 4LRDA 5T7BA 1WOMA 2YFQA 2MJNA 5LMUB 1VGRA 1JI3A 5GMEA 4NHEA 2NQPA 1YRYE 4OLBA 3M2UA 3PWTA 4UAJA 1DUVG 2W8ZA 4JX8A 2YVLA 3EX7B 4ZI7B 3LQFA 2GNAA 1OR8A 4RVOA 5HL7Q 3KK2B 4ICLA 4WZBA 4TV8F 4X4RA 4IG3A 3V4LA 4HT3B 4LBVA 1KVRA 3DMYA 1RVV1 3MT9A 3DZDA 5ETKA 5DTJA 4RD0A 3RYCB 1DDOA 4HI2A 1HTTA 1GKIA 3Q89A 3LUJA 4AULA 4ILRA 2A5DA 1VQ1A 4E33A 4E0DA 1HWJA 1WZCA 2X58A 2V55B 1E1KA 4PXDA 4RYLA 4AI6A 1RKQA 3UAVA 1Q84A 3BKTA 3DEAA 4ERNA 4XVRA 4DMMA 5DZ6A 4ERDA 1UMBA 1ESDA 5IVHA 1FDBA 4HRXA 2GS8A 3ACBA 3DLEA 3UT6A 4P93A 1SMKA 2RD5C 4MULA 1AGYA 5FEUA 1U98A 4DARA 5F7XA 3D1OA 4MJ3A 1SKUB 2WU1A 5I5EA 1QMGA 4ZV9A 2AI1A 2Y1RI 3QLTA 2VT6A 2PRZA 1ZVVA 2AZ4A 3ENVA 1WMEA 2PZAA 3M30B 1WULS 4GO7X 3PXDA 1JXQA 2XBMA 2G5PA 2KS6A 3AU9A 5CXXA 1H6AA 2HUNA 3TGPA 1JPUA 4MEBA 3FZQA 3I9KA 2FY8A 2JZOA 2GHVC 3C8YA 3OQVA 5IXYA 2BFWA 5EWLA 1M7GA 3OPXA 4F3QA 1Y0BA 2ZYTX 4EFKA 1C4XA 2BBWA 4ECYA 3ZW7A 1ZKMA 5K5MA 4GVPA 3O2SB 2AJ2A 1BMQB 1WCWA 8GPBA 3BKUA 1QAXA 2DNHA 3TP2A 2AJ4A 5JS8A 3EMTA 3VTKA 1H65A 2EZ9A 3K4PA 4KLNA 4W1SA 1GMUA 1XA4A 1CJMA 1ISIA 3IT1A 5E7QA 4OQJA 1RTIA 3DR3A 2OPQA 1HYHA 2QSYA 2H16A 4ZVKA 4R1OA 2WFZA 1HNZF 4KO0B 2YTZA 2PGLA 5J2TF 4CN8A 3KFXA 2JGRA 1BOOA 3DVAB 4N3AA 1R8PA 1WUHS 4KVFA 3FKJA 2FMFA 1DKMA 1T4BA 1EQAA 3PL5A 2QA5A 3K1TA 1FEEA 5A0YB 1YZQA 2RKBA 2BW0A 4JI4B 1SZCA 2M3DA 1NRXA 5LD2C 1NXOA 3WL3A 2NTJA 2C82A 3UJ8A 1TMGE 5H70A 6PFKA 2WMNB 3ZE7A 5ITHA 5JCPA 3BN3A 1QDUA 3Q8VA 1BX0A 3OWOA 2Y0BB 3HB7A 2ADBA 2IVFB 5DMXA 1RRPA 4IQMA 2QMYA 5TR9A 4V39A 5IDQA 1H85A 1NM5A 4BN4A 1U1FA 1U8EA 3OX4A 4IEFB 1C1DA 1NDLA 4RSGA 4H08A 2I66A 1MR3F 3ADDA 3EVZA 2QUKA 3T5KA 2IOHA 3PO4A 1XK7A 3QX3A 1H2RS 1W5AA 3RVJA 5ER6A 5CDTA 5DYTA 2CVHA 3P97A 5FOUA 4WJKB 4DR3J 4M5IA 4WY2A 2WCXA 3PGJA 4X9XA 4PYNA 3AOEA 1VA5A 2M9KA 2NUTA 4MYRA 1HD1A 1JQBA 3J80Y 2RHDA 3MUFA 2D74B 4M9ZA 1ZJ4A 5BPHA 4P4GA 2VUHB 1KIMA 4OJTA 4UTOA 2WK4A 1OYYA 3LXXA 1IBKJ 4BJ6A 2J0UA 2VF7A 1NG1A 6AT1A 1K47A 1UZNA 1SA0A 1P17A 3RS5A 1XC9A 3FOBA 3SC4A 1HDGO 2PUGA 3DU5A 1V3SA 4IIUA 4FW8A 1IYZA 2FX5A 2M1ZA 1SIZA 3KR1A 1Z4NA 5JCXA 1UPFA 3C15A 4GE0A 2XQJA 2HPHA 1D1PA 3WWDA 5AIBA 3H9QA 3I0RA 4DUYB 1KFBB 2CDNA 5LYJA 1DXOA 3ROZA 4D92A 3AUSA 1GSOA 4AB1A 2XM3A 3GPLA 2CFOA 2IA0A 2C2NA 3JRNA 3ZDYB 1W5TA 4F97A 1MJNA 2LEPA 4NV0A 4OQEA 4BB6A 3QSGA 2V68A 3GQBB 3UGKA 1R4AA 1T9VA 3CO9A 5F2OA 2YHBA 2HNZA 3PNLA 1OREA 5KC8A 4IOKA 2WYWA 1MW8X 2ZWMA 3NDIA 3E5NA 5FUYA 4FDVA 3UQYS 1F0KA 2XPCA 5K3DA 4DDVA 3RRJA 1T2CA 5COBA 1MDBA 3T7SA 3K6SA 4MKVA 2LFVA 2CB9A 4UEJA 3N75A 4D9FA 1OBCA 3WGNA 1IK6A 3H5UA 3IP9A 2HIGA 1Y7PA 3RTAA 3UJHA 3G8BA 3PKYA 2PGJA 3HSKA 4DSEA 3IBCB 1MFPA 2YN2A 1VFNA 3J81U 1W581 1MO4A 4MOWA 1QYDA 2LWIA 2R44A 2HQFA 3Q5GA 4V0LA 3W5VA 4DG5A 3ZZPA 4B5KA 3EDMA 5SZIA 1FZTA 2I8CA 3PB3A 1B1AA 2Q5EA 3FBFA 1Q0RA 2A0YA 1P19A 1MPXA 4O3QA 3R24A 4UVHA 3IIMA 4PR0A 3AA8A 3ZHXA 4EUSA 3AXMA 3LKBA 2PUTA 3EZXA 1M8PA 4G1QA 4UARA 4DR1F 3SFGA 4PIMA 4OYAA 2CQPA 5E3PA 3DKKA 1UZAA 1URRA 4GM0A 4CIVA 3SF8A 2GD6A 5HE9A 2CY0A 2ZCJA 1Y34E 5CEJA 4LY0A 3MLBA 4U0JA 4FC6A 4L7QA 3M4NA 3CLTC 3D6HB 2O3UA 3VMFA 3QBCA 3OHAA 2CDCA 1SOAA 2FLKA 3AX6A 2W25A 2GBCA 3IUSA 3I2GA 2PA0A 3OR1A 4OB6A 1O6CA 1KP6A 2BKXA 5ETJA 5G1OA 3KXLA 4MMYB 1JEYA 3RWBA 5LMNJ 1XEFA 3Q83A 2GJ8A 3R0XA 3DCJA 1NP3A 4TYWA 1GPAA 4J94A 1EB8A 3VKVA 1GXLA 2QAJA 1X60A 5B09A 2W93A 2XCSB 5CNJA 5CCEA 4RADA 4Q7LA 1CJVC 2ADOA 5KFFA 4MQEB 2FUNB 1ZQ9A 3L8HA 2FK7A 3B2NA 3AUXA 3LUDA 4O0LA 1QZXA 4RW6B 4TT3A 3VPBA 4ZOAA 3TRGA 1CUAA 1OU4A 2EBGA 1ZIYA 3C5VA 2RRBA 3O3MB 3BMQA 3TLEA 3DLGA 1X39A 4K81B 1QQ5A 1PVVA 2QDXA 1APBA 1IZYA 1K7EB 2DR3A 1YRUA 1ABEA 3A1SA 4QG3A 1W1IA 4DBQA 4M7PA 2ACYA 2WR8A 2MLXA 1FNXH 1BW9B 1HNZB 3KJQB 4F6LA 2ZCUA 2EX4A 2W2QA 1F06A 3LXRA 3G4SS 3I4PA 4CU5A 1RPJA 1Q1KA 5YASA 2G2OA 3A3KA 4HYKA 1CUDA 5FUWA 5KOWA 4AO8A 2VF2A 1P62B 1YIDA 3OAAD 5E3RA 2JJ1D 4I4IA 4KIJA 1GQFA 4F38A 2GAGC 3KLHA 1J5EB 4YDXA 1S6YA 5KX5A 3B5IA 4X5OA 3CUNA 1NQOA 2PM8A 1ZYQA 5TGTA 2R7QA 4X20A 4F3OA 3VX4A 4PAAA 1TKRA 4M5KA 4KQXA 3LUAA 4BN5A 4OZNA 3AXTA 4KXWA 3K70D 2Z2XA 3X3HA 1TYDE 4F04B 5ALZA 1SH3A 2QDKA 4DCPB 4CQMB 3SV4A 3NAHA 3FVRA 1YFZA 1TL7C 2B3TA 1OAOA 5CCLA 3KV3O 1T4CA 4NK5A 3DC2A 1TO2E 3MMJA 3F5MA 3CQ9A 4DR4F 2F9LA 4IHAA 3IA7A 1YL7A 2H2WA 3G79A 3EWAA 1Y8QA 1RCXB 4JJKA 1TL5A 3EQZA 4BMXA 1OBOA 1EE2A 3BIJA 5HGJA 3QKTA 4WTYA 2IEBA 3FZYA 1TL7A 3B6EA 2LVWA 1HPZA 4TMFA 5TMPA 2C2ZB 3ZVLA 3SDEB 4DS5A 5G0WA 1E9AA 1GU1A 1XEXA 3QF4B 4H7HA 4PV7A 1ISPA 2E6KA 2IXEA 2IF2A 3CMAS 5CP8A 2AYEA 3R7BB 1AU9A 4RVCA 4NYIQ 4RGBA 4W9RA 4F86A 3IEKA 2IOQA 4P3OA 3DU6A 2KG1A 4ZANA 2WWVD 1MC5A 2XTAA 4J1TA 1MP0A 2NTVA 4ENRA 3JZMA 2VHYA 1QHFA 5EE1A 2UXDB 1T26A 1U6JA 4UZBA 1DJPA 3ENQA 1PV1A 2ZH6A 2W4IA 3WZMA 2XMMA 4BNXA 2K7ZA 4KJIA 1G5PA 3BIOA 4AZSA 3QLUA 4RGVA 4QLAA 3S4YA 3MMBA 2NYRA 4ZCQA 4C4PA 2YJGA 5FPTA 3DF9A 4BDSA 3KSAC 4YRTA 5JQGA 3R7AA 2XYHA 2FN8A 1EHCA 2P5VA 1PGPA 3B36A 2AWZA 3QEBZ 3M3DA 3WQBA 4C20A 1CPZA 3G2QA 1EVIA 2OMKA 1FMJA 4K0KJ 5BR1A 4KKOA 1SD1A 3CVUA 2VDLB 2F8MA 3IP5A 1S3IA 3V2UC 3ZCPA 1IHYA 2O2IA 3AFNA 3K8OE 2WPNA 2H1SA 3AYZB 3O6QA 3MW8A 3MM5A 4CM9A 3KLOA 4FFNA 3FNEA 4UTGA 2XE7A 1RFLA 3EXIA 4EI8A 4EUNA 3ICOA 1OKKD 3MS4A 1UJCA 1DO8A 1NBEB 5ICMA 2QNIA 4WYLA 4HAOA 2EYQA 1F48A 4O4HB 5EJ5A 4BQNA 5L3RA 4EG0A 1I3OB 1JA9A 4IH6A 2ZZNA 4U9UA 2OZPA 3D3NA 1D2EA 2QE5A 1BFUA 3LW8A 4GYJA 2FXVA 4X65B 2II6A 4BWMA 2W01A 1YQXA 2C8JA 3FYSA 1M1ZA 4CMBA 4ZK2A 4F1KA 4MYUA 4FK8A 1BXGB 3C8UA 3WNZA 1D2CA 4GPBA 5CJJA 3PC4A 2I4NA 2FPUA 1RHRB 3AXSA 4FE4A 2HQCA 5H59A 5CDUA 3PKJA 4N7MA 3MWYW 2XXJA 1HBMB 4RIIA 2L41A 1B70B 4A26A 2ZBVA 4U6SA 3K5MA 1SKYB 2GO9A 1GTVA 1NBHA 4K6CA 1YZVA 3GSDA 4NA3A 5FFFA 3IX7A 3OI7A 3EPLA 2BR0A 3UH1A 1M2JA 2XWSA 1LI5A 5BNFA 4Z99A 1VMKA 1SPBS 3L7OA 4U1RA 3PHEA 2G77B 1FS5A 1CZLA 2LXFA 4QYXA 2E2WA 1R50A 2P2GA 4ED7A 2OM6A 3QXHA 4XIUA 4UTXA 2ZOGA 2J0WA 1PDWA 5EQJB 2WIAA 2FTKE 1HRKA 3T94A 5CDSA 5IQ6A 1KQSR 3PW4A 5K8NA 2WJ3A 3W2WA 2D06A 3BXEA 3PD1A 3KTFA 1U0NA 3FVTA 4R6WA 3N5CA 2HM7A 4S0ZA 2F9DA 3LYHA 2Q6KA 1VCIA 5MN6A 5DK6A 3GJRA 4TS9A 5AXNA 3CT6A 3PGXA 5JAZA 2KW5A 5I9MA 2G1AA 1YMQA 5ETOA 4Y3CA 2V8OA 2IV2X 9ATCA 3NS7A 4QWBA 2OV1A 4ED2A 3GVHA 1IM4A 2JDID 4FS3A 1MVNA 1MGOA 1I7QB 3LCRA 2ZR0A 4DDWA 5ADZA 4CMEA 2DNPA 1YZGA 2AJCA 5C1OA 1MHTA 4RVUA 4KTTE 3TAMB 1LC0A 1NDHA 3OUZA 4MYDA 5A62A 3K5LA 1VHDA 3LPMA 1F5AA 3AQ4A 4K4XA 3ETJA 2I8LA 4PFSA 3SEOA 3BRCA 1CS4B 2OP5A 1W1WA 4I7FA 5LYJF 3U4CA 3X1JA 2V8BA 2WSIA 2E89A 3VAYA 3H2JA 3CIOA 1F17A 3Q8XB 3HO1A 4DUPA 4YV1A 3DXYA 1WY5A 1RUSA 2WAOA 4HTIA 3F6BX 4QQKA 4NLVA 3L7NA 3CLTD 3OEHA 3DMTA 2QRLA 1T4MA 2VK1A 4M1WA 1XMQF 4UATA 2A2CA 1PC4A 4TRNA 4DSTA 1N36J 1JLCB 3KLFB 1V9CA 2RGNA 2YV2A 3P0RA 4YP6A 1EIWA 4A23A 4W7SA 3F56A 3AHCA 3A1TA 4PC6A 3BSFA 4A8XA 4AS3A 2UVQA 1GLGA 3TNVA 5MDHA 4RPLA 5BNZA 1TVRA 1B23P 4RK5A 4KXFB 3I5BA 2DUNA 1E3EA 3LGAA 3MPVA 3BTUA 1U7XA 4W98A 4FLFA 3TE7A 1I6JA 3W6ZA 1ZI6A 1ML3A 2V7UA 5D3QA 1I10A 2GM5A 2MYTA 1TD9A 1H0HA 1HLWA 1KMIY 1TMMA 4K9DA 4CQ1A 4ZD6A 2HMUA 5JMWA 4DWJA 1EFLA 4XDYA 3QEMA 5CFNA 3BPSP 1UZDA 4OLPA 2GA7A 1RRGA 4LF8F 1CD5A 2O05A 3HEAA 3DDSA 1CSEE 1RRMA 1KDOA 2VBZA 4Q0BA 2BJDA 3OTOJ 1RNLA 2VATA 4FX5A 2IYOA 5ALJA 1UJ2A 4Y2MA 4FKBA 1C9KA 3BJEA 1ZMTA 4CJXA 3C7AA 4JD5A 3BREA 2VPZB 2J6TA 4QPCA 2CFIA 3KTAB 4E8UA 4QPTA 5KNDD 4L7VA 5SY4A 2GN2A 2QL5B 2X5OA 4YMLA 3EUWA 2F2TA 3U4GA 5KSYA 4OQNA 3PHBE 4DUYJ 4WKPA 1JQKA 4WKOA 4M60A 1WHSA 4DL5A 4D8XA 3POTA 3K71B 3R5DA 2Q5HA 2CSUA 3EGIA 1AQYA 2F1IA 2XRFA 4G9EA 3B78A 1BFKA 3QSYB 2PX5A 1D4ZA 2AX3A 3RIMA 2XNQA 5E1DA 3SPXA 4CETA 1L1EA 4LMAA 4PVDA 2HCJB 2I7VA 2YKNA 2IE0A 4MV4A 2WF7A 3NQ41 3HRKA 1O6BA 3RU7A 4MIKA 5IK2D 4ITRC 2Q28A 4CM1A 4HVCA 1JFLA 5T41A 1QFSA 3KHGA 4E08A 4IDOA 1F60A 1H98A 5E2AA 2X22A 2BMEA 2ASVA 5JAQA 1Q6YA 3AP1A 1H1TA 3RB3A 2WVAA 4B3XA 4TMYA 3V3KA 1VE5A 4QC2A 2P1DA 3P4UA 3WGUA 4DPWA 2XHZA 1EEXB 4KBFA 4DZDA 2GJ4A 1V35A 4PVCA 4YP1A 2R8HA 1M8KA 1U48A 4MFBA 2NO9A 1X3LA 5KNLA 3N0XA 1VC6A 4QWMA 4NMHA 5E38A 3PW0A 4S0MA 2BFFA 1OVGA 3DI6B 4JI1F 2ODEA 1DT5A 1ENZA 1AGXA 2DGVA 2YWGA 1AZWA 1RXSA 1DKRA 5CAAA 4BNWA 2D2FA 3T1NA 5L3QA 2JJ1A 4AMGA 4L3NA 2XUDA 1BXNA 1I32A 4NZNA 4J7UA 4JLBA 2QWXA 2ZUFA 2WOMA 1IBLJ 3GMTA 5KS2A 3P9YA 5EZYA 1CJUA 3KS9A 5F5NA 4F9GA 1T2EA 5CFQA 3EUAA 3H6GA 3GO4A 2PZJA 2R5FA 3E1KA 4H31A 4HATA 4A4JA 3KUCA 1W7WA 1V8FA 2H1VA 2I6SA 1U1OA 5EIBD 2CV1A 4ZVEA 1TZKA 3IR6B 5LN1A 5GMKa 1EXWA 2OCLA 5E3IA 2BWJA 5CYQA 4A10A 1XR5A 3GDGA 2F59A 3BDVA 3MTJA 3DQPA 1DRWA 4PCLA 3RBEA 3KJEA 4YI3A 3FCVA 3AT1B 3UXEA 1QS0A 3W9UA 4L28A 2ZG6A 1EP4A 1ZBTA 3DXZA 2D8MA 4RHTA 2WD9A 1Y4ZB 2QAGC 3H0PA 3CUYA 1QM5A 4R1NA 3MEQA 2K2PA 3NBXX 2Z56B 3WR5A 1WD5A 3OPYB 3G68A 2BFBA 1JQ5A 4E6PA 1BHQ1 5T14A 4MWDA 4BLTA 4Z51A 3DRRA 4DV1F 1A7UA 3FHCB 1LFAA 4YJKA 2KSQA 5CT6A 4NSNA 3GJ5A 1LC3A 1SU6A 5K8TA 4W1QA 3A7DA 1XLTA 3SZ2A 1I80A 1OA1A 4KSCA 4IGKA 1SQ0A 2UVPA 4JVSB 4DV6F 5TPWA 3RAFC 4V1Ak 4B3DA 1HQKA 4GC6A 1E0JA 4XSGA 1XNQF 3BV8A 3S2YA 4GOND 3B6BA 5JC8A 1FZQA 3ZV3A 5DWQA 2QMHA 1HNXJ 2FF7A 1NKTA 5KNCH 1XP5A 1Z7BA 3EFOB 1XD8A 4G1EB 3EDOA 3AUJB 2VPQA 3KB8A 4H4EA 1QXSA 4FYDA 5T4EA 1CJTC 1CNEA 3EEIA 3B1ZA 3OPYI 1SWWA 5HSGA 3ORFA 1UZMA 4ETIA 3MB5A 5U4QA 4BWFB 4HPXB 2YZNA 4QIGA 4FVMA 3RVMA 3IT0A 5EA2A 1KKLA 4NOKA 4J0EA 2F3RA 1S6OA 2FQ1A 5F7OA 4YRLA 1XK8A 2OAEA 2ROQA 5D3MA 1VQNS 1Y7IA 3HBFA 4M0CA 5AHKA 1GM5A 4KDCA 4KCGA 1KE1A 3G0GA 3F6SA 1QVZA 2UDPA 5THKA 2ODAA 4HZUB 2EQAA 3L6BA 1Z5NA 3HCNA 3VV2B 4CUKA 2UXBJ 4RCYA 3BWEA 1E63A 5FXMA 1T91A 5AVVA 4DR4B 4NQZA 3H19A 1T5OA 1CW2B 1V43A 2HRQA 4IDHA 2IYTA 4DZRA 1VZ2A 1XTQA 2QN9A 2C0PA 2JI6A 3ML1A 1YBUA 2KYRA 4JC0A 3A32A 4KBYA 2DECA 1XTPA 1UDBA 2I34A 2D2EA 3A05A 1OXMA 2EDAA 1E6KA 2GEKA 1MQSA 1N8RT 3EF1A 3GLRA 2POKA 1U7ZA 2Z3ZA 4BLOA 2IU6A 2ZRCA 3ZIAA 3ITEA 3R5XA 2UUTA 4M1SA 3TI9A 1NAHA 1LX6A 4Y0FA 2HRBA 2ZDOA 2BCGY 2BSQA 2JIMA 3KAQA 3C5EA 2W7TA 1TFRA 4G5SA 1S1TB 3G2XA 3DE4X 3OHMA 5JZ9A 5GZ1A 5KFSA 2YKAA 4ZN6A 3FFIB 3UAWA 4PXEA 3ORSA 3EWNA 4ZT2A 5AJZA 3CNBA 4NCIA 4NK4A 5CVCA 5AI9A 3D6VA 1KYTA 3DLLQ 4Y2GA 1GG5A 2C2MA 4XDHA 1JIUA 3W7VA 4QIEA 3UA3A 3K92A 5K0SA 1GQSA 4E3WA 4LR7A 4S2UA 1KQFB 2C7PA 2FRDA