4AUKA

Crystal structure of c2498 2'-o-ribose methyltransferase rlmm from escherichia coli
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
357
structure length
355
Chain Sequence
MNKVVLLCRPGFEKECAAEITDKAGQREIFGFARVKENAGYVIYECYQPDDGDKLIRELPFSSLIFARQWFVVGELLQHLPPEDRITPIVGMLQGVVEKGGELRVEVADTNESKELLKFCRKFTVPLRAALRDAGVLANYETPKRPVVHVFFIAPGCYTGYSYSNNNSPFYMGIPRLKFPADAPSRSTLKLEEAFHVFIPADEWDERLANGMWAVDLGAPGGWTYQLVKRNMWVYSVDNGPMAQSLMDTGQVTWLREDGFKFRPTRSNISWMVCDMVEKPAKVAALMAQWLVNGWCRETIFNLKLPMKKRYEEVSHNLAYIQAQLDEHGINAQIQARQLYHDREEVTVHVRRIWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords RIBOSOMAL RNA LARGE SUBUNIT METHYLTRANSFERASE M
publication title Crystal Structure of Rlmm, the 2'O-Ribose Methyltransferase for C2498 of Escherichia Coli 23S Rrna.
pubmed doi rcsb
source organism Escherichia coli
total genus 118
structure length 355
sequence length 357
chains with identical sequence B
ec nomenclature ec 2.1.1.186: 23S rRNA (cytidine(2498)-2'-O)-methyltransferase.
pdb deposition date 2012-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01728 FtsJ FtsJ-like methyltransferase
A PF18125 RlmM_FDX RlmM ferredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2810 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4aukA01
3.30.2300.20 Alpha Beta 2-Layer Sandwich THUMP fold THUMP fold 4aukA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4aukA03
5LQUA 1I4WA 4OX9Y 2O07A 2PXXA 3NVMB 3NW9A 1ZHFA 3X0DA 3BT7A 3LKDA 5LQNA 3O7WA 2HV9A 3P2EA 1V39A 2AR0A 3VYWA 3ELUA 5FADA 3OFJA 3FPJA 5CCXA 1KPGA 4PGGA 2ZSUA 1KIAA 4X63A 5E9QA 3R6TA 2ZFUA 5FWAA 3UJCA 3EPPA 4YUWA 2IDJA 3HVKA 3IV6A 3LECA 2AZTA 3MCTA 2P35A 4GBED 1KXZA 3P97A 4QVKA 4E31A 2ZBPA 5C1IA 1MHTA 4V0QA 4DM3A 4YUVA 4Z2YA 1JG1A 3C6MA 5D1HA 2R3SA 3BWBA 5EMJA 5KQRA 4FP9A 1NW8A 2I6GA 3QOXA 2JHPA 5DX1A 4PGHA 4EMSA 3KQSA 3WSTA 4OA8A 5K0BA 3UBTA 5KYGA 1R6AA 3GJYA 4LECA 4RV9A 4DZRA 4YV1A 1DL5A 5E2BA 2B9EA 3FYCA 3UJ8A 2B2CA 2O05A 1RI3A 1RI4A 5ICCA 2AN5A 3FPHA 2H1RA 3KR1A 3TPZA 1KR5A 2VP3A 2ZIEA 2VZ9A 4OQEA 5F2OA 4FS8A 3O31A 4BP1A 2BH2A 3ER9A 5CVDA 2I9KA 1RI1A 4GOOD 3A25A 4HC4A 1NKVA 10MHA 2IH4A 3HM2A 5LR6A 2GB4A 2P40A 2O0LA 3TKYA 4YV0A 3LGAA 4HTFB 2AOUB 5BP7A 1FP2A 3FPEA 3PB3A 2IIPA 2PXAA 4GF5A 4PNEA 4RTLA 1P1CA 4B17A 5DPMA 5FA5A 2OYRA 3DP7A 5LQKA 5ICGA 5M5BA 4DA4A 2JG3A 2GPYA 1G8SA 5DX8A 4LG1A 4H0NA 3ELYA 5CVJA 4F85A 1TW3A 4CKEA 1JG3A 2QE6A 3SX0A 2N47A 3NWEA 3OZTA 4HTFA 2GH1A 2AOUA 1EJ0A 1YB2A 3CBGA 3SM3A 4CKBA 5BXYA 2OXTA 4ER3A 5CVVA 1EQAA 1NBHA 4FT2A 5EG5A 3PFGA 5DXJA 3NDJA 3G7UA 4C04A 1WG8A 4PYKA 4X61A 2LD4A 3HCEA 3P9NA 3CVOA 5K0CA 3PX3A 5BW5A 4AZTA 5FQOA 4XUEA 3FUWA 1KPIA 1ZG3A 2FCAA 4PYQA 2IBTA 3NDIA 3B3FA 2XVAA 4V0RA 3GRZA 3UJ6A 4RTMA 2UYHA 3R9XB 4YMGA 1AF7A 1YZHA 3U81A 1O54A 2NYUA 1ZQ9A 3GRVA 5KVAA 5EMKA 2FPOA 3L8DA 3GCZA 3G88A 4HGZA 2XBMA 3KPYA 3TFWA 4PYMA 2C7RA 3A27A 4FSXA 2ERCA 1G38A 1M6YA 2H00A 2O06A 1R8XA 5FHRA 4JXJA 3BWMA 2P7IA 5B1SA 1NW5A 3BWYA 3KQMA 3UJDA 2EX4A 1L3CA 1X1BA 1RI2A 3DMGA 5G02A 5CCBA 2C7PA 1X1AA 3GWZA 1QAOA 5EHIA 5EMLA 5EKUA 4IKPA 2HWKA 3KQYA 4KIGA 5H02A 2XYVA 2QM3A 4YMHA 4YUZA 1QAMA 2PT9A 3HA5A 3DLCA 4QQNA 3LSTA 3P2IA 3R24A 5EZQA 4FGZA 3NWBA 3V8VA 3DXZA 5MHTA 4F86A 5HEKA 2WK1A 1R18A 4DCGA 2PVCA 3LCVB 2PX2A 3FTEA 3GU3A 3S68A 2CL5A 3HA3A 1VP9A 3LHDA 1G55A 3OCJA 4R8RA 5LQCA 3ERCA 2YUIA 3OU6A 2Y1XA 5CVUA 5GIOE 5FWDA 1XVAA 1N7IA 3A26A 4AZSA 2BM9A 4KWCA 4RVHA 5GIPE 4CWAA 1P1BA 5E1OA 3KU1A 4OQDA 3ME5A 3HVIA 3BUSA 1XDSA 5EHGA 3GXOA 4PYOA 1KYWA 2VS1A 4RTNA 3EVZA 4UOEA 3GNLA 4RWZA 2GAFA 2ZULA 1P91A 2XYRA 3SVZA 3R0QA 5K0NA 4AX8A 1N2XA 4C07A 4HH4A 3HCBA 4EQZA 3KQOA 4QPPA 5E2AA 1VBFA 3LCUA 4HGYA 5DT2A 4C05A 3OE4A 2OKCA 2YXDA 3M6XA 2I7CA 2IGTA 3FUTA 3HCCA 4BLVA 1M0EA 1L3BA 5K0JA 4NECA 1ORIA 3OZRA 2IH5A 1XJ5A 1O9HA 3KPVA 2VDVE 3KQQA 3KR2A 3VC2A 3G5LA 3M33A 2JH9A 3UJ7A 3CC8A 4OA5A 2C7OA 2HTEA 4RTRA 1JTEA 1X1CA 3EVGA 3HCFA 2P41A 2PWYA 3DULA 5K0EA 4DCMA 1G60A 2R6ZA 3O4FA 2G8NA 2OZVA 1EIZA 2BR3A 3AJDA 1KP9A 3PFHA 5CM2Z 3OFKA 4PYNA 3B5IA 5FQNA 5GOZA 3SMQA 1NW3A 1JSZA 3G2QA 1F3LA 1NV8A 2FRXA 3K0BA 4C03A 5KQSA 3FRIA 5P8WA 1KPHA 4PINA 3RIEA 3CCFA 3DUWA 1AQJA 2I62A 4LWPA 4E70A 5DM0A 1PRYA 2NXCA 2PBFA 1X19A 3PVCA 4P7GA 1JTFA 2AOWA 1NT2A 3G89A 3P71T 5DRTA 1R00A 2Z6AA 5KS2A 3LBYA 2ZZNA 3JWIA 4GEKA 3TMAA 3UZUA 3MCZA 4EKIA 5ERGB 2WA2A 3LL7A 3ER8A 3MQ2A 3GGDA 3E7PA 4IV8A 3EVAA 3LDGA 5DXAA 2G72A 3PTAA 3CKKA 5DRYA 1X1DA 1ZGJA 1DUSA 2FK7A 4BLUA 2PLWA 2Y1WA 3E8SA 3HEMA 3JWGA 4R6WA 4C06A 3JWHA 2V74B 3ORHA 1NW7A 3G5TA 3Q87B 4RTPA 1XCLA 5E1BA 5EEHA 2GA9A 3MAGA 1U2ZA 4CTKA 4E2YA 2VDUE 3KPJA 4QQKA 3EGVA 5JR3A 4RVDA 3BGDA 5GWXA 2K4MA 1KYZA 4XUDA 4C4AA 1D2CA 3DXYA 3OPNA 4M37A 3TM4A 4ER5A 3P9IA 3OU2A 2PV0A 1WZNA 3KQVA 2ZZKA 1RJEA 3M70A 5K0GA 1SQGA 2BZGA 5HIKA 2ADMA 1MJFA 4ER6A 1HMYA 5LQAA 5C0OE 2P8JA 2DPMA 3EVDA 4GC5A 3KPUA 4R6XA 3NVKI 2P3QA 5FUBA 1UFKA 2ORED 2ZLBA 1OR8A 2P1DA 5EGSA 4FT4A 2AVNA 2DULA 7MHTA 1FJXA 3P9CA 4L7VA 5DWQA 2ZWAA 3I53A 3DH0A 3LDFA 1EAMA 2NXEA 2UZ4A 1ZGAA 3ELDA 5GM1A 4E2WA 5DTMA 2FK8A 5IH3A 4RTQA 1TW2A 5GM2A 2A14A 2JJQA 5GP1A 3QOWA 2ZVJA 5CIYA 1SUSA 2YR0A 2ZW9A 1BHJA 2AOXA 3HP7A 1D2HA 2ZIFA 3BGIA 4GOND 3FTCA 5FULA 3SR4A 1AQIA 2EJTA 4DF3A 3GRUA 2OBFA 5C9ZA 1R8YA 5EPEA 5DTQA 5E8JA 2ONYA 3MERA 3T7SA 4YUYA 3PLAE 1JQEA 3B3GA 2XVMA 1N7JA 1XTPA 2AOVA 1NBIA 2YVLA 3P8ZA 3R3HA 4G56A 4QPNA 3M6UA 4E30A 3KQWA 1NV9A 3G8AA 3M4XA 2AOTB 5DTRA 1QAQA 3UFBA 4YV2A 3I5UA 4FZVA 3K6RA 3UJAA 4KVZA 3B89A 3LX6A 4PYJA 2AN4A 8MHTA 2CMHA 1JG2A 3BKXA 4XUCA 5DM1A 3FPGA 2PX8A 3BGVA 2F8LA 1RJDA 2XYQA 1FBNA 3BKWA 2AN3A 4IWNA 4U7PB 5EVJA 3TR6A 4CKCA 2C7QA 4MQ4A 2HMYB 2KW5A 2AOTA 3T0IA 2YXLA 1EG2A 4XCXA 3REOA 4U7TB 2QRVB 4AZWA 4PIMA 3UA3A 5T67A 2ESRA 2QYOA 3G2OA 2NXJA 3AXTA 4PCAA 5LQRA 3MGGA 3MHTA 4BY9E 5D1NA 4A6EA 3OZSA 4YUXA 2PWPA 2Q41A 4E32A 1IM8A 1FP1D 4WVLA 3TRKA 4KDRA 4E2XA 4DQ0A 2B78A 5E1DA 3F4KA 3Q7EA 4BLWA 3CJTA 3OU7A 2HR1A 3HVHA 2QY6A 1RI5A 3T7TA 2G71A 5ICFA 4RTSA 2QRVA 3ELWA 1VQ1A 3FUUA 1UWVA 1VL5A 1I9GA 1XXLA 4Y2HA 4M7RA 2ZZMA 4X41A 1YZ3A 1WY7A 1Q0TA 2ZIGA 2CWWA 1T43A 2P7HA 3GRYA 5DM2A 5K0LA 3HCAA 3SGLA 4FSDA 1AV6A 5JUWA 2CMGA 5K01A 1O9GA 3P2KA 3E23A 3KR0A 3FPFA 3UA4A 1JQDA 3B3JA 4X1OA 3G8BA 1YF3A 3FTFA 3MTIA 2G1PA 4MIKA 4RTKA 1EJ6A 1RJFA 1YUBA 3SXJA 3T7RA 5K09A 1WS6A 2BR5A 2EFJA 3BXOA 3LCCA 1VIDA 2Z6QA 4ATNA 2JHAA 2P3OA 5E9WA 4E2ZA 5U4XA 2ONZA 2PKWA 3CJRA 2PT6A 2IPXA 1SG9A 3DMFA 4DMGA 3RODA 3KR9A 3PX2A 5DM4A 3ID6C 2PX5A 2B3TA 3UJBA 1XCJA 4ER7A 4R05A 3BZBA 2EG5A 3M6WA 5E9JA 2JHCA 2ZBQA 3I58A 1QYRA 4BP3A 1WXWA 2JH8A 3FYDA 2Z6UA 2ZBRA 1G6Q1 1NW6A 3EEOA 2WA1A 1G8AA 4HG2A 3LPMA 1VPTA 4OBXA 1KHHA 1JQ3A 3CJQA 3P9KA 2FYTA 1DCTA 4AZVA 3LBFA 5T64A 4E33A 1INLA 2OY0A 3H2BA 2PX4A 2IFTA 2PJDA 4QDKA 5EIWA 3DLIA 5HZMA 5FA8A 1IXKA 5HOQA 2PY6A 1RJGA 3MTEA 4PONA 1SUIA 5HILA 4M36A 3DR5A 3JWJA 1QZZA 3M6VA 5CUQA 1F38A 3SSOA 3AY0A 4FR0A 3IEIA 1XDUA 4A6DA 3FUXA 3IHTA 3HTXA 5DX0A 3SSNA 4EKGA 2PGXA 1PJZA 4P58A 2NNWB 4GQBA 5EMMA 5K8VA 5LSAA 4P7JA 2IH2A 3EMDA 1SKMA 2BM8A 3OE5A 1L9KA 1VE3A 3EVCA 4P7KA 2V7EA 5HIJA 5HIMA 5IKMA 1YFJA 3NMUF 4M38A 1ZKDA 3DOUA 2OO3A 1D2GA 3MB5A 4RVGA 4Y30A 3VSEA 2BR4A 2E5WA 2EJUA 1XDZA 1BOOA 2IDKA 2YTZA 3DXXA 5DSTA 1M6EX 3BWCA 4QTTB 2UYCA 4IV0A 5DLYA 5EEGA 3RW9A 5K03A 4GOLD 2ZTHA 3LKZA 3EMBA 5F2NA 4KW7A 5EQJB 4RSRA 1JG4A 5EC8A 3HCDA 3D2LA 4RVFA 3IYLW 4HSGA 4WXHA 3SSMA 3C3YA 3I9FA 1ORHA 5T6BA 2NXNA 3DTNA 2G70A 3EGEA 3VC1A 1B42A 5K05A 3HVJA 5CD1A 5EIFA 3NTVA 1FPQA 2AS0A 2H11A 3UWPA 3KHKA 3G2PA 4ISCA 4RYLA 2FHPA 4CXMA 2IBSA 4ZTBA 3EEYA 3TQSA 3AWIA 3UJ9A 3FUVA 9MHTA 3C0KA 3FTDA 3TKAA 2YXEA 1NE2A 1Z3CA 1P39A 4P7FA 3GDHA 5FTWA 2PSSA 4POOA 1Q0SA 2CKDA 2PXCA 3V97A 2VDWA 4C08A 4F84A 4RTOA 3C3PA 5EKXA 3TOSA 3HNRA 3THSA 4EVIA 2O57A 3THRA 2GS9A 2GLUA 4OBWA 5K0FA 1BKYA 1IY9A 2P3LA 4EK9A 3DMHA 4KIFA 1VP3A 4MTLA 3KQPA 4LWOA 4X60A 3A7EA 5ICEA 4RTJA 3A7DA 4GC9A 1UIRA 3KKZA 3QV2A 4PYIA 5F2KA 3TLJA 4KDCA 5E1MA 1JR4A 2OB1A 3ANXA 2B25A 3LDUA 5EZSA 2AVDA 4KRGA 4DKJA 1R74A 3FZGA 4MWZA 1TPYA 3PT9A 4RX1A 2NP6A 2YQZA 4PWYA 2IP2A 2YX1A 4AUKA 3GRRA 3KPWA 3G2MA 4MHTA 4QTUB 3I64A 1Y8CA 5BW4A 5E8RA 5FHQA 1L1EA 3NJRA 4O29A 3A4TA 2ZWVA 1SQFA 4PIPA 3C6KA 4PYLA 4QVGA 5DSXA 5EOVA 4R8SA 4HRAA 3EGIA 2OPBA 5LQJA 1H1DA 2HNKA 3PS9A 1I1NA 5CVEA 3HA7A 3KQTA 1QANA 1SVUA 4K6MA 3TM5A 2NP7A 2UYQA 4GUAA 1BC5A 3B7PA 4CTJA 4ER0A 3E05A 5GINE 1YFLA 1WXXA 3EVFA 3EVEA 4QDJA 1JSXA 3EVBA 3GO4A 3AXSA 2ZCJA 1VLMA 2UYOA 1HNNA 1L3IA 5FCDA 4GOMD 4PCLA 3GIWA 3FRHA 3CGGA 5HIIA 2OB2A 5HFJA
chains in the Genus database with same CATH superfamily
1X60A 2JBHA 1P3Y1 4EKDA 1X7DA 2ZFUA 2R8IA 1C41A 2PGCA 4OKSA 1GZHB 3W5XA 4G0WA 1X7ZA 4EMSA 4FHDA 1DKQA 2EHJA 1P5FA 3LUKA 1L4MA 2BA9A 3MEGA 1WHSB 4A8JB 1A5ZA 3BD7A 4JEHA 3U37A 1FK9A 2GBCA 1YJVA 1Z5OA 2WSFC 2J08A 2FPXA 1DLIA 3TGLA 3NG8A 1IN5A 3ASZA 1WUUA 5LSLA 2AZMA 5EWLA 3MXHP 2VQFF 5KFEA 3DZ8A 1LSSA 2Q6KA 3FMOB 2DIVA 3T9ZA 1IY1A 1JBEA 1NLMA 2DTXA 4MKAA 3NGTA 3PJGA 3WO1A 2BFOA 3G1UA 4PAQA 3INRA 4GBMA 5B0GA 3A27A 3L8CA 3T1OA 4PRKA 2K1RB 3I2IA 4BNNA 3B6KA 4P4TA 3T7KA 2XUZA 2OMOA 1NAIA 4JBXA 1JEQB 2J9FB 2AJ8A 2I6WA 4F2RA 3PR5B 1L3UA 1XBWA 1KI2A 4ECEA 2IU4A 2XM3A 2O1SA 1TKXA 1QIKA 1JFSA 4TTAA 1WBDA 4XJSA 3UAWA 3CGWA 1DQAA 4YTEA 1T6YA 4PC3A 2EKYA 1YJ8A 2GAFA 5JU6A 3DC2A 1N5YA 3MAAB 2HLNA 3QZ8A 4IYRA 1RACA 5HJ5A 3HACA 3JVDA 3ZCRA 3CLRD 5IV4A 3IIJA 1DAMA 1BXRA 2I0XA 2Y0CA 1ZU5A 1CBUA 1U3FA 2J09A 3NP5A 1FFBA 4X7BA 2QMUA 2BDUA 2ZRDA 2ISCA 1FVFA 3K09C 2I5JA 3M1VB 1FIUA 2WYWA 3L09A 5CNMA 3SMVA 1O57A 3KLEA 2EPIA 1Y3BE 2ZYGA 4C3ZA 4PANA 4KPYA 4HHUA 3KKMA 4EPRA 5L39A 2W8KA 2COKA 1EAYA 2D5LA 3CQ9A 3BKTA 1QZXA 2P3QA 1J90A 1P1JA 3GYXB 2EXXA 5J2NA 5BOSA 2YFHA 4EW3A 2EC5A 1L7RA 3C3AA 1X74A 1BXKA 3QVSA 1X9GA 2DISA 1E2HA 4TT3D 1FUIA 3DE7X 1AQYA 3CR3C 2GHRA 2P2LA 2WLTA 4DQLA 3E35A 4KO4S 4DV4J 1TL3A 2VWQA 2XIQA 3JQFA 2WW4A 3R1LA 2ZHBA 3JAKA 4IILA 1U2QA 2PGNA 4K5RA 2IJGX 4G1UC 1GUAA 3C87A 5B3JC 3WBKA 2RAVA 1U7TA 2JSXA 1CDZA 3ZY4A 1NN0A 5JVDF 2G71A 4O4HF 1RADB 1EM6A 3AEQB 1NK7A 3ZNUA 1AKNA 3PEJA 4X5OA 3RVKA 5DM2A 3WC4A 4JP2A 2ZQ5A 2VJNA 5BR8F 3NORA 2HTFA 5F9NA 7FD1A 4CM9D 4ER8A 5L7WA 2CCKA 4USVA 3DMFA 4INOA 2V94A 3RUHA 4A8PA 1G8AA 3CDWA 4OLAA 3BQ1A 4OHWA 3AYZB 5FLKA 2AZ4A 3KUGA 4CQJA 2JI4A 1C2YA 3PXDA 1OLXA 2E5FA 5HIMA 1KTVA 3QEOA 3OHSX 2Z3WA 3NBZC 2G5GX 2NWQA 4C21A 1GUFA 4B40A 3AR4A 2RQ4A 1E2BA 5JYEA 3JZMA 4J6EA 4GVBA 1XD8A 1LXJA 3LTOA 5G2OA 1UPXA 2HRUA 1SIBE 5TT1A 2YWBA 3JASA 3GELA 2FHPA 5F3TA 4F6CA 1IVNA 1Q57A 2IELA 4BRUA 2YVQA 5EKXA 4NVRA 1WQ1R 1UVIA 1RHRA 1SUQB 1S6PB 3CISA 4LEIA 3V2HA 1JWBB 3ANXA 4H1TA 1E98A 3MRTA 2P27A 2DY9A 4S04A 5FEMA 1GN9A 4CL0A 2I65A 5I7FA 1D6SA 1PV1A 2CXNA 4ECSA 3GFYA 3HLKA 4IG9A 1Q11A 1QRUA 4B44A 3E22A 1T3HA 2XGMA 3EWSA 2HK8A 5CIQA 4D2IA 4H31A 3B1JA 4UM5A 4CPDA 1B15A 4Q5VA 3ZWYA 4QJ3A 2GSWA 2QPOA 4NV0A 5AM3A 4JH0A 2EIXA 2IXBA 1QHYA 2MIIA 3VH1A 2BEKA 2V3WA 3SX2A 5EFOA 1VCMA 3TA2A 3GZNA 5IXYA 2HGNA 1OXVA 4OQEA 5KOHB 3RIMA 1WXIA 3X3HA 3EXFB 4F7DA 4F92B 3W9BA 4CKBB 2WHYA 3RRMA 5L38A 2Q29A 1NR7A 3K0JA 4MI9A 5EUCA 3GZ4A 3V8BA 3OA2A 5CG1A 3U5ZB 3O8QA 3K70C 3C8MA 1NR1A 2IC3A 3HKCB 5DH9A 3ADBA 4DCOA 3F0TA 3NS7A 1XRRA 1CD5A 2YVKA 3FZYA 4UTNA 3NDIA 5LMZA 3C15B 3HB7A 2A9JA 3FLAA 3WI7A 2NYUA 3GEEA 4D45A 3EAQA 4YRMA 2FHKA 4I46A 4XVUA 5AW3A 1SUFA 1DURA 4NQRA 3TUZC 9ABPA 3KSAC 2DFKB 4AP9A 4LRYA 2QO3A 5A03A 3RYCB 4Q1BA 2B36A 2H4WA 4JP3A 4IIJF 4BWMA 3NBAA 2EZUA 3MECB 2XGOA 3LYHA 1YXMA 2HSJA 4IJ5A 3G7NA 1L5UA 2PZBA 4AFFA 2BM9A 2YW9A 3ME5A 4I6GA 1M72A 1P4AA 4D4MA 4RWZA 1NK8A 5D3GA 2AMYA 4HDQB 5BN5A 3NS6A 4RLFA 2ZTMA 4LVNA 2XWQA 4DV7F 4G41A 2FMFA 4GKKJ 2W2KA 4DR1F 2DUUA 3KEMA 2JGDB 2NM0A 3KLNA 4DDVA 5B1EA 1EYZA 1XLTA 5IVIA 3TLZA 3V1YA 3B5IA 1W19A 3RHSA 1G4CA 3NTQA 3QE0A 3UN2A 3DUWA 2X0RA 2DNYA 4OXIA 2W93A 5CIWA 2ZBUA 3WC2A 4DVJA 3BJEA 3KL4A 1V5WA 3AEKB 3S8SA 1NNSA 4ERDA 1X1DA 4N7BA 2B6AB 4O2BA 5HJ7A 4Z4QA 3FJYA 3BD8A 3DWEX 4J0KA 4EPWA 1RHKB 3L41A 5CYQB 4UBKA 1S9HA 4CEJA 5KWSA 1A7GE 5DNDA 4KGMA 1G64A 2NXEA 4KNYA 3DOFA 4ZPVR 4PG4A 2FLOA 2A14A 2H1SA 5JWHA 4LT6A 4J0GA 3M49A 1WLYA 2EOAA 1RBOB 3VVTA 1IBKJ 5EPEA 1AT1B 4EZIA 4XVQA 4DN9A 5DXFA 4MDFA 3G8AA 4KWHA 5LDHA 1NM2A 3AUYA 3SBXA 5DI3B 4LBYA 2VHVA 4HKQA 1MO2A 1UPMB 2YY3A 1R12A 4I6EA 4G3XA 4PE5B 4AG5A 1W5EA 3W6PA 2J6SA 4DIFA 4ZVOB 4A3SA 4PSUA 3QENA 3C5VA 1Z37A 1UBKS 3DOKB 5I48A 3AQOA 2VRCA 2JJYA 3TLEA 2ZIGA 4KDFA 2EFEB 4X0EA 5KSPA 4TQRA 4FR2A 3NYWA 4P86A 4FVTA 5DGIA 1C1BA 1TCAA 1IQTA 1C3JA 1P6QA 4FFSA 2OHJA 4KI0A 4H0CA 4IRCA 2GN8A 4B7ZA 2OBXA 3ZR4B 1GQRA 4PRZA 1P2FA 3ZWNA 3MCUA 3R5HA 2ZYSA 3I9V1 1F2TB 3W66A 1GGJA 4I0WA 3OOEA 3RB3A 1ID8A 1L7DA 4NEZA 4FR0A 3KT3A 5JUMA 2H1IA 1YJBA 3KLGB 5LYJB 4PZDA 1RCOB 1HXHA 3MMSA 2R2TA 2MLXA 4M9SA 1YMUA 4Q3EA 4S2EA 3OUYB 1JJFA 2FN8A 1R5BA 3Q8KA 2BKXA 3L84A 1Q3HA 4MKIA 2C31A 5H4HA 1JS1X 1JIHA 4DSTA 3JQ7B 4I1SA 2OHOA 2QL5A 4U7JA 3Q2KA 4F97A 3AVXA 4ENSA 1I3MA 1KTIA 4CMEA 1AGPA 3DMHA 4BB9A 1UT8A 4BWJA 1HETA 4JYZA 4Z7CA 4KAAA 1RBLA 2AZ1A 4F67A 3AT1A 4KPGA 4V1Ak 1WEXA 2DHAA 5AQ1A 3ZE2B 1E6EA 5EOVA 4JDPA 4G85A 4CF4A 3DDNA 3PU6A 4DGSA 3H98A 2Z95A 2YWWA 2PGDA 3CEDA 1MOSA 3B2NA 2VFUA 4MGKR 3BRSA 3FBWA 3ZG6A 5LQNA 4Y2PA 4B0OA 3WLLA 1NBMD 3SZUA 3A6FA 1JEYB 1VPWA 2QA4S 1E1DA 4ID9A 4BDTA 4O23A 4G0VA 1G3MA 1KU0A 3ZLUA 2P2CB 4ID5B 1OB5A 4HLNA 1RXOB 3DVAA 2C07A 1HRDA 5LDGA 1UC9A 1X39A 2Y05A 1CY6A 4LF7J 2LCIA 3C8ZA 1M3SA 1BN7A 5B1YA 4EOGA 3LXRA 2ZYUX 1H3NA 1FMJA 2WIJA 1YIJS 4OM8A 3DVQX 1PNOA 3N76A 3D2AA 2W8BA 1D4ZA 5GAEU 4OBEA 2MY8A 2X4GA 3RYHA 1NXSA 1TO2E 4I2VA 4O5OA 2I1RA 1QKKA 3AZQA 1L3CA 4IH9A 1PIWA 3VRHA 3P96A 4B84A 1BQ3A 2O19A 3EASA 4Q44A 3NHRA 2RGUA 2D59A 1RYSA 2WK1A 1OREA 5HQTA 1P73A 1OX4B 1EFHA 2ZS9A 3ENAA 3EIOA 2GVNA 2RHLA 3JD4A 4URQU 3TNVA 2HG4A 3DU5A 1P91A 3L93A 4HNQA 4TT3A 1UZHA 4U7CA 5EZYA 2Z4SA 1SIOA 2XNSA 5SY9A 2VC2B 3K4HA 4OA5A 1RP5A 3UFXB 6LDHA 3DZCA 1HEYA 3GLVA 2W6JD 1LEHA 1K47A 5B58T 1MCZA 1WSDA 4OG2A 4WEOA 1X0XA 1KQOA 3DKKA 3TBFA 3OL7A 4DR3J 5FWYB 5DNYB 4DPTA 2QTLA 1UKYA 1AQUA 3LALA 5CT5A 5F8LA 2NU8B 2JI7A 5DXAA 3ETGA 3CKKA 4MQBA 1CSJA 5IBRA 1UKBA 5JQWA 2JEGA 1PT7A 1ZNZA 2F90A 4ER5A 5HAOA 5EX3A 2DGQA 4CM9A 5ENVA 2VDOB 4XD2A 3H42B 5FUBA 4YQYA 4Z54A 1EP1B 2GZDA 2J07A 2FJWA 2QVCA 4Q9JA 4FIZA 4Y6GB 5CTJA 3FIUA 4BBAA 2VR1A 5CIYA 4ND8A 3MJ4A 1LV5A 2BTEA 4A5OA 1H6CA 3I73A 1LI4A 4NV1A 2AIRA 2PFSA 1DFDA 2VDLB 1JHUA 4OGWA 5AW2A 3HHPA 1D0IA 4RD4A 3QE9Y 4TU7A 2KZMA 4YV2A 4G24A 3RRHA 4H60A 1L1RA 1Q15A 3ITKA 3CO0P 4MV0A 1W2WB 5ARCA 1XERA 2QRVB 1UPPA 1VRUB 4IS2A 3QHQA 2B56A 4DQ0A 2E1CA 1TK2A 5E1DA 3R5JA 4PN7A 1M8PA 4D9EA 1A71A 3SYRA 3D3JA 2ZDOA 2DT5A 3KK0A 3FFAA 3DV0B 2D5AA 1P7WA 4FQ5A 4PTZA 5AI0A 2PKRA 4U6QA 4WESB 1Z5WA 1V3QE 3GLSA 4WY8A 1XKLA 2Z6QA 5E9WA 4E2ZA 2XGSA 5LJ3Y 2UXBB 4QBGB 1OXXK 4CQLB 2A5LA 4GR4A 3RBAA 5HVNA 4B80A 1UKAA 3GYNA 1INLA 1CQIA 1ECJA 3TP2A 3CZ5A 2C2WA 4RU2A 3DMJA 4IVRA 3O7MA 2ILYA 1X80B 2J6IA 2D1QA 3TTUA 1ZL2A 1G8KA 5CYMA 2C3YA 1L9KA 1VE3A 2FVCA 3R3XA 2RMKA 4Y30A 3L6UA 2FG5A 2SICE 2JGEA 4EY8A 4ELVA 4W8OA 3OTIA 2XLIA 4G6VB 3IB6A 1WOSA 2BANB 4QWWA 4WECA 3I8SA 4UUOA 4QYTA 1CUHA 1QP4A 4K9NA 1G1XA 4KQEA 1E61A 2H6EA 2BV3A 1ZRSA 1Q0SA 2IRXA 2VTKA 3Q7QA 4ICLB 3MJVA 3T6KA 1PLKA 4KOEC 4S12A 1POXA 2OG1A 3FZNA 4TV8B 3Q8UA 3QW2A 3JWEA 4ZP6A 3B8HA 4JFAA 5DNVA 3R4VA 1Q0PA 4Q47A 2BZ1A 4MPPA 4DLBA 1E6CA 1QIDA 1M0TA 4ZYWA 3ML1A 2B7LA 3GZ7A 4F06A 2VUTA 1IQRA 2OEKA 1TKDA 2ALYB 1LBHA 2J6CA 4DR5B 3J7AC 1FQJA 2UYYA 3VAIA 2Z5VA 5JSZB 4PGMA 5HFJA 2AUMA 2PS1A 2AUTA 2B34A 1RI7A 3HVKA 5CX4A 2DFTA 3U7RA 5ES3A 4KOAA 1G20A 2RKOA 3PEHA 2B4KA 2A1UB 2GUGA 4W9NA 3LPEA 1A0OA 1ULSA 3W5HA 4AL6A 1EDZA 1UEUA 2ZRPA 3FDFA 5CDFE 1Q44A 2UUAB 2JFOA 3V2UC 2F3QA 3BQ9A 4AUNA 4IOLA 3ADAC 1HR0B 1B8UA 2UUWA 2QE6A 2NZVG 2GH1A 1VGQA 2I4OA 3AF1A 5BUZA 3QFHA 1Y3JA 2VP5A 3L7JA 4U9RA 3A11A 1PJLA 3PNKA 1EX6A 1ZG3A 1ZU4A 4ZO9A 3RH0A 3D3NA 4RMGA 4KKOA 4BNVA 3BE6A 4Z7QB 2JEJA 2F5GA 3ZDZB 2FLWA 4ZT6A 4EVSA 5A6SA 3JTOA 2DETA 1F3VA 4UD2A 2COEA 2BKLA 2JFXA 2XJ4A 3I0RA 5J40A 3R0ZA 1WZEA 3VVMA 1NKTA 4LYAA 4FGKA 4CLRA 4F36A 5HEKA 4NMWA 2W8ZA 2DH6A 3D8HA 1ICEA 1A77A 2KRBA 1DEXA 3KDPA 2M6KA 2YV3A 3A3OA 5BV1A 2RRNA 2XGGA 4OJKA 2ZULA 3P0HA 2WB4A 3IWNC 1EUCA 4BX0A 3C5EA 1VBFA 4PPNA 2Z6VA 1K7YA 3E7FA 3UC9A 1USKA 3OZFA 2BBEA 2Q6IA 3K0KA 4S24A 1AKYA 4RLQA 3PNPA 3QSGA 4F1WA 3H2ZA 4XDHA 4LZJA 2C1EA 2D2FA 2RRAA 1ZS6A 2HHWA 1NZFA 3PTZA 1NTRA 3VU8A 3HWX1 1AMUA 3O3NB 4U9UA 1JJHA 4QWBA 2PIIA 5KOHA 2IE0A 4B34A 4BFCA 3EXFA 1V1JA 2GXUA 2QT1A 2ZUDA 2N3OA 4EKNB 2FY1A 1QORA 1W52X 2CJWB 1S2IA 2AEJA 3T94A 2DWOA 5L3ZA 3G9CA 1JXOA 1WHTA 3IAM1 7MHTA 1DRZA 2RSQA 2OCKA 4ND5A 1S9GB 4IIGA 4G23A 2WJGA 1YR6A 5GM2A 5TMDA 5FWXB 4CF5A 4BPBA 2E9SA 3ZQ6A 2V59A 3GPCA 1EDOA 3CWJA 1E4EB 3WGGA 4DL5A 1QG2A 2FQYA 3UN5A 1BZYA 2QN3A 2XI3A 4ERXA 5AJHA 1CULA 1KSFX 2J4FA 3RIHA 3BMCA 3IXQA 5LFAA 3MECA 4TY8A 4HAUA 3DTVD 1CJMA 5KT6A 1DJMA 4P22A 3CEJA 5REQB 3G1WA 1TO6A 2GZ2A 4XKJA 3FROA 4M7RA 4EJ6A 3TQQA 1XU4A 1RTDA 3HVTB 4YRDA 3TAHA 5B37A 1TVCA 1K97A 4OK6A 2QKYA 1J33A 3CE9A 4LXHA 2MMGA 2X7IA 1RCFA 2CL0X 1U1KA 3WGTA 3PJFA 5LIPA 3QHPA 5I4MA 3DL0A 3ZHZA 1RABA 2LA6A 4ZAXA 5AK0A 3BD6A 3M2TA 4ZVUA 1GUZA 1SD5A 3L7DA 3PEYA 1K92A 1O5TA 3DFKA 2BR0A 2C57A 1RHQA 4EBDA 4XQEA 1NBMA 5I9TA 2A5FA 3WGZA 2ODBA 4R5PA 3DE5X 3L0IB 4HEHA 1M10A 4F9EA 1VLOA 3NR2A 3IYLW 2G3YA 3LRXA 5DM7Q 2V5VA 2YHIB 2H11A 2FHJD 1G66A 3SM9A 4C08A 2GCGA 2V0CA 3E3AA 2AFRA 4O4GB 1UKEA 1IHYA 1NJWA 1CJKA 1VP3A 4M0KA 1TYAE 5SICE 3D1VA 5AHKA 3TJRA 5EXDA 3ZWQA 1JR2A 4E88A 2RIPA 4UAUA 2OO4A 2PS9A 4MCJA 3Q98A 3OQMA 1SQFA 1E3IA 1ZHHA 1W5TA 4RW0A 4HB0A 1SMKA 4YRTA 5B6JA 3PPWA 2CLIB 1KZ6A 1V7QA 4ER0A 4AJNA 4OX9F 2UYOA 1OWNA 3BN4A 2JIBA 2W6QA 1I4WA 1JIXA 1V0JA 2IYYA 4HEA6 1ODSA 2NUTB 3T38A 2E5GA 3G96A 4ISBA 4OMCA 1C8VB 3TW4A 4TL6A 5AKIA 1G3OA 2IC5A 1USVA 3P0JA 4ES6A 4IDDA 3A3NB 2ZYHA 5JE8A 2WTBA 1Q2UA 1RT7B 1ZR4A 1RYFA 2O2YA 2PANA 1ZMTA 4FS8A 4WBNF 2GHQA 3SYKA 4ZZ1A 3EAFA 2WJ6A 2QT9A 4GF5A 2QE7D 5FA5A 3IPRA 3SIXA 3VDRA 1H2ZA 4DSJA 1A5TA 2KM8C 1U3DA 3ITHA 2Q5OA 3LO3A 2RNEA 1WP4A 2GASA 1KJIA 3BTOA 2W6JA 1Y42X 3ICVA 1VQKS 2R6FA 1FVOA 2WBLC 3NXSA 1F5CA 2HSDA 4MLZA 1KFCB 3PITA 1YKFA 1R3NA 2G2YA 3IRUA 4BUZA 5KFIA 3IAAA 2QW8A 2WWWA 5AXNA 1QYVA 1M66A 4M8IA 3PYGA 4U67Q 4RHYA 3A6JA 4E5VA 3UVJB 3D7SB 3EZYA 4AT1B 3O38A 1VFNA 4UBOA 2Y1XA 1CF9A 4RVHA 4Y1FA 3GXOA 1CYDA 1G2EA 3TEMA 2Q5LA 1TCVA 3KOXA 1B00A 4Y2TA 1J22A 4NCXA 1LUAA 1NPTO 1UDCA 3K9GA 2IWRA 3MEEA 2XWJI 1WW8A 3VC2A 3PXUA 2I4TA 3KYCB 3AVPA 2FWRA 2YMQA 3EEFA 4DV5B 3B3AA 1F17A 2P41A 2R60A 3RVJA 3O2SB 4I9UA 1E20A 1IJBA 3FHLA 4PRLA 3TXXA 2R9VA 5J2UB 3NNSA 4ZI3A 5F35A 3RFVA 5BT8A 1O5JA 3QU5A 5GAHU 1WBJB 3KG0A 1OYEA 1GRCA 2G6TA 4N0PA 3DMDA 3CCMS 5K4AA 5LL6d 3JPYA 3N6RA 4RTPA 1BXZA 5G40A 2Y68A 1QB7A 2ZZTA 3R41A 3T9FA 1YRXA 1VPLA 4FCTA 2WOJA 3R9KA 1DHRA 5BQFA 1GTRA 2RONA 3C6UA 1R8AA 1SL0A 5FL3A 3Q85A 4Q1CA 3SZRA 3WBZA 3AKCA 1GT8A 1EAMA 1CRQA 5JZVA 4CLUA 2W2VA 1J5OB 3LUBA 3BGIA 3OUUA 4PLYA 1SRRA 3EPIA 3TI9A 5LA6B 2QY9A 5IF9A 4CV2A 4RW6A 2KI2A 2VOJA 2EDCA 4I66A 2CLHB 2YZGA 2RE8A 4X6XA 1Z4IA 4NA3A 2XAAA 2C7QA 3T9NA 5A71A 1HORA 3ZVMA 1C3OB 3TZQA 2VAXA 2AJBA 3ZQKA 4X20A 1RT3B 5LP6C 4LE2A 3BMNA 3ITEA 3QKRA 4BC0A 3UXEA 1BMQB 3I34X 4QU5A 1DUIA 3KOAA 3VH2A 4LDPA 3WRXA 3CUEF 3G2NA 4V0OA 3UCXA 3N70A 3SZMA 2HXSA 3ZX4A 3PZPA 2I54A 4FQ7A 3IJ5A 2I0FA 1F8FA 1OD6A 5F3ZA 4KQGA 2KVIA 2HMIA 3O8DA 4IHKA 4BEBA 3QNMA 5AHWA 1QG6A 1V3ZA 3T4PA 4X92A 1DCTA 4NZOA 4RV5A 1Q7GA 1OAOC 4TSKA 1TM2A 1H6KX 3VNBA 4MPDA 5AT1A 5FPYA 2XB8A 1A8IA 5AICA 1JDTA 1SKQA 4N47A 2H4FA 5AK4A 3UWMA 1U90A 1A2OA 2YX4A 2BJ8A 2YTZA 4FFBB 1PJ2A 2BMAA 1N8TA 4WINA 1EGHA 5TIIA 1NU8A 5J2TF 2O2EA 3IOEA 3DYIA 4G5YA 1M5SA 1V5IB 4TQ9A 3MT8A 4RIGA 4RQUA 3RU0A 3R5KA 3IBCA 1OYYA 1D9XA 1KQKA 5U9CA 2MQOA 2FZVA 4C0OC 2YQ5A 2XMQA 2AYXA 2OBYA 3SZLA 4MTLA 4LWOA 5CJ2A 5ICEA 3QZ7A 1O6FA 1HDYA 2F1IA 3FSJX 1V1MB 5LXTB 4MUMA 3NALA 2RGNC 2FQXA 3UQYS 3KPWA 4QYMA 1RXUA 1W96A 1W1UA 3CCVS 1VI2A 1P7CA 5L3SA 5BV2P 1CJUA 3CEHA 1QH9A 5EGYA 3E5MA 3U80A 2J0VA 2H1WA 2GYYA 2QN2A 2V2QA 1NZJA 2ZFHA 4ED9A 1C7ZA 2OB2A 4JOQA 3OT9A 1HW9A 2WKRA 1I6MA 3ED5A 3JAMU 1N2IA 4N39A 4EI8A 3TZZA 4DPKA 3EPPA 1E2DA 3ZCPA 2TMYA 3CC7S 4FYYB 1FRJA 3I76A 5M2PA 3UK6A 2AE2A 1YZTA 3HI9A 1FVQA 1FJGJ 8RUCA 3UJ8A 1RI4A 1SPBP 3OJEA 4G2NA 1QHEA 1V26A 2QTBA 4NYJQ 3HBAA 3PP8A 5DW0A 5A5GA 3ER9A 4IGFA 4IG3B 1ZZEA 2LEBA 1GR1A 3VCDA 1XNQJ 2GB4A 3GR0A 1AZSB 1Q14A 5C8YF 2BCJQ 3PQCA 1T11A 3NRBA 4WNYA 1N5QA 5DEOA 1CIJA 3RS9A 5JQGA 4PAAA 4Z9BA 4DV2B 1ECFA 1CNMA 3IQDB 4BVGA 1DIRA 2H31A 3IUBA 3LFHA 4ZN3A 4JJIA 3ADOA 3C6TB 2LIVA 3Q89A 3CDBA 5FJJA 1X1BA 1ZHOA 4IFTA 2V2VA 5HRAA 2XDWA 4DRYA 1KJWA 2JAUA 1W2GA 2TMDA 1TYBE 1Y5IB 4BN5A 4KQKA 2B7CA 1ZOPA 4FBTA 1RRVA 1U0LA 2HBYB 5JRDS 3SZGA 3VQSA 1J24A 1TF5A 4MUFA 5B4TA 4F0JA 2PI4A 4NYIQ 2O3DA 5AHXA 4E0DA 1HDRA 3GEBA 4ZVHA 3CCZA 1U6IA 5EYPA 1DWPA 2GHIA 1F3LA 1Z7YA 3ZU6A 4ZOBA 3AOBA 2VKRA 1ULBA 4XDYA 2HNYB 3C6QA 3DTVA 5ESXA 2J7PD 1EX8A 4U7WA 2IV2X 1Y8QB 4IIUA 2JI6A 1DKMA 2P5VA 3ORHA 4L8YA 3MAGA 2P0EA 4Q7MB 4KNWA 4M7WA 1YI2S 3KQVA 4U3JB 4WJZA 3B38A 3VHXB 1L1QA 5CDYA 4AFNA 1PCAA 6Q21A 2P9EA 4XXHA 2ZWAA 4EATA 4IFVA 2Z58A 1YHYA 3NJ4A 1VFPA 4JBNA 1QDLB 4E5DA 1KU6A 5FBHA 3LPDA 1YZGA 4FGJA 4Y2YA 4MUNA 2ZOMA 4U5XA 4QCLA 3C3WA 2Q2WA 4C8MA 2MZQA 3W2VB 2K7KA 1QOZA 3IKMB 5L4LA 2MSEB 3HKBA 5U4QA 3ZN2A 4OLHA 1RAOA 1Q78A 3KJGA 2H59A 3CPSA 2DC1A 2I4NA 3D1JA 3MGGA 1NXPA 3DOJA 1K7CA 4RDIA 1X7WB 3VR4D 3U9LA 3IJRA 2FU5C 2O5RA 3CJTA 2W70A 2V6AA 1NDQA 3A1NA 2H17A 1NXWA 1Y4ZB 4ZEXA 2NO4A 4KFBA 5I3UB 3IB3A 2FHJA 2EERA 4CMIA 1IK6A 3AUXA 1G3RA 4DLKA 2Q9CA 2GAAA 2LKDA 2BFFA 1HBUA 3A28A 3L8FA 1F7VA 1JIVA 3CPJB 1NWCA 5LZ8A 3WWOA 4X54A 3M5CA 1JDSA 5CD9A 3WGUA 1T35A 3CLSC 5B3LA 4KE9A 3CW2A 1YQEA 3OP4A 3FVVA 4KR3A 4RZ3A 4BFZA 3DLIA 4JAVC 3CVVA 4MQUA 3BOSA 4KMMA 3JPWA 4XPZA 721PA 3EARA 4O1HA 3L95X 1RNLA 4J0QA 2A3NA 1G8HA 1HK7A 1JPVA 1YFJA 1SKYB 5ILQA 3VSEA 1FZTA 1WU8A 2B99A 1W4AA 1JSRA 4GPAA 1S01A 2WJAA 3U31A 3I9JA 4HDSB 3U4GA 1HZZC 1UTAA 3PXGA 1F2GA 4QL3A 1D5WA 5IFKA 4BVBA 2PUVA 1VS3A 4GR9A 2P77A 3LWBA 2DFDA 4IDNA 1WB5A 3JQPA 4HPXB 1VRWA 4EK9A 1IOLA 1U0GA 2WQ7A 4ZQBA 3BJRA 2XNRA 3V8NA 4KR2A 1YDHA 1KA9H 1CR1A 5TXGA 3LDUA 2ZAIA 3T99A 3K0CC 1CY0A 2VPXA 3I5AA 1D2MA 3EEQA 1Z0JA 2VDIA 2WKQA 4DMMA 4HR2A 3MJRA 1ND5A 5KDDA 1W4CA 3I05A 4PLHA 4TKVB 1PTKA 4ES2A 2WIAA 3PIRA 1VQPS 2WVGA 2WMYA 3IS9A 5KTPA 2ENWA 2FP4B 4YN3B 5I42B 1ZICA 2JEYA 4ZARA 5A4FS 1PSDA 3KFLA 2QTWB 3AHGA 4B3RB 1X1QA 2OGSA 3DAOA 1NF3A 1S9FA 4QG3A 1FXRA 3GFSA 5A3RA 2I4IA 4HQFA 3VO8A 1WPGA 3QLVA 3B6IA 4DLXA 4EA6A 2QAJA 4UBJA 2HN9A 2QTVB 1FVXA 4L2IB 3I92A 1KWMA 4DJTA 3FPSA 1T1RA 5AOBA 1AS3A 5D7NA 3C6ZA 3PW7A 3T1QA 4ER3A 2JA2A 2GVZC 2JWNA 5DXJA 2FRVA 3P5SA 1WWKA 3THWB 5K0CA 4AMUA 4RMHA 1GPAA 3EQ9A 4RZ2A 2D9OA 3MPVA 3U7FB 1E1MA 2EG9A 1HSZA 5EJ6A 3QRPA 2EF1A 3ZXYA 4MGYR 3ZE7A 3B53X 3VC3A 5AKYA 4QU0A 1AHHA 1R6DA 3CZRA 2O3UA 1SV5B 2NUUG 3GFZA 1FT8A 2HKEA 4UBLA 1Q81T 1WA5A 1FFSB 4HHEA 1TCCA 3DVLA 3W9IA 1GZ3A 3GU3A 5CAEA 3WJAA 1D1UA 3IAHA 5IDWA 1SH3A 4I50B 3OQPA 3UT0A 4JEMA 4FPRA 4TV9F 3JQRA 4ITUA 3BRCA 1PYSB 3MD9A 1I3OB 2Q6OA 1ZMRA 4KIUA 2FZWA 4R7TA 4BMOB 2JLYA 3JRWA 4RPFA 2ASLA 4ZZ2A 5HPYB 5F51A 4MMOA 4I56A 1YO6A 1PJ6A 2QTNA 4RD3A 3I9LA 1M7BA 3A6EA 4RCYA 1VGRA 5IX8A 4B6RA 5DRTA 1T4BA 3BSOA 1NP6A 1XV5A 3JU3A 2IM2A 4K81B 4CM0A 2NACA 1ZGJA 2G76A 2Z4RA 3WDLA 5TSDA 1I14A 1J8FA 3JWHA 1ZNWA 3FR8A 1LV7A 4M63A 4M7OA 5KYKA 1O6GA 4ZN1A 3VR5D 4UM9D 3E4DA 4MUJA 4L5CA 1GFWA 2WK4A 2BZSA 4USWA 4ZLPA 3CCLS 1VQ5S 1US8A 1NVMB 2R66A 3MGAA 2DRIA 3FVWA 5EHZA 2BUBA 1R5NA 1CQPA 1XJWA 2GPNA 4D9MA 2OI2A 1TEHA 3ENKA 1M75A 1KVTA 4CKCB 1U7ZA 1Q1QA 5BMOA 4F9TA 4LBVA 1BJTA 5KMGA 3IGNA 1GA1A 4TMYA 3DNPA 2MSLA 1KIFA 2CFTA 2YY6A 4DSFA 4GLJA 3UUGA 3C6XA 1QLHA 3QU9A 1I24A 4AZWA 4RY0A 3W1WA 3AHPA 1TYZA 5D2CA 2GBLA 4B48A 1KJZA 1FRHA 4RFSA 3KLIB 4R1LA 1DQ9A 3HCAA 3JQGA 1Y8RA 1QWOA 2H54A 2EZTA 3P2KA 1LJUA 1XA3A 1RWQA 1BN6A 3Q8YA 1DTTA 1E1QD 2WVFA 1OZAA 4JGBA 5LNK1 4MGIR 1JPNA 2HU5A 2ACKA 5CT8A 4NENB 1H8ED 4WXEA 4EG5A 4F2DA 2Q2NA 3RJ5A 1YOBA 3I6MA 5EIWA 1ACMB 1UC8A 3ABQB 1T4CA 2AK3A 1EU1A 2DUJA 4AYBD 4S3MA 5EIOA 1CEQA 4RD0A 4PZPA 5BR7A 3UH0A 2W9BA 1V8FA 4H1WA 2JAXA 4U8YA 2AKAB 1M6EX 2IHR1 4FYWA 3FIJA 3GHYA 3EXG1 4KW7A 3M30A 4JYAJ 2VA9A 3RT9A 2F55A 1DIOB 1IWOA 2H2HA 1RIFA 3K1TA 5K05A 3MTBA 1PSWA 5K8LA 1IC6A 4RBNA 4GPIB 1ZOTA 4D02A 2F9LA 1HYGA 2AW0A 1VMDA 2M9KA 1VJCA 1N3BA 3VZRA 3CTMA 5A4MS 3WLTA 3PI6A 5LIRA 4EMDA 3UTCA 3TNYA 1KAOA 2WMOB 5KG6A 3V80A 1Q8BA 4DCJA 1QG0A 3R44A 2QRUA 4HXGA 4B3TF 8ATCA 1YDEA 5JIBA 1JLQA 1SVUA 4RSMA 5GINE 3LVRE 1H7XA 5HROA 4KHPJ 3FNBA 4BFUA 3LKDA 1EXDA 4OI1A 2AF6A 4YRKA 1HWKA 1USUA 2YNMC 3WLJA 5KSZA 5SZKB 2FDRA 3L7AA 1JDZA 1T2NA 2KQUA 1FKOA 3TPCA 1DZ5A 3WSTA 5LWHA 1MP0A 3WKCA 3V4IB 1I51B 4QYZK 3V2IA 2GNAA 2AN5A 1XPRA 1MLDA 4RKWA 2GPAA 2KMLA 4Y28C 1B73A 3O31A 4HWTA 2WWGA 4AY6A 2IH4A 4GMDA 1OROA 1G3UA 2YJ5A 3I32A 1AZWA 1AB6A 4P71A 4RNOA 4LK3A 4M1EA 1DBRA 3J81j 6AT1A 3UFCX 3DJYA 3NWEA 2HWYA 4GMHA 2IXDA 3DEHA 5MN5A 3TRIA 4B3MF 4L74A 1KYXA 5GZ6A 3ZHVA 3CRZA 1UJNA 2IVYA 4OY3A 4U2CA 3MYRA 2DZDA 2OYSA 1TM4E 4A2PA 1P7PA 2D3TA 5EVCA 2J7PA 1UQUA 4HZGA 3EXHB 3OCWA 3EXIB 4DNOA 4NAVA 5JYBA 4JI1J 3MIIA 2WYVA 1EE9A 1YJQA 2XLBA 1XU9A 1UL3A 1Y80A 3HT0A 1BJKA 2XQKA 1SXJB 1G9TA 1TL7B 3HNOA 2WD9A 2F64A 1ZUHA 1JDBC 2NUAB 1JP7A 3P0RA 4GQAA 2OZLA 2ZB7A 5GVSA 3CJ5A 3ZHTA 1Q1NA 3GDFA 4K26A 2O7QA 5H70A 4C3MA 5L51A 1L5MA 2C5SA 5FFFA 1M83A 3DCAA 2XA9A 3MPDA 3WLSA 1Z2ZA 4NRTA 3E81A 1NUPA 1TA9A 3Q3EA 3GMIA 1YVRA 1J1UA 4U0JA 4YJFA 2LP4A 3KAQA 3PRJA 1DRVA 1DADA 4EUHA 5FO0A 2X19A 2VEOA 3U2QA 1XRNA 3WQSB 2ZBEA 1KP9A 4AYXA 1Q0UA 5JAUA 2J7KA 1CB7A 3WK7A 1I33A 4TUYB 3CCFA 1Q74A 4KXFB 1ZL0A 2Y1LA 4ZQIA 1YRUA 3VR4A 1Y89A 4NARA 1HBNA 4G65A 2XODA 1A9YA 4EFMA 2WG1A 2EL7A 1GSIA 3G6WA 1JR3E 3D28A 2UZ1B 1XZQA 5GWXA 1F60B 2FGCA 4MTCA 3EJWA 1J7KA 1UPBA 1TKZB 2G7MC 1QHHB 3RHZA 4C8LA 4DMHA 4E1AA 1IWPB 3PDJA 1TFRA 4HEA9 3S6EA 1AK9A 1PO7A 4LF9B 1J42A 2I67A 4HB4A 2P6MA 4IKOA 3KXIA 1DCFA 2VHZA 4RQBA 2ZIFA 1N2EA 3QBEA 4KRXA 2QUJA 4US1R 1AKWA 4YAWA 1DDOA 1W7WA 4USHA 4MVCA 2Q6LA 1Z2LA 1W34A 3DFIA 5H80A 2YH1A 1GGHA 1YS9A 2P6OA 4LFCF 3MOGA 4MKYA 5EJ8A 1WNFA 4QJIA 4U7HA 1PEDA 1VKHA 1TMOA 3CZMA 3HYSA 1IH8A 4Z3OA 3I0MA 1KZ9A 1R15A 1UZMA 3HB5X 4KSBA 1QK3A 2OAUA 3DV2A 1EFRD 3EQ7A 2JLFA 3QI7A 2BKPA 4B3GA 4OZ2A 2I87A 5AIAA 3ETNA 4H35A 5L53A 3G9UA 1DOHA 2V7UA 5J23A 2G1PA 1A98A 1OWMA 1ESMA 4MRRA 5CNKA 5CBPA 1WI8A 4F9FA 4C5AA 2FPRA 2GHWA 4JI0J 3LYUA 3KKLA 3TQIA 5JAPA 2JHCA 3PFNA 3C19A 2A2CA 4HG2A 2QVXX 1D0EA 1PR5A 3MEDB 1L8OA 4QT4A 2PMBA 2HBRB 2BFAA 1I6JA 4KL8S 4RZHA 1S12A 4X7PA 1UAWA 4NOKA 5DTJA 4NXMB 2XB4A 3EUAA 4REOA 3HPOA 2G5TA 2HXGA 1BQXA 4FNIA 2GCOA 4Z7NB 5CX1B 2WTXA 2ISQA 2ID9A 1IEXA 2HRTA 3T5MA 1HNXB 1PX2A 4UT4A 1ETHA 1XDZA 4MS4A 3ONEA 4KAJA 2N9UA 2WB1D 1G5TA 4DY6A 2R2RA 5F23A 2J8AA 1Z0KA 2I66A 1HW8A 3A4VA 1HDEA 3RASA 1GH8A 2GJIA 1K8XB 4ACBA 1PU2A 3HCXA 1B4DA 1PQ4A 4DA9A 1WG4A 4QWDA 5CNIA 3ZHQA 4NABA 1Z3CA 1R7RA 3P7MA 3H6GA 1X38A 1MT0A 2MSWA 2R7XA 1FPMA 5FOUA 2P3LA 3IR5A 1QH8A 1GQQA 4J16A 3D0GE 2O2IA 4DILA 4XPCA 5L9AA 5T3UA 3QKSB 2DUNA 2L9NA 1TPYA 1G5FA 4IDOA 2ZG6A 2QD2A 4C0QC 4KQ9A 4JOUA 3ESDA 1R6YA 1N6RA 1VSUA 2BDPA 1C1CA 4X97A 4EW1A 2RFLA 4OQNA 4Z7JA 5IDQA 3DI6B 4KYIB 5I3UA 1F2HA 3OFHA 1DQYA 5DGXA 2Z1NA 2O7NA 2P35A 1YQDA 1IM4A 1MHTA 3MTGA 5T5QA 3BKFA 1BIFA 1PGNA 1FDWA 1JQJC 4OZ5A 1M1ZA 4D3FA 1SUDA 3IKJA 1GEEA 3FRYA 1G19A 3KP1A 3KRTA 1ZAVA 4KVGA 2DBVO 4DLVA 4UBNA 1ZS9A 3PWSA 1MT3A 3M7VA 5GOTA 3M6IA 4RD6A 3VWSA 5H1SV 3CZQA 4HWKA 5ALKA 5HP1A 5ALWA 1KAMA 1K6XA 1IUNA 1DQSA 5ITSA 1ZJ5A 2Q6VA 4TVKA 4PYQA 2X6RA 1JWWA 4DR6F 3BHJA 3TRJA 3FAZA 2J31A 1OQ3A 3T1YF 3MWDA 2WEKA 4HGRA 5ALLA 3F9RA 2I6UA 4GS5A 1SEPA 2XTNA 3R9XA 1Z13A 3HDHA 4I99A 3VR5A 2AJFE 4WW0A 3HA5A 2EJVA 1KZGB 5L4NA 3PTLA 1M2VA 2PH7A 4ZZ3A 5KWVA 2JJ4D 3L40A 3KU1A 1YA4A 4FC7A 3GXBA 4UOEA 4F5EA 1JT9A 1Z15A 5CPBA 1ZVMA 5HQJA 2PUGA 3EIQA 5H68A 4PCQA 3BH6A 3EEIA 4LGYA 1EAYC 3ADCA 1P18A 2OV2A 3D43A 4BNZA 4I68A 4CKWA 2CQ3A 2WYIA 2VDKB 3QJYA 3GLRA 3DLGA 1EBUA 4RTRA 2C9CA 5L46A 4URVR 3T15A 1M5OC 4RNHA 1PRYA 2VZ0A 5AUPB 3JRNA 5DQHA 3G4SS 1GQSA 1M76A 5H4GA 1RAHB 4S1WA 2X0NA 2TS1A 3COSA 1T36A 3RU2A 4ZDIA 3C4QA 5NLLA 2NVOA 2XYHB 1FCJA 1U0RA 4KR9A 4GM1A 2WM3A 2I38A 3KHLA 2BGNA 3PKZA 4LC0A 1TTPB 4NMXA 2HHVA 3C48A 1YR9A 1J2YA 3EW9A 3LC2O 2QG9B 4JLWA 1BVHA 1V48A 1H8EA 5U1PA 5TJHA 1C0LA 3VZCA 3JSAA 5F8IA 3TANA 5D6NA 4E15A 1PJCA 3EIHA 3UB4A 4CUZA 1XNRF 1XTTA 3TW8A 1WG1A 4FB5A 2OZPA 5DG8A 4CV1A 2QRGA 3AXKA 4NI5A 4YECA 1E59A 4LA4A 1PGQA 1VJTA 2VQFB 2JLZA 3ROPA 4JVNA 3U27A 4PF1A 2B3DA 4RV4A 1SJ4P 1W25A 2KFZA 4PABA 2J9GA 3ZDDA 3FEXB 3DC7A 3H5RA 4MDYA 5COBA 1VRTA 3GJ6A 1DJ0A 4WOJA 4BEVA 4WMLA 4N7JA 4OOEA 2B3TB 2I2WA 3TGWA 1YTUA 1ZJYA 5JMTA 2BMWA 3HWRA 2R6DA 4AJLA 4RF3A 4G5RA 3M6WA 5GVQA 2MLYA 4LJKA 2G9VA 4DXHA 2NZXA 4A8SA 3PNIA 1NSAA 3I2GA 4MYHA 3INYA 2B5OA 1EI9A 2CFCA 2V55B 4HCJA 3M6VA 4O3FA 1HQEA 2VUGA 1X31C 3WTCA 3ZBPA 4E5UA 2V9PA 2DY1A 2OV1A 3V5NA 4KP7A 1BOOA 3LUDA 5JSFA 1CP3A 1M90T 3B85A 1SL2A 2BHSA 2YIMA 1FPQA 1BW9B 1QPBA 1QIGA 1KOGA 3UTDA 2GN4A 4P9SA 3DTYA 4N6OA 3K2EA 3MEQA 1XMQF 2OFWA 3KUHA 3LVBA 2WVDA 3THPA 4DLSA 3RFTA 4U00A 2YUTA 1VLZA 3BA1A 4M60A 1T3ZA 4C4ZA 2Q3PA 4H3VA 2CNOA 2XUJA 3G2MA 4NNOA 1FRFS 3A4TA 1B6SA 1DKNA 3PHBE 4J8PA 1PZNA 4N8NA 4KFTA 5LQJA 2CXUA 1TF2A 1N2BA 3MI7X 3B2EA 3H84A 2MKYA 1HLPA 5FCDA 2WINI 2OVBA 2JL1A 2QMOA 1NVVQ 4PGGA 4YYEA 1BS2A 3GQBA 2AZTA 3WKAA 1NH8A 4KHZA 1NKEA 1U0EA 2UV8A 1NUHA 2ADCA 3OQ6A 5JVDB 4O4HB 4F12A 4WOKA 1UBTS 4WBXC 4OZ0A 4EBFA 1NVDA 4WFKA 4X66F 2QUHA 3TKYA 1H2HA 2VNAA 4KB7A 2R68A 1KR4A 5BR8B 5JEDA 1WHSA 4A8JA 3OTEA 4O33A 1XZMA 1GGEA 3JD3A 3ZDRA 1O5IA 3PPIA 1JLKA 3AIIA 4EFAC 3QF7A 4F3KA 2C9MA 1R0BG 5C2CA 1VCIA 2MMCA 2IM3A 4DQIA 1D03A 4ZQCB 4D26A 7ABPA 2K7JA 2I91A 3AA8A 1ONNA 4G0OA 2JAPA 3DDCA 3OFVA 1X3LA 3GFGA 1M6YA 3AO0B 1R8XA 3RJMB 3N8NA 4G3IA 4C8NA 3R1HA 1RD4A 3MIZA 1DPFA 4XFDA 4MUEA 2K1RA 4QUJA 1EVIA 5H9EK 5D3QA 3QLTA 5FNVF 1JEQA 3OU6A 2J9FA 2A92A 5A4IS 1Q3KA 1APBA 2FZEA 2C92A 5CRIA 1XDSA 3OQBA 3GLIB 2PMDA 1MG7A 3BDAA 4J0CA 3GV7B 1VM6A 2H2IA 2OBLA 3MAAA 1RLIA 1NMZA 1EGVB 2FEOA 5K0EA 1NEEA 4MCIA 2VG8A 3FZ2A 4C03A 3L0SA 2M6LA 4AQYJ 2RKIB 2RARA 3RABA 4NATA 1TT7A 4Q6WA 5DO9A 2E89A 5FPHA 3MQ2A 1EFRA 2B92A 2D7SA 4MA5A 4MO9A 2PLWA 2WSSD 4B3OB 3T41A 1Y1QA 4WZBE 2AJCA 4RZUA 3A9CA 3M1VA 4H6PA 4WI1A 1U47A 4DZDA 4ER6A 1SZCA 3EGCA 5DIFA 1RWUA 3CWCA 3NVKI 2WU8A 2ECQA 2NYVA 3SQLA 2MZSA 5GM1A 3TLMA 4ALKA 3MPUB 1K7EB 1YJRA 2L0XA 1J5PA 1N36F 1NVTA 5C9ZA 4Z9YA 2XR1A 1N7JA 4ZI7F 1Z6GA 2IEYA 4TXSA 5KG5A 5IQ6A 3IP6A 4PRFA 4IDAA 1E3DA 3MMNA 5LD2B 5HS4A 5H9FJ 3DNCA 4BS2A 3ENNA 3DLEB 4CF3A 4NICA 5FD8A 2PKXA 3G2OA 4PZAA 4YUXA 2PL3A 2NUAA 5SY6A 1QGYA 1G6HA 3OLVA 2C5HA 1JBKA 3N86A 2RC5A 3GRFA 1P33A 3KKOA 5IQQA 2ZIXB 1MX3A 1JEOA 3W4KA 1LEOA 1ZD4A 1TMKA 1RADA 1DIBA 3AEQA 4Y2QA 2O3RA 4FMPA 3HXTA 2OR3A 2R7TA 1VBNA 4ZVGA 4LJLA 1GNVA 1OIAA 2RGDA 1NB7A 1X6VA 1QIEA 2W6NA 3STTA 4LXQA 2XT0A 4BO3A 3QLJA 1QFZA 2AFIE 2JPDA 2ZRNA 4YRPA 2ZEJA 5BNTA 3BDEA 1RJGA 2OAQ1 2BUNA 1XDUA 1SG6A 1P2DA 4NOHA 1RXWA 1C4XA 4DV7B 5E9AA 2JNJA 1KH1A 2NTEA 4DR1B 2YZ7A 1ORWA 1VJQA 2RDJA 4C7BA 3KZNA 2BR4A 3KJZA 4BQSA 2AG5A 3UEOA 1GA6A 1GADO 1N32F 2CJFA 4HDKB 4TL8A 1GTZA 3BH7B 2OHFA 4EG3A 3SJCA 4EJFA 4HI2A 5F0UA 1WPQA 2IJFA 3W2TA 1P4HA 3L7BA 2ZIAA 1T9HA 5KFGA 3WVNA 1LBTA 4DV0F 1QYDA 4A8MP 1SBNE 2EU8A 3KXPA 2QN6B 1TCBA 2JFYA 3VAGA 1EXVA 1X7YB 4Y2KA 3DCJA 4NHOA 4X4OA 1E6UA 1RJJA 1JX4A 1J8YF 1B23P 4AYWA 4H1HA 1SUQA 2D1CA 2D8AA 1S6PA 5LU8A 4OI6A 1X4FA 2AFHE 3SAJA 5B0AA 2P2YA 5TEVA 1NYQA 1R9NA 3CLRC 4P3PA 2RB5A 2XA1A 4LF6F 4MWBA 3T19A 4B7CA 4X63A 4ZJUA 5FWAA 1DIGA 4BBPA 4R8UB 3V2GA 4ZP1A 4DM3A 1J0EA 1CY7A 4M87A 2ANBA 3N3AC 2JAHA 3O93A 1LNSA 2AK2A 2BLLA 2MQQA 2DGOA 4BNXA 1NIJA 4CTMA 4BP1A 3HM2A 4NF2A 1LA2A 1UBEA 3PF8A 3LGMA 4K0KF 4EELA 4GR5A 2FJ0A 4JBIA 2XZWA 4TLQA 4YAKA 5JVHQ 1A2KC 3PGKA 4CKBA 3GRPA 3WC0A 3OF2A 2IU3A 4TRNA 2ZJZA 2ACWA 1IRXA 3MTJA 2Q5EA 1AX9A 1SZDA 3PDWA 3IPAA 3MTDA 3HKCA 4RGBA 4LVOP 1OBFO 2FPOA 1U6FA 3L82B 1UFVA 1PO6A 4LJ4A 1G38A 4MV6A 3C15A 3MMBB 2ECOA 1VL0A 4OLBA 3FCEA 1BJRE 2C5EA 1D8AA 4HX9A 3ECSA 3KUUA 5DMHA 3DPIA 2KLHA 1G291 4EPYA 4CVNA 2VYCA 4FXPA 1ZSNA 5DBGA 3RYCA 3K96A 4HT5A 4F56A 1ZZFA 2F3PA 2JFQA 2O5CA 5DLGA 1U3GA 3DTTA 2VT7A 2CNNB 5EWEA 2RHGB 1EEXB 3REQB 2DNMA 3AMVA 3V4PB 3GPDG 2FX2A 2J4CA 5BSHA 1XXHE 2PGOA 3QGHA 1BDMA 5THXA 1X1EA 2ALJA 3JQAB 2XXAB 5KOJB 3C2PA 1G7CB 5M2RA 4DRZA 4M8NE 1DEAA 3LQ4A 2JGDA 4HDOB 4RJ2A 5KSWB 4RORA 2XTJP 2PL9A 3J80U 1LW7A 1OE0A 5G4DA 3RVQA 2NZWA 2O50A 4FEEA 5TDHA 1N54B 4EA7A 5DN9A 5H82A 5HG0A 2NVUB 3V48A 2XHWA 2IYSA 2PEYA 3AEKA 3WG9A 1ZGCA 5L9XA 3F96A 3VHRA 2B6AA 1XLUA 1WF2A 1N1EA 4LZPA 2QIOA 4WKYA 5L1IA 3QE3A 4XAQA 2XDQB 3U62A 2BVZA 3KSRA 1RVDA 2H06A 2GEVA 2P1DA 1RHKA 5CYQA 3C7TA 2QW0X 2N82B 4JI2J 2FK8A 3HK2A 1LV8A 1H2BA 3PA6A 1DMRA 1W4BA 1USIA 2LMIA 5K5MA 3B3GA 2J9DE 1GOTA 2FDXA 4DKXA 4TN2A 5FX2A 2JZCA 1ES9A 1SJ3P 4F9GA 3T7AA 1AT1A 4D57A 2V0GA 2J1LA 2RK3A 3IPLA 1A7AA 4Z8XA 1EG2A 1RT1B 1Z2DA 5I5GA 5DI3A 1AUOA 1WMFA 2WSIA 1NOJA 1FP1D 5AVYA 3GMSA 2NADA 2PFFB 2ZRIA 4ZVOA 3S2GA 1K0UA 4EJSC 1YJ5A 3KBBA 3G9XA 3DOKA 4XWGA 1N57A 1VJRA 4C7KA 3BBPA 4Q8EA 2DT9A 3ORYA 2ONZA 4R1NA 3WLPA 4J29A 1MC5A 2JD1A 3QX8A 2EKQA 3IAS1 2NAPA 4MV4A 2DE0X 2X3DA 2Z6UA 4B83A 2Y1CA 3H5IA 3O2NA 4CLPA 4IH5A 5BYRA 2JK0A 4R9UC 2ATLA 3MSCA 1IBMJ 5IULC 5CYJA 1QE0A 3OEHD 2J0UB 3ZD9A 2HSEB 2DPLA 3AB7A 4P58A 1F2TA 1JI3A 3EMDA 3MS2A 2WV9A 1NKBA 5HNKA 3HMJG 2B69A 3NNAA 4DC1A 2ZWPA 3D2BA 2JC0A 421PA 2P0AA 5J2MB 3KLGA 5LYJA 5JEEA 1FU7A 3AQPA 2X40A 4WLOA 2OORA 2IYTA 3E7XA 1IJEB 5EQJB 1Y1PA 3URKA 2XUKA 4X4RA 4X8MA 3OT4A 4C7QA 4X64J 4U6PA 3DTNA 3OUYA 2G70A 2IPMA 2AZDA 4YR7A 3UWSA 4ISCA 3PYEA 1X7GA 1QS0B 3CMCO 4MVJP 4DL9A 3DHYA 1JU3A 3FW1A 4CQNA 3JQ7A 2FSVA 2HWWA 4FHFA 5CXQA 4W9NC 3KKZA 3KAJA 1VKNA 3IOBA 2R7OA 1AURA 4N40A 4QTUB 2EWHA 1JKIA 1L1EA 3TL2A 2XW6A 4AS2A 4L07A 1PFVA 3HGTA 1E3TA 4J75A 3N8GA 5DRKA 2EQAA 3RUBL 3HEAA 1ESDA 3K0AB 3BM5A 4QQBA 4AECA 3HPRA 1TGYA 4FZ5A 4Z2YA 4DDKA 1FTWA 4MUYA 1EDBA 3DYAB 3EPLA 1UA1A 4MI6A 1JEYA 1TA0A 1H42A 4JB3A 1TL1B 1P1TA 5ICCA 2OEMA 3E8OA 1RRFA 4HNAB 4ID5A 2P2CA 5CFQA 2PX0A 1H8HD 1YZNA 2WD7B 3I5XA 4ZOCA 2LEAA 3A25A 3AUSA 2W8LA 3DE3X 2RHBA 3LGAA 3WKEA 2EGUA 3MCAA 4FF1A 2CQ1A 3PQ4A 3GMTA 4XSVA 5AD1A 2YV5A 3DZDA 4LNHA 2EHDA 3O1HB 2V6JA 2FHMA 1FYVA 2IHZA 2DH9A 3DGFC 4YIKA 4K2HA 4D4GA 2QVYX 4RE5A 5K99A 1DOAA 4FJ1A 5AVXA 3AUTA 3RB0A 2PX6A 3G86A 2JZNA 3DEYX 4GO7X 1QMGA 2KHCA 2AJLI 1U24A 2WSSA 2YHSA 2Q4TA 3DMGA 1UP4A 1OYDA 3PEEA 3A9SA 1ADBA 1NY6A 4J9SA 1G2PA 2CV1A 2WWIA 4ID3A 2Z2LA 2YH0A 2AA3A 4R5HA 2QQEA 2WHEA 3ROMA 3KK2B 1HT3A 4R3UC 4N0QA 4Q34A 4LSLB 1U6BA 4WZAB 3DQQA 4TXJA 5T57A 2VK1A 3SDBA 3ZV5A 3VOAA 4NLRA 5EWFA 1OX4A 2HQCA 2Y2UA 4RGVA 2RJOA 2TMKA 4BMXA 3PO4A 4EG1A 1UMCB 4BIIA 2WZBA 4DCMA 3ZJYA 1NMEB 4WHMA 3UFXA 3HJFA 4M8LA 3W2EA 1ENZA 1WF1A 2IIBA 5BSUA 3UDCA 4JV5J 2ZXEA 1W5BA 4BECA 2PMZD 2QAGC 1PK7A 4OFXA 1FSZA 4ZOAA 1CULC 1GGMA 5FWYA 4JYMA 5AW0A 2GA9A 3WFZA 5IYZF 5T4FA 2XS2A 4OP2A 2NU8A 5M2UA 4GMXA 2XS5A 4A48A 2CHGA 4MQFB 3HH8A 4WTYA 3MUTP 1GVHA 1E4VA 1R4MB 3PGVA 4KHRA 3T7JA 3B9QA 2GDJA 3H42A 1P1KA 1B64A 1NI4B 4OZ1A 1JDUA 1MW9X 4W7IA 2IDEA 1Z4MA 4BO7A 3Q9UA 4J1QA 1NK9A 1AH2A 1KSGA 2BMBA 1MC4A 1BYIA 4X4NA 4TGLA 3Q83A 3E01B 1AROP 4V2UA 5FI5A 5AW5A 2JD0A 4YHBA 1GCUA 1EUYA 1OWPA 2HQBA 2JAQA 2AG0A 4F4FA 4W6QA 5LQRA 1SCJB 2DWQA 4C5BA 3TG8A 3DDSA 4PXBA 3HHDA 5LB4A 4X1YB 1Z73A 1LFPA 2QRVA 1VRUA 2GEKA 2QSFA 1ACLA 5KJFA 9ATCB 2CMGA 4YRNA 3C74A 5EMHA 2A7QA 3P1JA 3FPFA 2ZI5A 3DV0A 4M1SA 3WB9A 5KPDA 1NVGA 2PA8D 4U7DA 4XO0A 2HT6A 1SAYA 1SG9A 3BK1A 3KNZA 4WA7A 4WESA 3KEOA 1I0LA 2HLDD 4LKRA 1N0VC 4G0UA 1JVSA 3GVIA 3CJQA 1Q3TA 4BWGA 3OXFA 4CQLA 1M33A 1OT3A 1YJAA 1L3TA 4D74A 1YT5A 3JWPA 1SJRA 1KHWA 4Y6OA 2ZXUA 2RH3A 4Y9SA 4DE5A 4ABTA 4ZOQI 1JA1A 1FP6A 5C5CA 1GPUA 2PBRA 2OLWA 1X80A 4N82A 1GEGA 2UYCA 1Y63A 2X1MA 3GGJA 1QIFA 1QQ6A 5KFCA 5FORA 2REXB 3HKZD 4CF6A 2O2JA 2OQIA 3D2WA 2MJUA 5IARA 1GSAA 2C3PA 4ZRNA 4A0SA 2BANA 4LVUA 5EKTA 3E3MA 4FBMA 2Q4EA 4IF6A 4BX2A 1JU9A 3MOSA 1GRQA 2O7VA 2EG1A 2E1RA 2NS1B 4TQAA 5BVHB 1ZM4A 3IS3A 5JW6A 1FTQA 5A0VA 1NFFA 4ICLA 2DGVA 5BYAA 2IRUA 4ZKDA 2W2OA 2DHCA 1KMHB 1A88A 1MIOB 3VM6A 4Y8VA 4XYMA 4CEHB 1AMOA 4TV8A 1H1DA 4PICA 2Z8YM 3N2YA 2DTDA 5AM2A 3RVBA 3UKOA 3B52X 4I7EA 2H65B 2ZUUA 5C32A 5DZSA 3O0TA 1NJ8A 4DYDA 2ZIXA 1AKQA 3UIEA 1P2GA 1T2UA 5JVGQ 3LXUX 4YUWA 5JSZA 3TOVA 2HHHJ 4PQUB 4J3NA 3BWBA 5KQRA 2G77B 1LPAB 2ZTVA 1IQZA 3PWTA 3UMGA 2W25A 3IUYA 2BKOA 2QBYB 2RG7A 2X0IA 2A1UA 2CFOA 1PYTA 1KAGA 2DEIA 3GCXP 5BP7A 5LZ5A 1GGNA 3UB3A 3FB1A 5LQKA 2X77A 1Y11A 1N6IA 2R1TB 2QD1A 4PEOA 3OVAA 1A8QA 1JB0C 1P0CA 3RBDA 3T3NA 1YB2A 4I5IA 1F0XA 5IEJA 2OEPA 1NVUQ 2DRAA 1Q12A 3RR2A 4BVFA 2BJ7A 3PXAA 4PWUA 4A8TA 4ND4A 4LAFA 1ZUD1 1CUBA 3R20A 1U2GA 2E87A 4MA0A 1WW3A 3L7LA 1VG9B 4HYKA 1W5FA 3M6LA 3PX0A 1IXRC 4NLSA 3ABIA 3ZQ4A 3HB1A 3NGSA 1QTMA 3KQYA 2C28A 1P4RA 2X1BA 3F56A 4YAIA 1DWOA 2PSHA 4H2DA 1E9RA 4ZVKA 4PZVA 1DB3A 1I7LA 4MWTA 2O0JA 4DLAA 3N4WA 2IGBA 1N7IA 4UATA 4YMIA 4YCLA 3OWHA 1OWOA 4Q9NA 2VL7A 4BCDA 5CA5A 3GVCA 1I3KA 3BS9A 4NHEA 1AN9A 2E44A 1Z5PA 4M9QA 1NOKA 3CCJS 4BGUA 1CG6A 1OGIA 4C0AC 1KRHA 3G2QA 2N1MA 3T5CA 2IKSA 1URRA 1MB9A 4KE8A 2ET6A 1DE0A 3GSIA 3JQJA 4B46A 2GEBA 5FDLB 4ECYA 4LF5F 2C9YA 3OLAA 2QV6A 1YS7A 3HEMA 4OX9B 2I2XB 1YA6A 3VAFA 1TQDA 5ALGA 3EIFA 4ETNA 3HP4A 4LFAF 1BO6A 1VRQC 2R48A 3B9PA 1PK9A 2I78A 1LS6A 2NTJA 4DS5A 1BHNA 4CMHA 3PDCA 2XKAA 4JWKA 4YP1A 4JJZA 2NG1A 4QQRA 4Z0TA 3EPJA 3RRGA 5E3HA 3FF4A 4MH0R 4HRYA 2CJWA 3PRDA 1N1MA 1IQPA 2QM7A 3PE3A 3V4LA 2PNFA 2WWHA 1UFRA 1BHJA 3ONFA 5ALYA 1T1GA 2FOXA 4XRGA 2RIRA 1S9GA 4WBNB 2WMDA 1OLUB 1HE5A 4QPNA 2YYZA 1Y7HA 5FWXA 3D0HE 1FNXH 3OEHA 4IO0A 5FBKA 4RPCA 4YMEA 3KJFB 1E4EA 5LBUA 4C2UA 3OQNA 2XQGA 2QE7A 2DGXA 1FS4A 3BC1A 2Q9BA 5I8WA 3BSFA 2XTMA 4PZUA 1QPGA 1B8PA 3JYLA 3OWXA 2HLHA 1FF2A 1XXLA 2HRYA 1W36C 4A8WA 5JSYA 5DBFA 4QUBA 5REQA 2X1FA 1EJ6A 1WS6A 4B9MA 3HVTA 3FNFA 2JOQA 4REQB 2VFTA 3JQQA 5CW1A 1PBUA 1IN6A 2XXAA 2ZBVA 4MRVA 4MR8B 1G5PA 2CFRA 2F00A 4DR4F 1D9ZA 2Y77A 1ZNXA 2D1FA 2V03A 3UGTA 1GNSA 1CDOA 4AWBA 3I0SB 1UDXA 1JLEB 2E21A 3TW0A 5A9TA 3AVYA 2R3VA 4LGVA 1EHWA 2HM7A 3DFZA 1TQ4A 2V34A 4N3AA 1ELOA 4G4GA 4W1QA 1M6VB 1WTFA 4P7KA 1CZLA 4WWHA 2JGIA 3MB5A 1HY3A 1QR2A 4P81A 4HADA 4U0KA 1XIQA 1UFQA 1X4HA 4YB5A 2P8IA 2HV8A 3HL0A 5IFMA 4HL9A 3FTDA 1H8HA 4C89A 2DBZA 4QA9A 2YHIA 1X4CA 2IX3A 5H3HA 1BE0A 4M0MA 4XIFA 4DPOA 4NWBA 3RYTC 4DL4A 4BRWA 4O4GA 3JYTB 2BEFA 1LXNA 4DCNA 1T0TV 3MINB 2G0IA 3QU2A 3ILXA 4TZ0A 5TR9A 5A9SB 1RT1A 4NP6A 5DASA 3HF5A 4LREA 2J8SA 3VBCA 2X0JA 2JVOA 4WF9Q 4NCJA 4Q7EA 2BJ9A 2ZCJA 3EVBA 4A47A 3OEWA 1KERA 3NW9A 4AKEA 3C41J 4M0DA 1FOEB 4EJMA 2FRDC 3M1AA 1M74A 4KXXA 2NUTA 4LSZB 1T15A 4E03A 1YHNA 1Y82A 1BRMA 4Y2SA 1KI1A 2CVQA 3IIKA 3ZZOA 1RXVA 1XDWA 4G0NA 1MVLA 3BGLA 2LQJA 3A3NA 4R1QA 2BMEA 4UHCA 1RT7A 3ZIUA 2BEVB 3ET4A 2D5IA 3CO0S 4RJVA 2ZI3A 2R44A 4XGIA 3PC6A 3PUYA 3DOMB 5I8PA 3PCRB 5B4VA 4DA4A 1SKBA 4YCCA 3LQFA 3OWOA 5BPFA 1C7EA 1O3YA 3OOWA 1CTQA 1Q84A 1TI7A 5EG5A 2QZ4A 3PDNA 1FJHA 3CLUD 1H38A 1EUDB 3IXMA 1Y3FE 5J58A 3NHZA 4P5EA 5HHTA 2EZ9A 3BFKA 5JS8A 5SZHB 1C9JA 2P30A 1AW0A 5TPZD 4DG8A 2XRFA 2X4DA 3FKBA 4JYBA 2YJGA 2PUHA 2RG1A 3C97A 2GW8A 2XQFA 3VOSA 1T9WA 4HVAA 4UJ5A 3ZEIA 5HA5A 2Y4NA 5ALZA 3MGCA 2XYGB 2PT9A 1VK8A 4CLKA 1I2ZA 2ASVA 4LF8F 2HF9A 3P4XA 3T12A 1U99A 4KXQA 3DDUA 5J2TB 3NU1A 3UVJA 3D7SA 5ULLA 1PVVA 2CEKA 4AT1A 3J81k 5K3AA 3SZ2A 2HRZA 1KONA 5LT5A 4R3WA 1L3BA 4JSYA 4AU1A 2ZM6J 5HCUA 3BJYA 4HH1A 4D9KA 3SSAA 2RU9A 1KP6A 1OCEA 2I80A 4NBUA 4DDMA 4KH1B 5KB3A 4E0BA 2QWXA 1JQLB 1X9WA 1KPHA 4EW2A 3KYCA 3FHJA 4UHKA 3RIEA 4IH7A 1MIHA 1KMCA 3O26A 4LS3A 2OD9A 4O4IF 3ANYB 1PFQA 3HLUA 1VRCA 3VTKA 1ZPWX 5IM4F 1TL1A 5J2UA 3HJHA 1JLLB 2OSRA 3TAUA 1JAXA 3RB4A 3PR4A 3IKTA 3GFXA 1YONA 5KTYA 5DGHA 3KYIB 5KNDH 1L7AA 3A8KA 4HKTA 1SOAA 1XYVA 2HLDA 3UUWA 1EA5A 1VJDA 1XEAA 3QV1A 1V96A 4B3DA 1QX4A 2BAGA 1TMYA 1H73A 1HWJA 5KYNA 4TKMA 3K7RA 3L0BA 1W75A 3KOWA 1Z2NX 3DO8A 1J5OA 1U63A 3CF6R 5FBZA 1T1EA 1LY1A 3EPKA 3RM3A 5LA6A 5C8YB 3OKPA 1VQ4S 5HQLA 3CW2C 5EE9A 4ZVSB 4W8GA 2C4MA 1NC3A 3SCJE 1CHNA 4BTLA 4C3UA 5J5AA 3EXCX 3OAAD 1GSHA 1IUJA 3AX6A 3NMAA 1FDVA 1C3OA 3UPFA 1GG8A 3GP8A 1VQ1A 4IOBA 5CCMA 4J0EA 1M1NB 4DABA 2HZVA 1RT3A 4W1PA 1NQVA 4KI7A 1MAUA 3KIPA 2C0CA 5AXBA 3ZCQA 1BMQA 1Q19A 2X0EA 2FC8A 3GF4A 3GGOA 1FTSA 3F1LA 4XR4A 1XCJA 4REMA 1AGXA 1RYEA 4G4SO 2KXFA 4D8XA 1JVNA 1CR4A 1F9FA 3FM9A 3HJTA 1QK5A 1T10A 4NC9A 3F98A 3C7AA 3O5TB 1SPXA 3G0GA 3L3CA 3AWDA 5JADA 2LV8A 5BR1A 5DGBA 2RIJA 1AZLA 1D2GA 2MSSA 3CEMA 4UW2A 1GGFA 1DUVG 1E77A 4R54A 1DAKA 3JSXA 4QODA 1EEHA 2SECE 4FFBA 1E8DA 2EIHA 3LQYA 2C61A 2QLTA 2I2DA 1YZLA 2VXBA 1GQFA 1V5IA 3E3LA 1R4AA 4O3MA 1YVPA 2F1KA 1WKLA 2FW7A 4KDCA 4O3SA 5AVWA 3M3PA 4C7JA 1I30A 2WRZA 3KZVA 5FHQA 1JHAA 1V1MA 3WJ2A 5LXTA 4WASA 4PYLA 3QLVC 3OLQA 1KQFB 1MEOA 5AJ3F 3RNLA 3PRYA 5LQMA 4L73A 1BFUA 4GOMD 1P1RA 2MT9A 3CO5A 3IP3A 2W2LD 1FRQA 3UBTA 4OXNA 4DSOA 1L7OA 4FYYA 2JFVA 4Z9AA 2W7PA 2YOHA 5GMEA 1RP7A 4HLQB 4R31A 4XWTA 2Q3LA 3CSSA 4DUYJ 4RELA 1M34E 3TI0A 4EMBA 4IG3A 4INPA 1RB0A 3HHLC 1X86B 3SM3A 5IF3A 4P74A 1AZSA 3CR8A 2PLFA 1EVJA 1C0IA 4WYLA 4P2FA 2FCAA 4BO8A 5U47A 1NN3A 4ND7A 2H85A 3QLEA 1B26A 5I4CA 2GETA 1SVNA 3WQQA 4FUTA 4JXJA 3BWMA 4H3HB 4NLUA 1SBHA 1UMJA 3VGPA 3C6TA 3QSYB 3L8GA 1UZLA 1U1NA 5AVTA 2MR6A 1NNUA 4BZWA 1MWQA