4AUKA

Crystal structure of c2498 2'-o-ribose methyltransferase rlmm from escherichia coli
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
357
structure length
355
Chain Sequence
MNKVVLLCRPGFEKECAAEITDKAGQREIFGFARVKENAGYVIYECYQPDDGDKLIRELPFSSLIFARQWFVVGELLQHLPPEDRITPIVGMLQGVVEKGGELRVEVADTNESKELLKFCRKFTVPLRAALRDAGVLANYETPKRPVVHVFFIAPGCYTGYSYSNNNSPFYMGIPRLKFPADAPSRSTLKLEEAFHVFIPADEWDERLANGMWAVDLGAPGGWTYQLVKRNMWVYSVDNGPMAQSLMDTGQVTWLREDGFKFRPTRSNISWMVCDMVEKPAKVAALMAQWLVNGWCRETIFNLKLPMKKRYEEVSHNLAYIQAQLDEHGINAQIQARQLYHDREEVTVHVRRIWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBOSOMAL RNA LARGE SUBUNIT METHYLTRANSFERASE M
publication title Crystal Structure of Rlmm, the 2'O-Ribose Methyltransferase for C2498 of Escherichia Coli 23S Rrna.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 118
structure length 355
sequence length 357
chains with identical sequence B
ec nomenclature ec 2.1.1.186: 23S rRNA (cytidine(2498)-2'-O)-methyltransferase.
pdb deposition date 2012-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01728 FtsJ FtsJ-like methyltransferase
A PF18125 RlmM_FDX RlmM ferredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2810 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4aukA01
3.30.2300.20 Alpha Beta 2-Layer Sandwich THUMP fold THUMP fold 4aukA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4aukA03
2IH2A 3LBYA 1I1NA 2CMGA 3FUXA 2NXEA 2XVAA 2B2CA 3HCFA 1N7JA 3LCCA 2ZZNA 3ERCA 2EG5A 3BT7A 4KDRA 4MHTA 3BUSA 2JHCA 3HVJA 3I5UA 3SSNA 3EMDA 3KPJA 3FYCA 4RV9A 3GDHA 2NP7A 4B17A 2AVDA 2GS9A 2XYVA 3CBGA 3EVFA 1F3LA 5LQUA 3UJBA 1NW7A 4E2XA 5DXAA 3NW9A 2NNWB 3EVZA 1YZHA 3FUTA 5DM0A 4X61A 4PCAA 5K09A 5CCXA 4X41A 3REOA 3T7SA 4E30A 2NXCA 3P2KA 2A14A 4QQNA 3MTEA 3OZSA 4EMSA 2GB4A 2GLUA 2O06A 3GRVA 5K0BA 5H02A 3C0KA 1YZ3A 5FCDA 3BWMA 4V0RA 5DSTA 4YUVA 1BC5A 1R6AA 1WY7A 2PX5A 3K0BA 5LQJA 2AVNA 3FUVA 5FHQA 5LQRA 5CIYA 2PLWA 3G8AA 3EVCA 5T67A 3LDFA 5DX0A 5DRTA 1X1BA 4PYKA 4IWNA 4DF3A 2P40A 3DP7A 5KQRA 4LECA 3ANXA 3RIEA 3HNRA 3PS9A 5G02A 1JSZA 3SGLA 2ZFUA 5KYGA 1BOOA 3R6TA 3PFGA 4KDCA 5E9JA 1JSXA 1MJFA 5EMJA 1G8SA 3TMAA 3VC2A 3T0IA 4OQDA 3BGDA 2I7CA 3MERA 3NWBA 3LPMA 3LBFA 2G72A 4U7PB 5DXJA 3FTDA 2PX4A 3A4TA 2FYTA 3CGGA 4JXJA 3SX0A 4DMGA 1R18A 1R00A 3P2EA 4RTJA 1SUIA 1R8YA 3TM4A 3I58A 3M6WA 4EKGA 2PT6A 1KPGA 3GNLA 4R05A 4DZRA 2HV9A 4QDKA 5EQJB 1YUBA 3EEYA 5CVVA 5E2AA 3CJRA 2YTZA 3SVZA 3M6VA 3DMGA 2GAFA 5K0GA 4OA8A 1JR4A 3AXSA 3Q87B 4KIGA 4PONA 5EKUA 2GA9A 2Q41A 1I4WA 5LQCA 2GPYA 1RI2A 5KQSA 3KR2A 3UFBA 3OZRA 4FT2A 2BM9A 2Y1WA 4AX8A 4PWYA 3UZUA 4RVGA 1NW3A 2HMYB 5K05A 5M5BA 1O9GA 1L3IA 5DWQA 5EIFA 2LD4A 1NBIA 4X63A 5FWDA 2HR1A 2IDKA 1XDUA 1RI4A 2WA1A 5E1BA 4CKBA 1FJXA 3HCDA 1SUSA 3I53A 3FPGA 2JH8A 3BGIA 1RI1A 3OFKA 4MTLA 2IH5A 1M6YA 2P3OA 4XUCA 1U2ZA 2PVCA 3RODA 4EQZA 3M6UA 2AR0A 1KPHA 3EGIA 4PNEA 1HMYA 4FGZA 1VIDA 1Y8CA 3HCAA 1RI5A 1H1DA 3P9NA 3OFJA 5CCBA 1RJGA 4PINA 1Q0SA 2FRXA 1KPIA 4OBXA 2E5WA 4PYOA 5K8VA 3KPWA 1JG4A 2ZCJA 1JQEA 4LG1A 1SG9A 4F85A 2ESRA 4QPNA 2ZULA 2IBSA 1QAOA 2DPMA 2KW5A 2OYRA 4GQBA 3B3GA 5CVEA 3MAGA 3TPZA 4V0QA 3HM2A 5FWAA 2PWYA 2G70A 3DULA 4GOND 3GXOA 2AZTA 2XYRA 5EMMA 2IP2A 5EMKA 5K0JA 4ISCA 2CWWA 1EAMA 2PV0A 10MHA 2ZZKA 4X1OA 3AJDA 2QY6A 4GC9A 3A25A 3HTXA 5JR3A 2UZ4A 2QYOA 5EIWA 2FHPA 3ELDA 3FPJA 3KKZA 1VE3A 4RWZA 3LDUA 1Z3CA 1KYZA 3BWCA 4Y2HA 2IBTA 1RJFA 2AOVA 4O29A 3P71T 5B1SA 3BXOA 5EMLA 1ORHA 2AOWA 3VC1A 4EVIA 2HWKA 4KW7A 3SSOA 4YUYA 2IFTA 4PGGA 5K0LA 2BZGA 3FPFA 1P1CA 3ER9A 3OE4A 8MHTA 4RSRA 2P8JA 3FTCA 1PJZA 3KR0A 5DM4A 1ZQ9A 3KPVA 1QYRA 2PX2A 1WZNA 4RTLA 2AS0A 1AQIA 1P1BA 3DMHA 4YUZA 3OCJA 2C7RA 3DMFA 4YUXA 3JWGA 2VZ9A 3LCVB 5DRYA 1SKMA 5T64A 3QV2A 2O0LA 3SXJA 2DULA 1G6Q1 1NE2A 3BGVA 5K01A 3KQMA 4RYLA 1L3BA 4AZSA 4PYQA 5FHRA 3ME5A 3EVDA 4IV0A 1WS6A 3BKXA 3ELYA 3TQSA 2B3TA 3B7PA 3GWZA 3KQVA 3OZTA 3G89A 4HH4A 4QTUB 1YB2A 5EG5A 1XCJA 5C1IA 2Y1XA 5LQKA 4LWOA 1NT2A 1YFJA 4RVDA 2BR4A 2EJTA 1R8XA 5E1OA 3LSTA 2AOXA 2YXDA 1X1AA 4M38A 2C7QA 1G60A 5EZSA 5IH3A 2C7OA 2OB1A 2BR3A 1VP3A 4ATNA 1JG1A 2JH9A 3M4XA 4HC4A 4R6WA 4BLWA 1QANA 1ORIA 3PT9A 3AXTA 3M6XA 4PYLA 2ZIGA 5EHGA 2G1PA 2VDWA 2P41A 5EHIA 5ICEA 4R8SA 5EZQA 2UYQA 3G5LA 3GU3A 3NWEA 3DLCA 4AZVA 4YMGA 2OO3A 2Z6AA 5D1HA 4M36A 3NDJA 3MCZA 1YFLA 5EC8A 2EJUA 5CM2Z 2AN4A 4FP9A 3CJTA 1EIZA 1VL5A 2QE6A 2YR0A 4MQ4A 2ONZA 4POOA 4Y30A 2I6GA 2AOTB 5HILA 4RTKA 1XDZA 4DCMA 5HEKA 3DOUA 3HVIA 4CTJA 3EEOA 3HA3A 1XTPA 3GO4A 1P39A 3FRHA 2ERCA 3SM3A 2N47A 2H00A 1SQFA 2CL5A 3ELWA 1QAQA 2R6ZA 3R3HA 1JQDA 3I64A 3PX2A 4GF5A 2PT9A 3TM5A 5GWXA 4BLVA 5LR6A 4RTRA 1UIRA 3K6RA 5EGSA 3OU6A 3G2OA 3GCZA 5DX1A 3B89A 2AN5A 2I62A 2Z6UA 3G7UA 3DUWA 4GC5A 4ER5A 5F2OA 1D2CA 3P9KA 3KQPA 5GOZA 3FPHA 5GP1A 3GJYA 4E31A 5DTRA 5K0CA 4WVLA 2UYOA 5U4XA 3UWPA 4CKCA 3CJQA 3KQQA 1SVUA 4CWAA 2ZBQA 4A6DA 4RX1A 2OPBA 2BR5A 5P8WA 3KPUA 3THSA 4F86A 5LQAA 3PTAA 1L3CA 4HSGA 5EVJA 3E8SA 3DH0A 2ZBPA 3GIWA 3KQTA 3UJ9A 4C06A 1Q0TA 1WG8A 2FK8A 3IYLW 3AWIA 3P8ZA 2WK1A 2JHPA 1DCTA 1BHJA 3TKAA 5ERGB 1XVAA 2AOUB 3HCCA 3B3FA 3F4KA 3E7PA 5EPEA 5C0OE 2PWPA 1NBHA 2B25A 2R3SA 3G88A 4EK9A 1AF7A 5KVAA 4DA4A 4YV0A 2AOTA 3A27A 1DL5A 4UOEA 3MHTA 1KR5A 4OX9Y 3KR9A 4E2YA 4LWPA 3PLAE 3BZBA 3Q7EA 5DTMA 3TRKA 1SQGA 2XBMA 2O57A 4YUWA 2ZBRA 1G55A 2ZVJA 5E1DA 3FUWA 5HIMA 3ER8A 3E05A 3GRZA 5EKXA 3KQSA 5E2BA 4C03A 1KIAA 1XXLA 2P7HA 3UJ7A 3IHTA 4R8RA 1NW8A 5T6BA 3C3YA 1D2HA 5FULA 5MHTA 3FPEA 3U81A 2VS1A 2XVMA 9MHTA 2FCAA 3EVBA 3G8BA 5D1NA 3S68A 3C6MA 2H1RA 3R9XB 1O9HA 2PSSA 2HNKA 3MTIA 4IV8A 3MCTA 1FBNA 5CVJA 1X19A 1NV8A 5E9QA 2IIPA 5FA8A 2YQZA 4E2WA 2UYCA 3O31A 1EJ0A 2PBFA 3EVEA 2F8LA 3R0QA 4QVGA 2ZW9A 5K03A 4HTFB 4FS8A 2IH4A 3FRIA 3C6KA 1G8AA 3G2QA 2EX4A 5E9WA 3NMUF 2OBFA 4QDJA 5KS2A 4YV1A 2JHAA 4ER6A 5DTQA 5E8RA 1WXXA 1XDSA 4F84A 2GH1A 3ID6C 1TPYA 2ZLBA 4ER7A 4BLUA 2AOUA 1X1CA 3RW9A 5HIIA 3EPPA 1KHHA 5FTWA 4BP1A 1AQJA 4RTNA 3EGEA 1VP9A 3CVOA 3G2MA 1NKVA 2O07A 5E1MA 2CKDA 3LCUA 2IGTA 2G8NA 2PXCA 2OZVA 3AY0A 4BY9E 2OKCA 3IV6A 5HFJA 1NW5A 3EMBA 7MHTA 3M70A 1G38A 4P58A 2P3QA 4MWZA 4C07A 4DKJA 5CVDA 4RTQA 2PXAA 2VDVE 3NJRA 5DLYA 1V39A 3R24A 2PJDA 5DSXA 3V8VA 3PFHA 4M7RA 2AN3A 2EFJA 2G71A 4E32A 4K6MA 1L1EA 2ZWVA 3LKDA 1HNNA 3MB5A 2PGXA 4AUKA 3LX6A 3GRUA 3V97A 5CUQA 4P7JA 1O54A 2YX1A 2O05A 3DR5A 2NYUA 3DXYA 2YUIA 3EVGA 3KPYA 2QRVB 3LGAA 4HTFA 4XCXA 3LHDA 1JG3A 4XUEA 2OB2A 3KQWA 3GRYA 5HOQA 1BKYA 4M37A 3JWJA 3FZGA 4ER3A 3LDGA 5HIJA 3DTNA 5DM1A 5FQOA 5LQNA 1ZHFA 2YVLA 4PCLA 3TKYA 2Z6QA 5EEHA 3PVCA 2HTEA 4U7TB 1OR8A 4DCGA 1EG2A 1UFKA 2ONYA 3B5IA 4IKPA 4PYMA 4GBED 3T7TA 3M33A 5GM1A 4R6XA 1ZKDA 3QOWA 4DM3A 4RVHA 3X0DA 2UYHA 2WA2A 4OQEA 1KYWA 2ADMA 3MQ2A 5GIPE 2C7PA 3UBTA 4RTPA 1I9GA 4FZVA 2PXXA 3JWHA 4RVFA 4FT4A 3DXXA 1KP9A 2CMHA 1X1DA 3EVAA 1B42A 3NTVA 1VLMA 5K0NA 3SR4A 4E33A 4RTOA 3B3JA 5DT2A 3FYDA 3VSEA 2JG3A 3ORHA 1EQAA 2IDJA 4QPPA 2NXJA 3G5TA 3HCBA 4DQ0A 4E70A 2VP3A 3UA3A 3UJ6A 2QM3A 4KVZA 1FPQA 1JTEA 2B9EA 3GRRA 3HA7A 1RI3A 1VPTA 4KIFA 2NP6A 3JWIA 1TW3A 3P97A 5EEGA 4YV2A 2ZIFA 4L7VA 1NV9A 1JQ3A 4NECA 2K4MA 3BKWA 3C3PA 5FA5A 2B78A 1JG2A 4H0NA 1UWVA 2FPOA 2P35A 2PY6A 3KR1A 1F38A 3WSTA 2QRVA 1DUSA 3QOXA 3DXZA 2V7EA 4CTKA 4C04A 1AV6A 1EJ6A 5GINE 5IKMA 4FSDA 3SMQA 3KHKA 1PRYA 3T7RA 3TOSA 4QTTB 3TR6A 1VBFA 2P3LA 5FADA 2H11A 3CC8A 5ICFA 2YXLA 4GOOD 4HG2A 2BM8A 3O7WA 5F2NA 5GIOE 1VQ1A 2IPXA 3PX3A 4XUDA 4OA5A 2JJQA 5C9ZA 4HGYA 2P1DA 4HRAA 2XYQA 4MIKA 2ZSUA 3DLIA 2ORED 3A26A 3G2PA 3KQOA 3UA4A 4CXMA 1M6EX 4GUAA 2ZTHA 4ER0A 1IY9A 1QZZA 3HVHA 3UJ8A 3GGDA 5BP7A 4PIPA 1KXZA 4RTSA 3UJDA 3OU7A 3PB3A 5GM2A 2ZWAA 5BW4A 3FTEA 4PYNA 4RTMA 2BH2A 4YMHA 1RJEA 4WXHA 4GEKA 1ZGAA 3ELUA 5EOVA 4A6EA 3O4FA 3A7DA 5HZMA 2ZZMA 1N7IA 4GOLD 1ZGJA 3NDIA 3KU1A 1XCLA 5BXYA 3SSMA 3HVKA 1NW6A 3UJCA 1N2XA 1ZG3A 5ICCA 1JTFA 5JUWA 1R74A 5DX8A 4KWCA 3NVKI 3OPNA 2PX8A 1IXKA 1XJ5A 4PIMA 1MHTA 4P7FA 3P2IA 3THRA 4ZTBA 2NXNA 5ICGA 3EGVA 3HA5A 3MGGA 3P9IA 4X60A 4CKEA 2I9KA 3FTFA 4P7GA 3D2LA 5K0FA 3LL7A 1RJDA 5DPMA 4AZWA 3P9CA 5E8JA 5CD1A 2VDUE 5DM2A 3A7EA 1T43A 3HEMA 3OE5A 4KRGA 2YXEA 3TLJA 4QVKA 1FP2A 5K0EA 2ZIEA 5CVUA 1IM8A 3KQYA 1TW2A 3HCEA 4G56A 4QQKA 4BP3A 4C08A 2PKWA 5F2KA 4EKIA 4GOMD 1QAMA 3L8DA 4HGZA 4FSXA 3I9FA 3H2BA 4PGHA 3BWBA 4PYJA 1D2GA 3FUUA 4C05A 5FQNA 3VYWA 1WXWA 1L9KA 4C4AA 4PYIA 5HIKA 3HP7A 5FUBA 2OXTA 3UJAA 2P7IA 5BW5A 3LECA 4OBWA 1FP1D 1P91A 5LSAA 1M0EA 3NVMB 3OU2A 3CKKA 3LKZA 4Z2YA 4AZTA 1YF3A 2FK7A 3CCFA 3TFWA 2OY0A 3BWYA 3E23A 4E2ZA 4FR0A 4P7KA 2V74B 1INLA 3IEIA
chains in the Genus database with same CATH superfamily
2VDRB 2ZQ5A 4LR7A 1RZVA 1UADA 4M9XA 1QLNA 4ESHA 4RPGA 3SN6A 1KY4A 5HAOA 3RS7A 3T3HA 3K5OA 1X2EA 1JZSA 4NU6A 4DLKA 3AB7A 1EP2B 2AZDA 1GZ6A 2JAWA 2VA3A 2AKYA 1H8HD 2BCEA 5C8ZA 3G8AA 3LXXA 1U1IA 1JLHA 1T8TA 4XJXA 1J5OB 3FCEA 4O4IA 4BC1A 5BO5A 1J23A 3IR6B 3GSDA 3BHNA 3PUIA 1A82A 4LAFA 4EKGA 4WWSA 3QXXA 1SZDA 4TY9A 1S96A 1WW8A 4RJTA 2Z98A 3FMVA 5EKUA 1XC7A 3BXXA 4D0NA 5D3MB 3T5MA 4C78A 1UK8A 1N8TA 3LH5A 3DUFA 3V1KA 1L8AA 2X0FA 3MI7X 5H9EJ 5KFPA 2M1ZA 4MYCA 3T5AA 2GHIA 1JJ4A 4PM4A 2FWRA 7ADHA 3OQBA 5ETSA 1RI5A 2XWPA 1VRQC 2AXPA 4Z99A 2HS4A 3IDQA 2MB0B 3NM4A 1HPZA 2KW5A 4Q0BB 2YNFA 3QYPA 3N0XA 3TGWA 4B7CA 4Y2XA 3HVTA 3O6QA 2PZAA 4AN4A 2EATA 1KJIA 1ZM2A 1DI0A 2ZBFA 2IU3A 4MV9A 5IW8A 4UBIA 1XNQF 3CW9A 4DR2J 4PGGA 2HWIA 5DG7A 4XYEA 2W9XA 1RLDA 1BE0A 5KYXA 3UATA 5FR1A 5LJ5Y 1QYRA 3AJ1A 1FW8A 2CVPA 3TAQA 4GXNA 1D5CA 2KVIA 2A5DA 3LKBA 3TQSA 4B3SB 2P2CB 1ZEJA 2PQMA 5C8VA 2ZJQQ 1OC2A 2UUBB 1OLUA 2X0IA 3LSTA 2YXDA 3RHTA 4HT3B 2PS0A 2OB1A 1VP3A 4R2IA 3Q6IA 5F12A 2WB2A 1YBTA 2YFQA 2H5LA 3L3CA 2WIAA 2ZOFA 2DH7A 1VC0A 2NTYC 1U2DC 1AKQA 2QE6A 4ALLA 2CW5A 2AUMA 2PWAA 2Q8PA 3FX2A 2RHWA 2X2OA 2MSCB 4UJ5A 1EUDB 2YRFA 2DFDA 4MVXA 4F12A 2BABA 3G7SA 5E5NA 1Z6TA 5CXXA 3E7WA 2VHXA 1HBOB 4URYR 4HT7A 1W96A 2GHQA 3Q8LA 2XS2A 1E2PA 5B53A 4X8LA 2H2DA 1R64A 4HXEB 3RVSA 3LWLA 8GPBA 2JBHA 3MT8A 4AQYB 4G1CA 1KI9A 1AK2A 4EVRA 2V50A 1G1MA 1T5HX 1RT7B 5E2BA 4M3NA 4WFYA 1RISA 1U7XA 2BWJA 1YBAA 1MMFB 3Q3EA 5DB4A 4EUHA 1V71A 1X19A 5E9QA 3WIDA 2R6GA 1XKTA 2XECA 4RHXA 2ZDQA 4PLZA 4XIIA 4E6PA 3SHVA 4CG3A 1KSGA 1Z7YA 2EDAA 2JGJA 3K72B 2H63A 3IMFA 1SUFA 3O9MA 1A5SB 1RLCL 3BH6B 3QGMA 3LBAA 3VPXA 4CLLA 1PSDA 3Q8WA 2ZJ6A 1U1PA 2ZSBA 3CE9A 4CLOA 1SXJE 2Q9AA 1JEAA 1FMLA 4FFLA 2WVGA 1W44A 4XVHA 1FFWA 1IEQA 3NLLA 4XW2A 2YNMA 3MIZA 3R40A 5IM0A 2HHHB 7FDRA 3CX3A 3B5IA 5I3UA 3M33A 5GM1A 4C0BA 3R5BA 1IKWA 3QK7A 3RGGA 1YJWS 4TVSA 4NZ6A 3SQGB 2W6PA 4RW9A 5A4JA 1RC0A 2VOPA 4IJMA 1SQEA 2BZ0A 4N6OA 3OX4A 4B6PA 5IASA 4AJIA 1F8YA 4UVIA 1QHYA 1LBTA 3HDSA 2R5FA 1N57A 1X7HA 4MW0A 3KHKA 3H65A 2F63A 1T5SA 4DDMA 1MNEA 2JJ1D 5LVAA 3OZVA 4PLYA 7MDHA 3CLSD 2B69A 4ID9A 4IIXA 4DQQA 3OWHA 4L5IA 3TZBA 3ILLA 1A88A 3SYZA 2QQGA 2R86A 1AX9A 1S8AA 1Q1EA 3BSWA 4HPJB 4J9NA 3GP9A 4HEA1 4DL4A 3UXYA 3FBWA 2ZCVA 1G7RA 1Z0UA 3RT9A 2YINC 3F7MA 4ENVA 4OQXA 1NURA 4USVA 2HNAA 2HVHA 3M9LA 4QYZJ 4GMHA 4CKEA 3OM1A 4RFVA 3NFYA 2XZOA 4KRGA 2NU7B 3E4DA 3M5WA 2HOQA 4X4RA 2AF6A 4R1QA 4I3HA 3ICQB 4C4OA 1HI9A 2XY6A 2YHIA 1WABA 1T2VA 1LS6A 4NYZA 3QEKA 3VAAA 3HV0A 4YIHA 3CSDA 4HY3A 4UPEA 3BQ0A 4I64A 3E9QA 3VKWA 3BORA 5I8ZA 2A92A 3BCSA 1YOBA 4PPFA 2BIFA 1Q3HA 5RUBA 5L7TA 3VKGA 2HLUA 1QK3A 2G4LA 4MQ6A 2XVZA 4JX9A 3VAHA 5DXJA 1CUIA 3TPFA 4DMGA 1ZCAA 1PT8A 2LEAA 2W43A 3ZNNA 1EGHA 1XLVA 4M88A 2G9VA 2ZBEA 3DOCA 5I4IA 5B6JA 2MEWA 2X1BA 4AJPA 2FVRA 4J1NA 5D0EA 2OXIA 5J4YA 1K5PA 4BQPA 4GH5A 4ZOBA 3BSYA 3FPGA 2EKQA 1XK8A 4R2HA 1QRAA 3CEPB 3TWOA 4PYOA 2QAGB 5FTJA 4YA6A 3SZLA 3GBPA 4BLOA 2ZPAA 4FMDF 4KGXB 2Y27A 5K8IA 5BJRA 2LE0A 2OUKA 5C5CA 2WFLA 2PM8A 3L7OA 1M1HA 1IOWA 3I0RA 4WP9A 4BAZA 3HHLC 4JU9A 1ZM9A 1ORHA 1QBGA 1OT5A 5HBGA 3PQEA 4RGVA 1CY6A 3R5CA 1Z8NA 1VHFA 4OYBA 4YT4A 3DWIA 3UMCA 4OYLA 2QRHA 3AF5A 2XZDB 2XPCA 4P10A 1OLSA 4PGFA 2RGYA 4JQCA 2ODWA 2Q3EA 4KH1A 3CUWA 3HHKA 4LRXA 2WW4A 3THWA 3CO9A 1S9GA 2VT3A 4JVSB 3LUGA 4QPCA 4Y2QA 2XC9A 1T9UA 4XR4A 1U1NA 4WHMA 1BDHA 2QR5A 4CLWA 1YE5A 3DWEX 3ILVA 4EEKA 3EGXA 3INYA 1NBOA 3O5TB 3RNOA 2D2FA 4Q4AB 1OBOA 5EN1A 1A97A 4RUCA 3LCRA 4HDKB 3IOBA 2V7GA 1KQKA 3LP6A 1UVIA 2B7BA 4DTCA 4CT0A 2OK7A 3ESDA 4UTNA 3ZZYA 2FQQA 3LANA 4K3UA 3NNCA 4DCUA 5DTRA 3DYIA 5U4XA 1JFTA 2PCLA 1SHZA 2Z2KA 4I2QB 2MINA 3E82A 2JKVA 2W2MP 3CZAA 1RYNA 5E33A 4W1SA 1R0WA 2PIDA 3AB4B 1TVKA 2XIJA 1OILA 3EFHA 3DXSX 3OTEA 1XXLA 2MOKA 1Y5NA 4ZVPA 4WNAA 2HXYA 3PPYA 2GXSA 3EH1A 3NIFB 1NYTA 5K4HA 3GA0A 2Z1NA 1QO9A 4BWFB 3CUSA 2NVUB 4QJVA 3MEGA 5TQ0B 2KMLA 1NXQA 3PZRA 1UIMA 4DR6J 2V9WA 4YV1A 1GZVA 3ACDA 3OQVA 5E8RA 4F84A 4ZVQA 4ER7A 4CEIB 3MEQA 1O6GA 4FGUA 2VNSA 5CPFA 2G04A 1ZP6A 4KBYA 1IKXB 4DR4J 3FZEA 2NSHA 5DZ6A 5DLDA 2ZH8A 3GEHA 3NJRA 4JB3A 4NNPA 4RD1A 4CUKA 1JXVA 4BATA 4PVDA 3LX6A 1ZFNA 1RKVA 4EEZA 2OO4A 1HNZB 1CPZA 3U61B 4P73A 1Z4OA 4LJ7A 3ZHUA 2VCYA 5FOQA 4CO3A 1ZN2A 3THVA 2QTWB 1H9AA 2GBPA 2AYEA 1S2IA 3NXKA 3T3EA 1XP8A 1R89A 5JCJD 2IVFB 2B21A 3FZQA 5TEWA 4EFMA 3KLBA 1X7XA 2PZBA 4K1LA 1X7ZB 1WF1A 2QF7A 5AW0A 3A4YA 2VP3A 3IBCB 1P2VA 3PZBA 3JWIA 4AJ2A 1X77A 1HC7A 4OFBA 3H6GA 1YMQA 2A33A 2ZRHA 4BNXA 3FCVA 3X44A 4WU3A 3RSSA 4FUQA 4JLKA 4OA5A 2LTAA 4M8SA 4LRYA 4EZEA 3MGCA 4LF6F 4BS2A 2CJPA 2ORED 1YB5A 2HQGA 1G3UA 5F73A 2OCXA 3HU5A 1CIJA 3R0JA 5AJXA 5GMOA 3A7DA 2ZKLA 1RC8A 4LRAA 5HQJA 5AW4A 1EDOA 4HMPA 4WBNB 1R74A 1AUSL 4LHXA 4CM4B 1IK6A 4DMUB 3ZKAA 4ID8A 1V9OA 3M2RA 2GZSA 4G0PA 5M2RA 5A9TA 1PUJA 4AKSA 1WVMA 1JPUA 4ZZ1A 4GSYA 2ZH3A 1SURA 4IDCA 1HDOA 4RW6B 1S1UB 2FC9A 4DLAA 4N7JA 4Q44A 1L5QA 4KV7A 3OETA 4C7XA 3R76A 1E6EA 2Q0SA 3K31A 4G4IA 3CD7A 1N7JA 5K3SA 4GO7X 1Y8ZA 5F1KA 3I4CA 3MEDA 1REVA 4WXPA 2YMQA 4G8JA 4J6FA 4EMSA 2GB4A 5AKEA 5FCDA 1PS9A 3AI7A 5CFOA 2CYBA 1N2GA 1E3SA 2VFRA 3KJVB 1NW9B 4RW7A 1CSJA 4M76B 4F4WA 3SXUA 3KKPA 1A3CA 1FS4A 2W4PA 3EFBA 3V42A 4RTJA 4H54A 1X9WA 4CUJA 4JOCA 3TM4A 1KPGA 4EJSB 4WWHA 4EATA 4DCPB 3SEFA 3UKOA 1NBEB 1HURA 5AVVA 5KFHA 2EJCA 3IQIX 1RXOB 2HQ3A 4QAJA 4YB8A 1O87A 3I53A 5J4LA 1CUXA 1FRVA 1OROA 1QTIA 2D9OA 2HBZA 4L27A 4Y18A 1S97A 1PK9A 3D31A 4RADA 2FW0A 4M6WA 3G23A 1VSBA 4MQFB 3Q10A 5EFZA 2L41A 2EJWA 3KKEA 3VI3B 1GRNA 1DY3A 3ZV3A 2R2TA 1VQSA 1RT2B 4Q9AA 4L4YA 3IM8A 1KYZA 2GNKA 2ZZTA 1BMFD 2FN9A 1TYZA 1PDVA 3QF4A 2IX3A 1P1CA 4B4KA 1QF7A 1WDKA 4B73A 1XMOB 4FW8A 1KI1A 2OXCA 3IQZA 2F7SA 3EJ6A 3B8EA 2NWQA 5JG7A 3OTGA 3IOYA 1V9CA 3CJ8A 3QJPA 1CV2A 3OC0A 1XCJA 2FMUA 2VNHA 3CG0A 1E62A 3GY0A 3H8YA 5BT8A 1G98A 3PYMA 2FRDC 2OV3A 2X0KA 3PO4A 1RABB 2C9YA 4KIAA 4EYSA 3TI7A 3PK0A 5LKAA 4NLPA 1GGVA 3H8JA 4JV5F 4ANFA 4CCHA 3UPUA 1M5RA 4DR5B 4C0KA 1GG2A 2I6GA 3Q3VA 4D6XA 2UV8A 3SS9X 3IA2A 2I3BA 3S6JA 1A0OB 1SXJB 4TMZA 2XDAA 1F0XA 3FUYA 3PXXA 3ACBA 4HNHA 5FEMA 2C5SA 1T0PA 1E1MA 3HX9A 3OEED 3QHQA 4EYQA 4CYMA 1J2TA 2CZCA 3WLOA 5DW0A 2FTKE 2HTFA 2QOEA 4NONA 4UASA 3NYWA 2K1RA 3PHJA 3OQ6A 4BB9A 3G5AA 3RR8A 4PSUA 1A9XB 3EJMA 3OL7A 1CS4A 4C7JA 2PBLA 4JBXA 1E1DA 3ONFA 3H8VA 4BLSA 4ZHRB 3W7BA 1KQOA 3ZZZA 2DEIA 5TQ2A 5BN5B 2WTMA 1L5LA 3FBFA 1OREA 3WX0A 4DJEC 3GL9A 1GKYA 4CT4B 3MJ4A 4RIGA 2HF9A 5C1BA 5LJLA 2R85A 2ST1A 1ESCA 2OKCA 2XMVA 2BXJA 1WW3A 2QA5A 1UZNA 5KJ1A 5KYUA 1Z5NA 5BWCA 3MB5A 1WP4A 3SP1A 3BDVA 1CJVC 4G4SP 1TI7A 3B1FA 5JCPA 2HZVA 1W4LA 2D9PA 2BMVA 4C4RA 3I1IA 2A59A 1VECA 3AA8A 3HKBA 2B4TO 4FMCB 2NU9B 5G2OA 3I3OA 1LPAB 3ICVA 2A2CA 3SMVA 5E4TA 1ZETA 1RP5A 3DW3X 2LKCA 4HKQA 3KOUA 3D1JA 2ZIFA 5DJ5A 5EYPB 3DV2A 4GEGA 4PN7A 4D9IA 4CLRA 4BKQA 2E55A 4WCFB 3NGMA 5FBKA 1O97D 1JKHA 4IEEA 3FE2A 4LF6B 2FHMA 2HREA 3LX4A 2C8KA 3VUEA 2E4XA 4PLFA 3VR3D 1NX9A 2Q79A 3W5XA 3R3XA 3BEGB 1ICEB 3AMVA 4UDXX 4G6ZA 3ELBA 3GQVA 1KU0A 1HXHA 4DQRA 4G0ZA 4WPAA 2X41A 1J9EA 3DOHA 2BJ7A 3BB5A 1GKLA 3NBZC 4I1RA 3KKFA 3NHPA 1JXLA 4U3JA 1FEHA 4L08A 3K16A 3A3OB 1QSGA 5TSDA 3FNFA 3PQ6A 1NXOA 1TO6A 1KYVA 2J9ZB 2R84A 4KZKA 1LV7A 3C2PA 2HZBA 2DRIA 1W5SA 1W0CA 3OJ0A 2G08A 5JVGQ 4X1KA 2WMDA 1MJNA 5J2UA 2CVHA 4ZVUB 4HFNA 4AG6A 2JBAB 4OB6A 3WYFA 2I9SA 4C7BA 4D3HA 2XSJB 5A02A 1ARZA 4DMRA 2NPIA 3P0IA 3KZCA 3SPXA 2H1LA 2R9VA 4WZBA 1HKUA 3BMQA 5BN3A 4QELA 3CIZA 1CUUA 4GS5A 1JLMA 1KK2A 5ITVA 1ZR2A 3UK6A 3SCKE 1XD2A 3Q2IA 1QOZA 1L9XA 1NRJB 4PWYA 3QT7A 4S1TA 3C19A 5FWDA 4Y98A 5A5FA 1DAKA 5IBRA 1XT6A 4EHKA 3FMOB 2Y1FA 4CO4A 3A4VA 5K3FB 3PI7A 1DBVO 4R1NA 5TR9A 4EPRA 3PVZA 4D9MA 1SCJA 2VBXA 4F0MA 4LG1A 2PH7A 4ZWNA 1DIGA 4Z49A 2XYRA 4MT1A 3W66A 2AX1A 3BHJA 3NIGB 5KAKA 1E3IA 4JNCA 3OKFA 4EBFA 3RC9A 1RBMA 2ZB2A 2GHVC 2QD4A 2I29A 2HYIC 3DFZA 1T9KA 2X3FA 2UUAJ 3HDQA 4IH7A 3ESRA 1J0DA 3IESA 2AWOA 3FWYA 4F3OA 3TUPA 2AMJA 4OH1A 1N25A 4M7WA 4PYQA 4EFKA 1OH5A 2OD4A 5FHRA 3EXEB 2G8LA 2PZ8A 1U90A 4G8BA 4D9FA 4DE5A 4KO3S 4BP8A 5HVFA 2VDLB 1EKRA 1SC3B 3D7RA 4FJ0A 2VQFB 4UM9B 2BFWA 2G1PA 5FAKA 4E14A 4URUR 4N7MA 1V1MB 1R6DA 1BQ4A 1B7YB 1H8EA 4CW7A 4IG4A 2N42A 3ZK7A 1U9ZA 5I5EA 4RX6A 2FPKA 1IWAA 1L4EA 4MW2A 3E3OA 2COEA 5BR4A 2F48A 2AGOA 3KQNA 3SF8B 2RCNA 5CW2A 2QX8A 2WM3A 5T7LB 3K0AA 1NBMD 3N6RA 4JDPA 3KAQA 1BD4A 1R9JA 2I5JA 2VDQB 4DL7A 3Q89A 3PUJA 2BN4A 1GQFA 3UHPA 1T9GS 3EF1A 4EY4A 1N36J 2F43B 3JD4A 2M6LA 3E18A 1UTAA 1X2BA 1DKRA 2RU3A 3WWOA 2HU5A 3MUNA 1LBEA 3DVLA 4XI9A 3CE6A 3IAXA 2ZJ3A 4IX9A 2KG0A 5F51A 4D26A 2IDMA 1E9CA 3QVSA 5HIIA 5TEVA 4JUFA 4FXWA 3AIOA 1IQTA 5DNDA 4CTAB 2E7XA 3PDHA 1FU4A 5T5QA 1BCSB 1IMOA 3IAM6 4Q8EA 1PLKA 1K8AT 4BL5A 2LGJA 1Y6JA 1TKDA 4DZTA 4WD3A 4IRKA 3IR7A 3LP0B 2HMAA 1T8YA 2CPYA 4H7JA 3IEKA 5EJ8A 4ENSA 4R3WA 4ALNA 4EFDA 1OX4B 1Y9OA 3B60A 4ELVA 1EWTA 1T5OA 2VT2A 1B3BA 3EVAA 5U47A 2X9NA 3PY8A 3BZUA 4MR8B 3Q2KA 1O0SA 2OCAA 3K09C 1VCTA 4J29A 1NMEB 1NU8A 1HEYA 2J7WA 3OTOF 2M52A 3S55A 1SEVA 4CL3A 1TMYA 1RTDA 3KC2A 2NYHA 1AD2A 1WJGA 1K97A 3VVTA 5CYQB 4B9UA 2O2ZA 1YZVA 4XOIA 4P81A 1VSTA 1FFYA 1UF9A 1M6NA 2YJ5A 3JVIA 5B2FA 4I7FA 4IGAA 2QZ4A 2ZZMA 4L50A 2Z5GA 3PYGA 4CMEA 1EQ2A 1AZLA 3TR5A 3NS6A 4HWSA 2FWIA 2PVSA 2BRUC 1JR3E 2M2BA 1EX1A 621PA 1JHQA 3W5AA 4FQ8A 3L8DA 1C7ZA 4K6KA 3D3EA 1KHWA 4UW2A 2QGNA 4N5LA 1T95A 3ANNA 2OZLA 1EZ1A 2MMGA 2PE8A 3UMVA 2JI8A 2WJIA 3CLTC 4GC7A 2DQKA 2Y9MB 1Q3TA 4HOYA 2B5OA 3EXG2 4J0HA 4NOKA 4CTMA 2WWXA 2G67A 5LD2C 1UJ5A 4QLAA 4IVQA 5EESA 3SSNA 4DZZA 2GNOA 2MY8A 4JI7B 4M0MA 5T3YA 3DRYA 4X61A 2PMHA 2R8BA 4YMUA 4RCVA 3CQ9A 1SJ4P 1YI1A 2IJNA 2ZETA 4LQ4A 2ZBDA 5F9HA 3BILA 2FPGB 1LLFA 1DJNA 5E9JA 4OHBA 3L4KA 3L18A 4QWBA 2VLIA 1XCBA 3OX3A 3UANA 3ZWBA 1OH8A 1SJRA 5LQCA 3PC3A 1JKXA 3PLRA 1GEHA 4ZT2A 1ACMB 2YV5A 3SHWA 1MX3A 2BKEA 2OFOA 2BACA 2ADOA 4LNUA 5LMNJ 5LSRA 4BGEA 1IQ0A 4Q7JB 2H1IA 3Q8KA 4EMDA 2QTGA 3LX5A 2E5WA 3HB5X 1S0MA 3QW4B 3T19A 2YQ1A 1MV8A 2XO7A 3GP5A 1YK0A 1VG9B 4ZICA 4B4UA 3AVPA 3K9LA 2QVBA 3BSFA 1XELA 4BFLA 5HLFA 2VNJA 4YAWA 3M7IA 3HTXA 1CJKA 2VXOA 4XOUA 2FHPA 4CV3A 1H05A 4UM5A 1KD1T 3CGIA 3FWKA 3W2WA 2E6KA 5C53B 4JC8A 5IF9A 3EAQA 1EB8A 1RI7A 1C50A 4DLSA 4A47A 3NUQA 5JW6A 1ZNQO 3EDCA 4F6CA 1GQYA 4ZQHA 3WBZA 1HQUA 4RK0A 5J9FA 3N4WA 2GZOA 1ZA1A 2RHJA 1R12A 3QIPB 2Z1DA 1F2UA 5KX5A 4XIUA 5EHIA 1ZXXA 4FDAA 1RRGA 3C16B 4USWA 2EJUA 3HU1A 1N34J 2BKNA 5ITSA 4UUQA 3NCRA 4KI7A 4F5EA 1O6FA 3U4DA 4IO0A 4MP6A 3KX2A 5DX1A 3P0EA 2P9BA 2ZBIA 3EZXA 4Q34A 3FB1A 4LNHA 2BMBA 3KVRA 2DMRA 3KQQA 1NJZA 1VDMA 2R8ZA 3GILA 4LMZA 1NF3A 3HY4A 1TRHA 5FWNA 4IUBS 1UW9A 1S77D 4O63O 1PR9A 4Q7MB 2A0UA 4PZPA 3TRKA 4LNAA 3QYFA 2ZVJA 3SMZA 4M60A 4RHYA 1KDTA 2ZYAA 2KL8A 4WLFA 1G21E 2PV7A 3SE0A 1I7QB 3DCJA 1V47A 2GOYA 1EINA 3TX2A 3CF4A 3VTAA 3OVMA 4OX9F 3DKKA 4B45A 1M72A 2J67A 3C3AA 1CEQA 5LP6A 1KDOA 3LCUA 1JEEA 1CBKA 2FR8A 2C2OA 3FKSD 1OJLA 3WGHA 3L7NA 3HFKA 1KQNA 2ZGVA 3G13A 1B6TA 4D3FA 4QPTA 1DAFA 3KG4A 3C3JA 4BKUA 3Q72A 4A9AA 3FFIA 2H48A 4KL8S 1H6BA 1Y7PA 1WCXA 4TKUA 2GWRA 3FOCA 4RETA 3TKYA 4LZOA 4HEHA 1S0OA 2FMHA 1KFKB 4WJLA 3OQPA 2VPYB 2HHTA 1YJ5A 4GQIA 4GP6A 4ICLA 1N9ZA 4QEKA 3WGYA 1SH2A 1XVLA 3K0EA 3WRXC 3AUAA 1FE0A 5HBRA 1X1DA 5J2QA 5BWNA 5C7OO 4YGYA 4BNNA 3V6JA 3UPFA 4MO2A 3BMOA 3KE8A 4IH9A 4DGSA 2VIHA 2ZCUA 3DYAA 5F8HA 4RGYA 3OTOB 5L3RA 3WGKA 3H2YA 1RAEA 3JW8A 4U63A 4K03A 4QIWD 2OAUA 4QTTB 4AM8A 2VAPA 2BM8A 5JH7A 1U24A 5A03A 4FNAA 4N39A 3RB6A 5DM60 1CQJB 4QT4A 1IY9A 1ODLA 1JFLA 1W5TA 3HVAA 2D4AA 1PCXA 2QN6A 2O8EB 1LWEA 3MB8A 3MR7A 3GEDA 2ZI5A 4YT5A 4WY8A 4JJIA 5KFUA 3UJCA 1B6SA 1RIFA 2DH8A 1WBJB 4LUCA 4NXMF 1NPRA 1DV1A 4EGJA 1RJDA 2EW8A 4LHEA 2Q3HA 4RK6A 1VA4A 4BO5A 5LBTA 3ZG6A 3H2ZA 4B9TA 3H83A 2NVBA 1ZKMA 3OJEA 4NMHA 3IALA 3II6X 4O3MA 4P7KA 4OL0A 3N2GA 2I4TA 4WN3A 3LCCA 1OXTA 5J58A 3I6YA 2CSXA 3TB6A 1F9EB 3T9DA 2I54A 2JGMA 1S10A 5CCXA 4I6YA 4PQEA 4ZVFA 2FJXA 4RVUA 2R3VA 1JL3A 1LTKA 1CR6A 5G3YA 2AVNA 3FGPA 1YWGO 1L4NA 4Z37A 5DRTA 3SV3A 3VR5D 3PG5A 2R60A 5AI8A 1E2FA 1YI8A 4C07A 1LFAA 2GQ0A 2HRCA 4ZDKA 2QMZA 4N49A 4KQGA 1NDKA 3I58A 2PT6A 2ZM5A 2LQ5A 3HSKA 3D67A 5HL7Q 1IAQA 4XGQA 4IUFA 2R62A 2JEYA 4H4KA 2BQ3A 3CZCA 1KYIA 4ZPTR 1V45E 4PQYA 3QLEA 4YR7A 1I14A 2J9EA 3KALA 1QUFA 3LWNA 1NDUA 4FT2A 2FZ4A 2HMYB 3EEQA 1GUBA 2X2EA 4QZVB 3W5ZA 4Y6QA 1QLJA 1YXMA 2ENWA 1QZ3A 5IF3A 4XXHA 3Q7SA 2DD8S 1I7LA 1RRKA 1T9GR 1SC6A 4QUJA 2D1SA 5IAEA 1KXJA 2GBFA 3ESXA 4DLXA 4YROA 5KT7A 3NGDA 1SBRA 5HKKD 4UOFA 3DZIA 5EMKA 4W98A 2GI4A 2E4AA 2AK2A 1T7PA 2XNDA 5MGNA 3LBHA 3T7EA 4MLPA 3HNPA 4DS4A 2NUPB 3H2SA 5LCXA 1TAHA 3KZMA 2Z58A 4U8GA 5JANA 4KJXA 2JLGA 2WM8A 1RT6A 3N8HA 4RF5A 4XR9A 4S2UA 3KQLA 3JQ7B 3PD0A 5D77A 2MKKA 2AQ8A 7AT1B 2PBRA 4EY5A 4K6CA 1WZEA 2IRXA 2GZ1A 5AHOA 5CQGA 1T9AA 1T2UA 3GQBB 1OBHA 3GJTB 1JG1A 1LZLA 6LDHA 4OV1A 2C20A 1H73A 2J0UA 4V19J 4C11A 3GU3A 4QNRA 1S4MA 2OO3A 2PS1A 4IXNA 2Q6KA 3W9SA 3P1JA 4ITSA 1U2CA 1QB8A 4OV6A 2B8PA 2C2GA 3TF5A 5HEKA 3EEOA 3MT0A 4Z9FA 4X66J 2CG4A 1NAIA 3ELWA 3NC1C 3QSYB 3FVVA 5KFKA 1H2UX 1A96A 1W87A 2B4OA 2O8FB 1J0AA 3N2NA 1OH6A 3KPUA 5BR8F 3TQIA 4Y3CA 2IOFK 2DWOA 3A8JA 1RM3A 1V5IA 2R2AA 2XE6A 2XI2A 4P6VF 3OZXA 3UC5A 4LYHA 2WSIA 3AERA 4G0NA 2XZTA 3IHTA 4QYRA 3TZCA 4CG2A 2W22A 4KU4A 2R2SA 3H1EA 1W2WB 1Z4KA 4ZCSA 2X1AA 3POTA 1XP5A 3G6YA 1YZTA 1NMXA 3L8FA 4YC7A 3ISZA 1TD1A 4OX9B 5G4KA 5KHLB 3UR0A 1QD1A 1BE1A 2ZS7A 5CFNA 2VJAA 5KTTA 4ELTA 4JI2J 3O3LA 4F3RA 4ZP9A 3IDSA 1EK5A 3TD6A 2YWWA 4I3GA 3WBKA 2OZVA 2WTBA 4AP6A 1COZA 5FTLA 3E51A 4Y1GA 4U6NA 3M3PA 3PFFA 1T1GA 4C4YA 4F6RA 2YWDA 4KE7A 3EMVA 2IUYA 1EETB 3OLXA 2XDQA 4NG5A 3OXLA 3GV0A 3RFXA 3L02A 3GX1A 1M8GA 3JWJA 5IEBA 3B5EA 4DPMA 4ZCRA 1HDZA 4OL9A 2WBMA 2XLJA 2ZRNA 2VC0A 2FDRA 1XZHA 1W75A 1ZCJA 2GTIA 3GUYA 1QRRA 2J0SD 5ALYA 4D98A 3KLNA 5K51A 1R43A 2PRJA 2GZDA 4NDAA 5AM2A 4MKRA 4HZIA 2Z5FA 1RWOA 1F0PA 1POWA 2WLSA 2OXRA 1SH7A 2A2DA 1S9DA 3BWDD 2Q3JA 4GBMA 1RAIA 3HFZB 3KDNA 4ON9A 3ZI0A 3K1ZA 5HJ7A 1DTQA 2VJMA 3T3GA 4CVNA 2P75A 4USMA 4DDWA 2XEXA 1J8VA 4QPZA 1NVDA 1XMPA 1S5PA 1YB1A 1TMOA 4BZZA 3UC9A 1JLBB 1U9JA 1D09A 5COAA 2P4HX 3MW8A 4LWQA 4JQOA 5CURA 1IBLB 1RHMA 1WSAA 4X1YA 2A3RA 4NYPA 2AH5A 4GKKF 3KYIB 3FBTA 2KYXA 5D8DA 2I9KA 4BJ5A 4EA9A 4K9NA 4UTGA 3NXSA 1WKVA 3KHLA 5CVUA 1M6HA 1D0EA 1QAMA 5BR7A 3I9FA 3BWBA 4GLFA 5BSWA 1VPDA 3ASVA 5LLTA 2QYTA 4NR0A 1KAOA 2Y0PA 3LA0A 2X1MA 2VR1A 2X23A 2OMLA 3GDFA 2DGOA 4LI3X 2CE2X 3OO0A 3SCJE 2A10A 2H85A 2LIVA 3DM2A 3KLMX 2D1QA 2D7JA 3N3AC 1EP4A 1UETA 4E30A 3HN7A 5DTJA 1HE3A 3G1TA 1DLIA 1E4EA 2QUAA 4F9EA 4OLOA 2QR3A 2HSGA 3H4VA 3TUIC 1AK1A 3RRHA 4C6TB 4R31A 3I83A 2CWDA 3QLJA 2XCQA 3T5BA 4TZTA 1Y8AA 1PJ7A 4D8YA 2A58A 4K5SA 3EZ9A 4CV0A 3GZTB 1C2PA 1U0BB 4J07A 1X13A 4HMQA 2OJ3A 4BNGA 3M6VA 1K5GA 3Q98A 1NY5A 2R6CA 1NSFA 3VR4A 3CX7A 1X31C 2VTBA 1HI1A 3ZLTA 3RTGA 1TKTA 4I1PA 5KYVA 3AF2A 3UQSA 1ZZNA 4NVRA 3L6UA 4YUDA 3TL3A 1X0FA 5LQSA 2XMSA 3LP1B 2QRPA 4X6UA 3NHKA 4C0XA 4PF1A 1JJBA 2A78A 1XNRF 1FY2A 5K8JB 3H5OA 1S12A 1F7VA 1ADGA 1P1RA 1F1BB 4TS9A 4FYYB 3JWEA 4KP7A 4RVNA 5I4KA 2VPXA 4JEMA 3KEOA 1T6YA 3RBAA 1GKIA 2UV8G 2X2PA 4FNIA 1HNXJ 4G97A 2FQ1A 2VP5A 3EE3A 2FN7A 5JSQA 4CLFA 2E82A 1QG0A 3C1TA 2JLQA 4RJIA 1J7JA 1OX6A 5E3CA 3GBVA 4OK6A 2KM8B 1VKNA 4ZVNA 3OQIB 5CMLA 1WXQA 4OUDA 3TIGA 4KHPB 3RKUA 1G21B 1D3AA 2NAPA 3EVDA 1ZVKA 4CI9A 1W7AA 1WHYA 1T8PA 4M0CA 3ED1A 4EJ6A 3F3SA 4DQKA 1P1KA 3G5LA 1NF2A 2NUAB 1RCFA 2QFJA 1X9GA 4M4SA 2C4TA 3TA0A 4Q7KA 4DUZB 3BM7A 4EEXA 2HEKA 4WOPA 1TV6A 1LVUA 1R50A 5E6SB 2BKPA 5DOVA 3AY3A 4OI2A 1HGXA 3HACA 2V59A 4IJUA 2FPXA 2VPIA 4TYAA 1YR6A 4DN0A 1II0A 5BR8B 1ZN8A 3CKMA 3DEFA 3UK0A 1QSYA 4CIVA 2CYYA 3CURA 3KKMA 4YY3B 3W79A 4DX6A 4Q82A 4RE5A 3VPAA 3R23A 4KQCA 1G6BA 3K9GA 1TU3A 1UANA 3SFGA 4QARA 2XSZA 1SQSA 5DNYB 3LT4A 2QENA 4ARAA 3IT0A 1K7XB 3OOSA 5BVHB 2B43A 2XB2D 1Q21A 2VUIB 2Q2NA 3IP6A 3KK1A 3R3SA 5AUQA 1IJBA 2MSLA 1HDCA 3IQHX 2A9PA 2VDHA 4HTFB 2J3IA 4CMIB 1NUEA 2WHOA 2IPOA 3WKEA 2DBQA 1YA6A 5FWYB 3S2IA 4KIJA 4OGGA 3T9CA 3QYYA 1AGXA 4XAQA 1SFRA 2IVYA 5CVDA 3KYCB 2GVDC 4R1PA 4V1CA 2Q3DA 2VUHB 1DBIA 1SVDA 3RVOA 2EU8A 3GONA 4UCWA 3DXYA 2FKAA 5EWMB 3PE4A 2J0QD 2FZVA 4WYWA 5HA5A 3ZDAA 3IVMA 4RNHA 1JT9A 2WUFA 2KBEA 4WRRA 4MW7A 3JSRA 2CB0A 3LI2A 3JYPA 1XE3A 3RGWS 2RMLA 1KEKA 2AQHA 2H4YB 3AR6A 3RCBA 4ZQIA 4B3CA 1FDBA 1GX5A 1A5ZA 3GCGA 5KVQA 1X4FA 2FLWA 2ZRKA 1KVQA 1FJGB 5SZKB 3HBFA 1T6NA 2JL9A 2UXDJ 4NRDA 4RZXA 1CQPA 4HZUB 3C46A 2ORYA 4DLBA 3DOJA 4ER0A 1S0UA 3PUVA 5DSZA 1TL1A 3OD2A 3QO9B 2WG1A 4DV1J 1ZM7A 3R5JB 1QU2A 3RW6A 3O4FA 2VJOA 3PQ5A 5TARA 2VP2A 3ORRA 1M9NA 4GKKB 2UXBF 1SCAA 3NGLA 3QXHA 4TS3A 3MMSA 4P72A 2DKOB 1MORA 4DIFA 4B3MB 3DLBA 2Q6LA 4YRJA 2B92A 1BMQB 2C2EA 2KYRA 5KT2A 3UH1A 1RVV1 4OJNA 3R77A 1E2NA 4XJSA 5EGNA 1PKXA 5HTKA 2Q66A 5IMBA 2PI5A 5HVNA 2BFCA 4PLWA 1OQ3A 2A1TS 2IHZA 3SVTA 4HKTA 4K50A 3DTYA 1SCNE 4LBIA 4XB2A 3CC4S 1A98A 1OOEA 2CJXB 3NHYA 3R9WA 1JIUA 2IZ6A 1N6PA 2RI0A 4Y0AA 4I4TF 2WP8J 5IX8A 5CITA 1PJ5A 1YE3A 2FEOA 4MS4A 2O8BA 5KMGA 4XGRA 1P4HA 2TMKA 1C0LA 5BYQA 3G82B 4BFTA 2GA9A 2EVWX 2P2DA 3NCHA 4Y9UA 4I81A 1HE4A 2DRAA 4PAOA 2WWWA 4JI5F 4ZK7M 3ZHYA 1CNMA 4IX1A 1GPBA 4Q7EA 3EGWB 6PFKA 4XUCA 1HBNA 1R4MA 2HK2A 1UDXA 1NP3A 4BFXA 2OEPA 3DZFA 5K1ZA 3K2QA 4TYPA 3W2EA 3ND8A 2EKLA 1H3NA 2H9YA 2FW9A 3IQXA 5IYZB 2UZIR 5LDHA 2AA3A 3DZKA 5C25B 2MYFA 2F8HA 2GD6A 2A6PA 1GQQA 3H5TA 1Z3CA 2XVYA 4H3KB 4DL2A 2WHPB 4RKUC 3DLPX 3ZDQA 4Z8YA 2FJPA 3CW2C 1UMDB 4BNDA 4DARA 1POXA 1V2HE 4N77A 1Z83A 3BCRA 4BO6A 1GVNB 4BJ3A 1SC4A 2PSHA 1W29A 3PV8A 1ACLA 3AZOA 1GITA 2DG2A 2I1VB 4FDFA 1J2JA 4INZA 3RABA 5H9VA 5EG5A 3TJMA 1GFSA 4OYHA 4DQVA 5K14A 4L2IA 3AXTA 2LLZA 4U5XA 3CVXA 4MKVA 2DEUA 4NCNA 3LL4A 1V35A 4EZBA 2JC1A 3I9V1 2DVIA 4QFBA 1JXMA 1X4AA 1JF8A 4P3YA 4BGDA 1NVVR 3K8ZA 1Y42X 4LRCA 4F3YA 4D96A 2BANB 1WD6A 4K4YA 4N8SA 4DILA 1F60A 1B4SA 1F6TA 4W5WA 2IZ7A 3PTAA 2SBTA 1XMJA 1OFTA 1O58A 5ADHA 4YV0A 5E3QA 3WNVA 2QE7D 3QNUA 2AD9A 2JJMA 1CR4A 4A8JC 2X6TA 3A6PC 3UO8B 2VHWA 3EVBA 4OXXA 2H1RA 5SV2A 2BGJA 2FMTA 3KOZA 3N7UA 5GVQA 4A0QA 5L3QB 2OTLS 4F4IA 4ZTUB 1XBTA 1NKSA 1G8AA 3HB0A 1P7WA 1CY4A 3PDNA 1RPTA 2OYCA 1ULZA 1PKEA 1MGPA 1DIOB 4C20A 1KEZA 3ZDBA 1WUKS 1X5PA 1L5GB 3KETA 3DOOA 3RVLA 1J24A 1P9NA 4Y34A 2DIRA 4BGUA 1UCNA 1JU4A 3NNHA 3PFHA 2JPDA 4AB1A 2BE2B 3IBYA 3GZNA 2KZZA 1NQVA 3D6UA 3LHDA 4LSMA 5J40A 3QX9A 3HK2A 2CPFA 3WLFA 2M9MA 4MA5A 4DNOA 3C3XA 3KLFA 1SOVA 2J9FB 4U8YA 3VXKA 4J0QA 3GRCA 4Q1CA 4EB6A 3OE7D 3NTVA 2YW9A 3Q2SC 5DNAA 4UPVA 5AKXA 4QYTA 2V2ZA 3T3FA 5IT9Y 2VV5A 3G8CA 3HBJA 4KIFA 2AI2A 2QX4A 1IVSA 5JZVA 2POQX 3BKWA 1QOPB 1X1QA 4AL7A 2FUNB 1NK8A 2IX9A 4CCWA 5E4FA 2J7KA 1EWRA 3TNJA 1FQJA 1LB1B 1ODIA 1PYGA 2VPZA 3DOEA 1XMQF 4GOXA 3Q23A 3F44A 3JAKA 2JIBA 3NNNA 5BORA 4Z7YA 5CNIA 4N7BA 4AIRA 4LF5F 1OTXA 3V6DB 2QRKA 4HQ6A 2QYCA 3ZZNA 2W4DA 3GJ4A 5EP1A 1WC6A 3HYLA 4DMCA 2OIHA 4UHJA 3AIKA 1DEXA 3I8SA 3BJYA 1Z35A 1YOVA 4DWIA 3GIRA 4I1SA 2YC4C 5FDLB 4QDOA 2XXAA 4ZYXA 2HK6A 4DADA 3QIVA 4W5TA 3IAS6 1SKUB 3EXFB 3A2LA 3WLSA 4GUDA 1ISIA 3LDHA 4ILLA 2XUIA 1XNQB 3RSOA 4JYAF 4MS3A 1DWUA 1EEXB 2FEPA 4B7AA 3D81A 4EJ0A 3DE2X 3UD3P 2EX0A 1XPRA 3NV7A 2HBQA 5IC6B 1V5VA 4M8KA 1TUWA 1GKUB 4AWAA 3C6BA 3U4CA 3AJ9A 1OT3A 1RZUA 3GLQA 1SHUX 3ZE8A 4NHOA 4KX5A 1R6AA 2YY7A 1HI0P 3LP5A 4AKTA 4O4HF 1Y3JA 2HNZB 3AHEA 1WXGA 1MJFA 4LMRA 4AXIA 2DRDA 2P9ZA 2ZBUA 4RHEA 1KEPA 2IY7A 4E3ZA 2VNAA 1U4BA 1N1EA 3QKRB 1GYRA 5KQLA 2E1CA 2FN4A 4PONA 4R54A 2C8LA 3V2IA 2X40A 3KR2A 4ZEMA 1XFAA 3HDGA 3JVDA 1N5LA 4JI5B 2CDBA 5B7PA 3JQPA 3IP8A 2Q5JA 2RAFA 5JNUA 4QSHA 5HCNA 3V4OA 1AFJA 4N6GA 5FNVF 2IMWP 1WEXA 1HD0A 3OFJA 4IDBA 3SEAA 2A9KA 4LZPA 3R5FA 4G26A 1R1DA 2EXXA 1Y3DE 1C0KA 1NHGA 1FP7A 4QQ8A 3OP1A 1PSZA 3H4IA 3FZNA 2ZUBA 3AVUA 3E01B 3P27A 3SFTA 4Y2HA 3GP8A 4BFWA 4UUWA 4JZYA 3FFAA 2AMLA 5K3AA 2BKOA 2XZPA 1XU7A 2XLIA 2KKHA 1XAJA 3UHFA 1PK8A 4Q05A 3CCES 2MKHA 2XGMA 1P3JA 3MEEB 3PHIA 1N6QB 1NH7A 4TLMB 3GWZA 2GN9A 4Q1EA 1QS0A 2Y1XA 1X1EA 2HA3A 1G5RA 2IYGA 3HGQA 4DNQA 4MB6A 4M1TA 1PZXA 5FV7A 2W42A 5ALDA 5D1HA 4EKYA 4YDHB 3ND7A 3QUBA 5CG2A 2VCEA 3OXFA 4GVBA 2W6QA 3CF4G 4RTKA 5KFIA 4GM4A 3BD9A 4FMBB 4PWZA 4K26A 4G0WA 4KXVA 2YMPA 1OLOA 5HNKA 4PTLA 3VAYA 1O6BA 1Z17A 3GFVA 2FPLA 5AVQA 4XPEA 4LPKA 2OO7A 2GCIA 4Y9SA 1GGKA 3RS5A 1RCUA 4D56A 1VQYA 1KL7A 3M3DA 3ZYCA 3NWRA 2IFXA 3PVXA 1OBCA 1Y7HA 4DV0J 2Y1RI 4CKXA 1DVRA 4NPOA 1C3LA 4X20B 2O7VA 2QP9X 4NLRA 1BWSA 4I4IA 3KZXA 2PSSA 1KEUA 2WT9A 3PTWA 2ADFA 1HWYA 6NULA 5CVJA 1N0WA 4N5SA 3IPAA 5CGQB 3U7QB 4W8OA 2JJ2D 3GMSA 2EBHX 3KBBA 3MQ4A 3DBIA 1SH3A 1Y3CE 4MHOA 5K8TA 5B1HA 3WV4A 4Y2SA 1GAEO 3TOQA 5B1YA 3U7RA 1K06A 3RAPR 1VOMA 1XTZA 3AY0A 4Z4QA 1G38A 1KAQA 1RWMA 2OD2A 5K6AA 2PRIA 1NYRA 1Q7CA 3KQWA 1QJ4A 3CLSC 3FGZA 16PKA 4B6GA 4HUQA 1FSPA 5IZ4A 2QN1A 4E0DA 1CPYA 2C7PA 1QF9A 5I7UA 4D8TA 2QLMA 5HATA 2BZ2A 1DUIA 4UE2A 4GECA 2GIRA 1L8XA 1S76D 4ZYLA 4YAJA 3WHIA 2ZYIA 2QG6A 2AX0A 1ID1A 4FZ3A 2FX2A 1GM5A 4Q37A 1KERA 4XFDA 4FVMA 1NDPA 1YUNA 2QUHA 3G5UA 3A6ZA 3Q83A 3HCXA 2HVEA 2J31A 4Q19A 1R3UA 2VH1A 3CH7A 1E9BA 1FWPA 5LWHA 2XOEA 4C7QA 3JARB 1FFSB 3HADA 4RA6A 3SI8A 3DRRB 3ZI4A 2PUAA 2GNPA 2AKEA 4PHTA 3RT7A 1QAJA 1OWNA 1OXXK 2SCUA 4FCCA 4MRMA 4IFYB 4W5RA 2V96A 1Z29A 2J3JA 1VJTA 4FMDB 3D2BA 2GXUA 4HLNA 3HP4A 4LXHA 5KVCA 5ED4A 3GAZA 3W8DA 1FP4B 4Q3OA 4NX2A 3QU5A 3BCHA 1QK5A 3FMFA 3BFVA 2BLLA 3KUEA 3LRPA 1FP1D 1HYSB 3NVMB 3R3TA 4I19A 1LWNA 2DWUA 2A6MA 1E2UA 2WWTA 3I0MA 2NQ8A 1RBLA 3RTEA 3B6EA 3CO0P 5HQLA 1TMKA 2VWGA 4N4AA 5KFFA 3GUHA 2B7CB 1ZK0A 2B1IA 2ZB4A 8ATCB 3GI1A 3MSCA 4O4HB 4B85A 4WKNA 2J5XA 3MUTP 5GAHU 1NJXA 1DGQA 1XL1A 4PYDA 3ZZMA 4FYVA 4PZZA 3UPDA 3TCKA 1BJRE 4QVIA 3UGQA 4G09A 5T4BA 4JOUA 3AJ8A 3QYAA 2BFDA 3KYLA 2YWXA 1UPBA 1OW3B 3QI2A 5AK0A 1OE0A 3OBIA 3T1QA 2V9PA 2AT1B 3K0KA 2RAPA 1I3OB 1OMSA 5B3KA 5LUAA 3BAFA 3W7VA 4IHKA 5KJFA 4UOZA 2LIPA 3QW2A 2Q2VA 3N2YA 2G1DA 4NZ7A 2CHQA 3EDYA 3R3UA 1Z6ZA 4J3NA 2J3LA 4INJA 3CIMA 1CY8A 1GT6A 1AT1B 1O6ZA 3OF3A 3VU0A 1AF4A 1MCZA 2P6RA 3TL2A 3K5NA 5GGXA 3EMTA 2PWYA 3HJUA 1N3IA 5EWEA 2VDKB 2Q2QA 5LU9A 2HHVA 1YVPA 2PO5A 1BROA 1GGHA 1N1GA 1OU4A 1X4CA 4H9GA 2IUSA 4PXAA 2QTTA 3DKRA 1F8XA 1UKUA 4KFTA 4D1YA 3E3LA 3ECSA 2AL7A 1E18A 3MJCA 1PJQA 3AQOA 2OHOA 3V80A 3NHAA 3P4XA 4WW0A 4U0JA 3OY7A 4XQGA 2R1UA 4LWOA 2Y0EA 5JBQA 3MS2A 5C5JA 2N0SA 4MCJA 1ORIA 4A8WA 4NV1A 2WWYA 4B6FA 4IDFA 3DFIA 3MXTA 1Y6QA 3EIFA 4OZ1A 4RLQA 4GBJA 1REGX 5DMHA 1J49A 3AV0B 4QU6A 4FGKA 2P9JA 3ET4A 4EJMA 1WD7A 2CQCA 2NG1A 2P5SA 4MVJA 1UAGA 3W77A 5A8RA 3C15B 3NTXA 2CQ2A 3QZ8A 3KL4A 4P0QB 4PC1A 3ZY2A 3LF0A 3F5DA 3VV2A 3BM5A 1VE1A 4DR3J 2A5FA 2JD0A 3KQTA 2QXUA 4F4ZA 5DULA 3LF2A 3UVEA 4M1EA 4MARA 4B3TF 3STHA 2J6HA 2N75A 5DWVA 2IP4A 3C70A 1M0SA 2WV7A 4PC3A 2ZIWB 4FILA 1UWLA 2C54A 3H5RA 3FC9A 1ZH5A 3RU7A 3SZRA 5HROB 4IIGA 4XK8C 4B2IA 1WW2A 1FBNA 2ZM6J 4Z53A 3GB9A 3PFKA 2FZGA 4TLDA 5EWJB 2ZLBA 1V1JA 2CIMA 1RT4A 2I67A 2FE1A 1TMGE 4K8RB 2XTAA 1HTTA 4OP2A 1Z5VA 5LOVA 1XJQA 1RK8A 2WD9A 1M1GA 3QMVA 4BJHB 3M8KA 2A9RA 4RM2A 3U44A 2HRQA 4ZYWA 4M7RA 2AN3A 2RKIA 3AVWA 5COBA 3SG0A 1T1SA 4UUXA 1WPGA 3EQZA 4MZXA 3ZGNA 4PG5A 4DIKA 4ES6A 3RVRA 4RDHA 1O5JA 1YNSA 4B2PA 1XOIA 5CDGA 2IBOA 3SYKA 3LLCA 2ADMA 5ADUS 5GIPE 2AFRA 1NNLA 2GPWA 1LQUA 1OJ7A 4ZMBA 1GR0A 2R7AA 2FZKA 1C0TA 3CS3A 2Y76A 5KTRA 1I8TA 2D5CA 1PHPA 1XNJA 4AUMA 1JLLA 4J2OA 3CLRD 4DR7F 3JQ9A 8RUCA 1Z2AA 1GFWA 3DZCA 3U39A 3FDIA 1TCUA 1QZXA 4XVUA 4QTYA 2W6JA 2C94A 3FGOA 1RQPA 4GAEA 4QOIA 3D2CA 3AH6A 4Z2XA 1T9ZA 1XERA 1Q11A 4DJDC 1JIKA 4Q9IA 3OKCA 2EBWA 3A36A 4LGCA 5EIOA 3UB2A 4YHBA 5AK4A 3AETA 3T6JA 1NB2A 3DDIA 4G3XA 3TJRA 5K6RA 5H3LA 1FK9A 5DGAA 1JFVA 4X45A 4QR2A 3PGJA 4B0PA 1BZYA 1BS1A 4HACA 2JVJA 3OPYI 2I2DA 1E3JA 4GWLA 3I01M 1N2CA 4W7HA 3NOQA 1OY9A 3AUXA 4TV8F 4E0BA 3ZJ4A 1TKZB 2X5JO 4B6EA 4NXNJ 2YPYA 4KQ2A 5KAMA 4Y1RA 2ATXA 2PQ2A 1N8RT 4EFNA 1H0HA 2VOJA 4USIA 2PLWA 3MOGA 1JEQB 1HFJA 2ZJOA 1ILWA 2IU0A 3AR7A 3AOGA 3QX3A 4JV5B 2OELA 3RYIB 4L78A 1PGNA 1QX4A 2FKNA 3ONWA 4LEIA 4PICA 3S1TA 1KLMA 1BHO1 3DBVO 4P31A 3HXMA 5E2AA 3TQOA 3B6JA 5FJIA 1N9GA 2HQBA 3Q87B 5DP2A 4RXUA 3JQAA 5L51A 1ISPA 4MYRA 4KPFC 4EG7A 2HHQA 2PLNA 4GYYA 3BK2A 1VYHA 1YZGA 5ALSA 4EOGA 2IS6A 1P2FA 2X22A 5ABPA 5F35A 1OXVA 4EENA 1P81A 3D5QA 3RODA 1AKUA 1G4HA 1B43A 3CMAS 1QYIA 2NO0A 3D9BA 2F1FA 1SBNE 4ZOQI 5G3ZA 1JIVA 5DDPC 4JB8A 2I4RA 1CY7A 1J42A 1NSPA 1IZYA 3CX8A 5CD9A 2MKYA 1FFBA 4GLJA 3WHKA 5J2MA 4G1PA 2AIRA 3K8YA 4JB2A 1JBQA 5E6UA 3F6EX 3T38A 1KYQA 3G59A 4RSRA 3L7IA 1DFGA 1VGQA 4LYGA 2OPPA 1Z28A 4PC6A 2DCMA 4TVKA 2VG5B 1SRRA 5E3PA 3VYVA 3OZ7A 3HL0A 2JEGA 1H4SA 4LBPA 2O2GA 5FJJA 5A62A 1CJMA 1XXHA 4QRDA 1STOA 4H0CA 2GRJA 4EUEA 2OPHA 4HAIA 1XZFA 3CSUA 3H3XA 3PXBA 1O6XA 4QYXA 5CXUA 1WF2A 2VSOA 3A8EA 2G06A 4CTJA 2QL7B 1KTQA 3PU6A 4D9KA 3AV3A 3QU9A 1K8XB 1H2WA 4WYLA 3ZWDA 3LFTA 5EGSA 5ERYA 3W0LB 4KFCA 3KQPA 5AESA 4Z2AA 1NMYA 4MKFA 4K59A 3SV4A 2Y05A 3CF5Q 4C88A 1SJ3P 1MFPA 1IBKF 1SU4A 2ZBPA 4X1IA 1X3LA 3TLYA 3FNIA 4YRIA 3HR7A 1DCTA 2HFOA 2VODA 1URNA 4E5SA 4JELA 3L9XA 2HJSA 4M5IA 2CXUA 2VXCA 3TNLA 1XEAA 3TDMA 1RAAA 1UFWA 4IXWA 3JQGA 1AH2A 5COQA 4GVPA 1Y7TA 4CFSA 1YRAA 2NYVA 2EKZA 2UXCJ 1PYOA 2II6A 2XB9A 3H5UA 1A2BA 3BKTA 3R3VA 1LJLA 1WXXA 1ADJA 3LCMA 2GJKA 3K1TA 1WDDA 2FPSA 3W60A 4RFSA 2HHAA 1TL3A 3D3WA 4IH5A 5GV7A 2O9JA 2P3QA 5K8CA 1ZA2A 3INGA 1P2GA 4GM1A 3SCIE 3IPLA 3E3NA 4ZRMA 2TMDA 4RD4A 4J3FA 2XMAA 3MMAA 4PSVA 4FHDA 4EA6A 3JQ8B 1O97C 1RCTE 1EG2A 4P0PB 3I2FA 3RBZA 2I4NA 1FXSA 4MB2A 4Q48A 4DRXA 2GKSA 3DLAA 1GTRA 1OWXA 1G64A 3RK0A 1A1VA 5HJYA 1MROA 3LQFA 1CLUA 5DQHA 5H3CA 1JG2A 4DR7B 1WUYA 1WM1A 4XWOA 5IKMA 3I2HA 4ZIRA 1PRYA 4ZPBA 3IVAA 2V8OA 4IAOA 1E6VB 4YRPA 4BFZA 1KSFX 1ZNXA 3UFCX 2R6DA 1VCHA 3G9ZA 1VLLA 3EXHC 3RYFB 1C9EA 5AXBA 4OSPA 4PIPA 2BFBB 3OOEA 2FY1A 2PUEA 3GIKA 3WSVA 4RTMA 2CQ1A 1H65A 3ENQA 3LAWA 3HSSA 3SQLA 2P5VA 4RULA 4PXBA 4RH0A 2ZHAA 4YJFB 5BXYA 1FMFA 3PDIB 1O3YA 1D0IA 3HA5A 1R9GA 1E3WB 2IEYA 1E0KA 1OGYA 3V1TC 4EFAC 1PE0A 4C0SA 4XO0A 2WOMA 4FNMA 3T5PA 4KT0C 2XH8A 1CUVA 3RS8A 2IAJA 1IZ7A 3P52A 5A06A 3NGTA 1M73E 4KK4A 3F98A 2HK7A 2ZNZA 2MQLA 4QXQA 2R9LA 5L1LA 1FDVA 3ZNUA 3D1HA 1G2OA 2ZB3A 4ZOLA 1SIOA 5D85A 1BCRB 5HF9A 3HCFA 5KQGA 4MQ5A 5EQDA 2PSEA 3ST7A 5DNWA 3GLIE 3CO0S 3T5CA 2BHRA 2NNWB 2FSFA 4QRIA 2B6NA 2A1UA 3GSIA 2B99A 3VPSA 4US1R 3K9CA 2IZ1A 1M34A 3BV8A 1T0UA 5GAJA 4REMA 2BEWB 1BFUA 1FS6A 4BO2A 4YRRA 1E1NA 3SJAA 1ZJZA 3TAHA 1M2EA 5KWJA 1T24A 4TN1A 2HDOA 3T9EA 5AKIA 1L3KA 3BGUA 2PGNA 1R4NB 4HHUA 4MIOA 3BJMA 4XD7A 3DMTA 5M5BA 1SY7A 5D3GB 4KO1S 1AJEA 3PIOQ 3HHLB 4IS2A 4PZVA 5EPUA 2EL7A 1VYTA 4AZ0B 4NLVA 1RWPB 1F3OA 2A5JA 4WCVA 2EIXA 4D45A 3NT4A 3B6ZA 2ZE2A 2EQBA 2R6FA 3BYPA 1MAWA 1TQ2A 2QT0A 4HNAA 3QUCA 5I3PA 4H2DA 4YACA 1XMVA 2WONB 4JSTA 1VYUA 5EIBD 3Q0TA 2WVFA 4NLDA 3EC2A 1XPJA 2P0EA 3F9CA 3R20A 3E1SA 5FB3A 5F98A 1Z8DA 4XLTA 2Z57A 1FRNA 3TK1A 3W1EA 1SPXA 3O3OB 2QROA 3KFXA 3A6JA 3CJKB 4RELA 3PIPQ 3N8NA 1EIWA 4N41A 4X00A 5DRYA 4IDGA 4R25A 5CYOA 3DNMA 2FHKA 2X14A 2ZRGA 1I4EB 1X7GA 2J33A 2PGLA 1NVWQ 2ZH4A 1TYDE 2GTPA 4DLWA 2DU8A 1N33J 2O0KA 1DZ5A 3QEBZ 1FFHA 4MV0A 1N56A 1JBEA 3WL3A 1YO6A 4G41A 3P2MA 4PBRA 2NQPA 3WGTA 4OK3A 4CIYA 2XWSA 1P31A 1RBQA 1C4KA 1CJTC 1PEKE 2QVXX 1FHTA 2QP3A 3INRA 2ZUAA 4S04A 2AN5A 2N1BA 1D6JA 3O92A 3EA4A 4CI0B 2F3JA 2FFQA 2XS7A 3CJQA 4ARVA 1IBKB 3THSA 5PGMA 4DNFA 2HT1A 1WG8A 3RRXA 4CGZA 2AOTA 4WY5A 4G37A 4KPEC 1OXBB 2JB9A 2YOFA 3RSCA 2C4HA 4MMYB 2PO4A 1GCIA 2IUEA 5A0VA 4CMAA 2HXGA 3PKJA 3DR3A 4MCAA 1OFIA 2CC2A 2A4MA 4PLTA 3JAMU 1QFYA 3NTQA 4R4JA 3EHEA 4MJKA 2XHWA 4NEQA 5EMNA 4PHFA 1GXLA 4CCYA 4ERDA 3VTFA 2GK4A 4IQFA 3DU6A 1Y4SA 1RWVA 1L5YA 3UH0A 3QWIA 4FNGA 2BJ9A 4J91A 4HBZA 2J09A 1ST2A 3FM9A 4LBZA 2JFBA 2X1HA 3E27A 4MTCA 1DC8A 3MBKA 4YNBA 4RLHA 3MWEA 3C4JA 3PYFA 1TL7C 1FCAA 1P1LA 4P7JA 3D6NB 3K1AB 4GZMA 2YVLA 3C39A 3RH0A 1OR8A 5CYPA 1HA3A 4CV2A 2WC1A 1FDOA 3PUZA 2BZSA 2EVZA 3SSAA 4QE3A 1N77A 3E9MA 3OQHA 5JO0A 4UZBA 1UBTS 4WK2B 4UEOA 2GARA 4XIYA 3LWMA 3SJBA 3QTTA 2GJSA 2PBZA 3S7TA 1E8MA 4BQQA 3BGSA 5JHHB 3AF3A 1JLEA 3FMIA 6FD1A 4JXKA 3CJ2A 1R8HA 1W46A 4Q5VA 3K6JA 5JFOA 1ZUD1 1IL0A 2DXIA 1EBBA 1Y8RA 1E9AA 4RW8B 1F2VA 3ZQUA 2Z2IA 4NCKA 3PB3A 5BW4A 3A05A 2J59A 3VR4H 3OSNA 2D59A 2EWHA 4YI3A 2E5LF 3A6GA 1PR6A 4HDOB 2C5HA 2CNBA 2FFJA 4DQPA 4TQUS 4J6EA 3GJ7A 2WUGA 3OA0A 4AY5A 5ETLA 1IBRA 5FDFA 4LFAJ 5SICE 1DKOA 1E5TA 4O2AA 3FNNA 4NMXA 3Q11A 3L1HA 2K6GA 2AX4A 4HGZA 2DNQA 5JASA 3FUUA 4IILA 4KPGA 4FXOA 3UDEA 1DPFA 2O5CA 1Z75A 4RU2A 2OWDA 3SYMA 2VC2B 4ZVLA 1MOZA 2WZDA 3FDZB 1RHRA 2RK4A 4GICA 5LBUA 1GNRA 2HAIA 3PNKA 2OEKA 1U45A 1QYCA 1NHKL 7GPBA 3BXGA 3Q8SB 4P52A 1KHVA 1UPCA 2GEJA 2KJVA 4L6IA 4N48A 4PZCA 2QP4A 5H02A 5AW8A 1X0PA 2K2QB 5JSHA 4CKBB 3VHXB 4HWKA 5FBQB 3S2FA 5FL7D 3PNOA 4GXQA 1ZJ5A 1LSSA 3DBLB 3V2UA 1K3FA 4YJDA 2XOXA 3LUPA 4QDKA 3A70A 5CVVA 4B3DA 2ZKTA 2NXWA 2WE7A 4B79A 1F9HA 1Z38A 1CRPA 2YYSA 2XCTB 3C3LA 4C8YA 2ZUDA 3PR4A 3FYUC 2PANA 4LRQA 1A77A 2KI5A 2BBTA 4RDCA 1EA7A 1A9RA 1BRMA 1ESZA 2QTVA 1LW6E 2GHTA 1I2AA 3QVKA 3OT1A 3ITHA 4RA9B 4LDZA 4Q8FA 2OD7A 3ILJA 3U3MA 1L5FA 1K8YB 3TRFA 1NKTA 3I45A 3KQHA 5H82A 2RG7A 1E3EA 1MTOA 3H98A 2JFZA 4EPTA 121PA 3ESZA 1LK7A 2YWCA 3HG7A 4OHWA 2G9UA 5EIWA 5L38A 1DC5A 4NCGA 2HUNA 5EMLA 4E1AA 4OQ4A 4MV4A 4Y0NA 2J3DA 3ABSB 1C1BA 3PJWA 3TOCA 3MOJB 2FEWB 4RKRA 4FHEA 5A04A 1MD9A 4WFAQ 2PZMA 4EMTA 1G6Q1 2MLYA 3QZ7A 1CX9B 4R2LA 5KYNA 1CF9A 4WUTA 3ZD8A 4NSNA 3QVUA 1TC2A 2CBXA 3G0BA 4JI8F 1CJBA 2V2KA 5G1OA 1JXEA 5CZXA 1Z6PA 3J7TA 2PUFA 4AXXA 4YB6A 3ZDYB 2VUGA 1Y3AA 2VA8A 3VPBA 1QORA 1V8FA 4RPJA 1NVUQ 3QLHB 4RD3A 4RGBA 1K7YA 1JQDA 1C30A 1JB0C 1FKPB 2JF0A 3P2YA 2ZYWX 4GKVA 2CPIA 1PVDA 5K0CA 1DXHA 2C82A 1G5FA 1FTWA 5CTJA 4HEJA 1BEZA 4QBHA 4JLSA 5F7JA 3WR5A 2B4PA 3VVUA 2E21A 3LMKA 4TL8A 1P5FA 1X92A 3OWXA 5GONF 1GX6A 2F4NA 4H0FA 4J9VA 1UZDA 3KHGA 4M63A 2W2KA 2I3DA 3MAQA 3BRWD 4C7OA 1L5NA 1HDRA 1N5SA 5JRDS 3OZWA 1QTNA 1CJVB 4JJ8A 1K86A 2YJZA 3QKSB 4PXCA 5AM1A 2JLZA 4NXMB 3QNWA 3ZCTA 2FCRA 3R7AA 3K8QA 2YZGA 3C85A 3RT1A 4ZHQF 4Q3KA 3S0JA 1OHHD 2VD3A 1RBOB 2XMKA 1VL2A 3PUKA 2AMFA 1NKVA 3D5TA 4CO2A 3LFHA 2FPUA 4NLYA 1C9DB 2QZSA 3U7HB 4CQMD 2VBFA 1KVJA 1NI4A 2J32A 1AKTA 4U00A 3H1BA 2DERA 5IAJA 3ZZTA 4D99A 1TK2A 4LF7F 3Q9NA 1ZSNA 5JPCA 2YY6A 4PYMA 2ZBCA 1C14A 4BZPA 1DBPA 1VHTA 4I55A 5IAOA 4DL3A 3WK4A 1FUKA 3L6BA 3PYLA 2QIOA 3GLIB 3AOBA 3FSGD 5EXTA 1W52X 3PRHA 3DRXA 1YC2A 3GWGA 4KK3A 1UT8A 2YNHB 5J4VA 1HLFA 1JLGB 4OG2A 4CHTA 1M2KA 3DE4X 2H11A 3T5KA 1AIPA 2B6AB 1S79A 4OLFA 2BW2A 1KJ9A 4OFXA 1VGYA 5EXPA 4K9DA 2HMIA 4NQZA 3ZJ5A 4HVAA 3LFUA 2VQDA 3SYNA 4QAQA 2LEPA 5D4NA 1ZBQA 3OICA 1N7IA 1F1JA 3HYSA 3HKEA 3E81A 3C8DA 1D9DA 4CU2A 4O3OA 4PIMA 4DA6A 3LC2O 3U09A 2DT8A 4QYSA 5K0EA 4L3OA 2WVEA 3L8GA 1XQ6A 4BMOB 2ZOGA 2PU7A 2HDHA 2OOSA 4OQZA 1XEXB 1RW4A 2YN4A 2OPRB 2ORVA 2QRLA 3EXG1 2FPPB 3C8MA 1MJ5A 5K2MA 2M70A 4O44B 4QU5A 2GO9A 2DGDA 3ZU2A 2FUG1 3CBQA 3ETMA 2B36A 5AXNA 3A04A 3FF1A 4ED9A 3IQWA 1QHHA 1HYGA 4P98A 2RGNC 3VSDA 3OZSA 1BIFA 3FDFA 1PW5A 5ITWA 3OO1A 3KZNA 3HB1A 2H65B 1RRPA 2P40A 4LECA 3H0CA 1LPSA 4KSBA 4A46A 1PQWA 1WB6A 3COWA 1UPPA 4NMWA 3QA9A 3KOXA 4GP7A 4FKBA 3DMPA 4JGGA 1CEXA 2WQ7A 4IO9Q 3A3KA 1F4PA 2ZJYA 3WZLA 2F1RA 3IQFA 2P2YA 4ZLPA 2GCOA 1B4DA 2C2RA 4BVAA 1AKRA 5KYWA 5HPYB 4QU7A 1ISHA 4HRXA 1MX9A 1E0AA 4AS2A 2VVTA 2ID9A 5J2PA 2ADCA 1RI4A 4FYPA 1NIPA 4HQ0A 3RU3A 5FA6A 2G2YA 2H1YA 2HYIB 4DPYA 2GM9A 2BTEA 5L4NA 4DCTA 3IBGA 1VIDA 4KN5A 2CNKB 2Y0DA 3HJGA 1QIDA 3BDPA 1B26A 5CVEA 5G41A 4NF2A 3G0CA 1H1TA 1Z4JA 4M0KA 1EA5A 4EPYA 2O2SA 4F45A 3CX4A 1QHIA 2RFLA 1Z0FA 4L0DA 1LWCB 3E03A 3BGRA 3LO3A 3ESAA 1OZ0A 4MVJG 1FYDA 1WXEA 5AXCA 2BELA 4ZJPA 1OI3A 1PFWA 3P9QA 1ZK4A 3MOIA 3FQKA 4O0MA 1PJZA 4M0EA 4PLCA 4RJ2A 3OCJA 4WZ6A 3FTPA 3MD1A 2G2OA 1Z7EA 5FLXU 2W9BB 1PEDA 2OFHX 4JI8B 1QMPA 4DABA 2VP9A 4LISA 4NEHB 4R68A 4B3HA 2HCBA 2ZUFA 4L76A 2GFHA 1H5NA 1S7HA 2E18A 2ALYB 2OC9A 3DLCA 2OENG 4MIWA 2NZ4A 1E77A 4PYAA 4UQTA 3V55A 5ENVA 3RYCA 2HIYA 2D8MA 1I2MA 4I50A 3NAGA 3M6LA 4IGIA 1BE8A 3CNQP 2HB6A 1NQTA 3X1YA 1ATZA 2C22A 4F71A 4QWAA 2R25B 3O8QA 3B36A 4PHHA 3PUYA 4ANCA 1RT5A 1X7WB 3QFFA 3LUAA 3RFTA 3CDUA 1DZIA 1CUGA 1DQSA 5JISA 5ERGB 2ZQYA 1C5KA 1JKJA 1XAHA 4EK9A 5JO9A 1VQNS 4ZLNA 1G55A 2G07A 4RBVA 1CZOA 2WP0A 1HZZA 3RRKA 3WLLA 4LSGA 3PWKA 1TZMA 2YMLA 1MRSA 2JFUA 1U0LA 1ZH0A 3C6KA 2DHEA 3N5FA 1SU7A 4RD6A 5JQGA 3L1KA 4UTOA 4UULA 4EPVA 2I38A 4LFCJ 2PX3A 3OLVA 5JECA 1HW9A 1QY7A 2VJBA 3HY3A 1LFWA 5T4FA 1RRVA 5HFJA 1IOZA 4RXTA 1DAXA 2YQ0A 2HSDA 4D4MA 4B84A 2NADA 3N8IA 1QUEA 2DVMA 2R0QC 2EC0A 3R9KA 3NY0A 4PXSA 3GRUA 1SUAA 4KFBB 4OJGA 1U99A 2R8IA 3CONA 3ZHQA 1BKYA 1RWBA 4ZGBA 1U0TA 2C5FA 3R5HA 3H3JA 1ND5A 4B3BA 1ETHA 1EE2A 4TGLA 1JQBA 2WZ1A 1B42A 1WOSA 3S29A 4O3NA 3ZWNA 4YRNA 3WYAA 1MO2A 4LSLB 3VALA 4G1QA 3IUNA 1W4RA 1MIHA 2HH9A 3PPWA 3OCXA 2MQQA 3QOXA 4Z4FA 2XMDA 3ISJA 2FTRA 1CU1A 4UUNA 3IRWP 1IN6A 3SDEA 1VL8A 3GJQA 2LEBA 2JJQA 2XNSA 2ZI3A 4DL6A 4HRAA 3QX7A 3UJ8A 3KKLA 4C76A 4CL0A 4RPFA 1X8JA 1PG2A 2NUHA 1IZZA 1CHDA 1XNRB 5LD2B 4FN5A 5HZGA 1U7UA 4GLOA 3NUZA 1AUDA 1WLYA 3MRTA 2M2IA 4R7TA 3MM4A 1F9AA