4AUKA

Crystal structure of c2498 2'-o-ribose methyltransferase rlmm from escherichia coli
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
357
structure length
355
Chain Sequence
b'MNKVVLLCRPGFEKECAAEITDKAGQREIFGFARVKENAGYVIYECYQPDDGDKLIRELPFSSLIFARQWFVVGELLQHLPPEDRITPIVGMLQGVVEKGGELRVEVADTNESKELLKFCRKFTVPLRAALRDAGVLANYETPKRPVVHVFFIAPGCYTGYSYSNNNSPFYMGIPRLKFPADAPSRSTLKLEEAFHVFIPADEWDERLANGMWAVDLGAPGGWTYQLVKRNMWVYSVDNGPMAQSLMDTGQVTWLREDGFKFRPTRSNISWMVCDMVEKPAKVAALMAQWLVNGWCRETIFNLKLPMKKRYEEVSHNLAYIQAQLDEHGINAQIQARQLYHDREEVTVHVRRIWA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBOSOMAL RNA LARGE SUBUNIT METHYLTRANSFERASE M
publication title Crystal Structure of Rlmm, the 2'O-Ribose Methyltransferase for C2498 of Escherichia Coli 23S Rrna.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 118
structure length 355
sequence length 357
chains with identical sequence B
ec nomenclature ec 2.1.1.186: 23S rRNA (cytidine(2498)-2'-O)-methyltransferase.
pdb deposition date 2012-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01728 FtsJ FtsJ-like methyltransferase
A PF18125 RlmM_FDX RlmM ferredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2810 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4aukA01
3.30.2300.20 Alpha Beta 2-Layer Sandwich THUMP fold THUMP fold 4aukA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4aukA03
3DTNA 4FS8A 4C03A 3E8SA 3AXTA 4KWCA 2P7IA 2OY0A 2XYVA 3M4XA 4AZWA 2IH4A 3HVKA 4R8RA 3TMAA 4GC9A 5CM2Z 3HNRA 1P91A 3C3YA 5KVAA 3LKZA 1IY9A 1O9GA 5EPEA 2AVDA 3HVIA 3LDFA 5FA5A 1X1BA 2JH8A 2DULA 2F8LA 4PYOA 3FZGA 2HMYB 4C04A 5F2NA 3G2MA 2IBSA 4P7KA 2PSSA 1FBNA 4L7VA 2ONZA 2O05A 2ZZKA 4FSXA 3T7SA 2HR1A 1ZG3A 3OZSA 3TKAA 2G70A 2PX8A 2YQZA 5HIMA 5T6BA 1UFKA 3DUWA 1R8XA 4R05A 2BH2A 1Q0TA 1KPGA 2AVNA 5DXAA 1JSXA 4XUEA 3DOUA 2ONYA 4PCAA 2LD4A 3O31A 5E9WA 2ZBQA 2BZGA 3GDHA 4RX1A 5EC8A 3PX3A 4DMGA 2PT9A 1HMYA 1SUSA 1BOOA 5T67A 4GQBA 1D2HA 2HV9A 2CL5A 5DM2A 2B25A 5FUBA 4E32A 1XDSA 4PIPA 3KPJA 3EVDA 3AJDA 4DA4A 3HEMA 4FSDA 3GNLA 2JHCA 3TPZA 5ICCA 2ZWAA 5E2AA 2IDJA 2QRVB 2ZZNA 1X1DA 1RJGA 5HOQA 2B78A 3E23A 4HTFA 3LSTA 3ME5A 2OZVA 2PXAA 3KR0A 4MTLA 1G55A 3CJRA 3EVGA 3AWIA 4ER0A 2C7RA 1VPTA 2P40A 3O7WA 3E05A 3PFGA 2YXDA 1EG2A 3UJ7A 5E8JA 4OX9Y 3TM4A 4ER5A 1M0EA 2FPOA 5EOVA 2AN4A 3FUTA 2NXJA 3IEIA 4DZRA 3EPPA 3NWBA 2V7EA 3E7PA 3EVCA 5EMJA 3P9KA 1XXLA 5FQNA 3VC2A 2AN3A 1G60A 2PX5A 1YB2A 3A26A 4KIGA 2R3SA 4GOND 5EHGA 2IIPA 4RV9A 2EJUA 1JG2A 2Y1XA 3OE4A 1SVUA 3RIEA 3L8DA 1AV6A 1L1EA 1TW3A 3ELUA 3HA3A 3M6WA 5DLYA 5KQSA 5BW4A 2IPXA 4WXHA 4HGYA 3T0IA 1FPQA 2PWPA 3DP7A 1SG9A 3BXOA 3DLCA 2EX4A 4H0NA 4OA8A 2Y1WA 3UZUA 3MHTA 2GA9A 3LCCA 5DM0A 1V39A 5GM1A 3UJ8A 4FT2A 2PY6A 4AZSA 3B7PA 4IV0A 3P9NA 4RTOA 5EEGA 4K6MA 3FPJA 1R6AA 3TOSA 3KR2A 4M38A 3AXSA 1KPHA 1WY7A 3BKWA 3GRVA 2G72A 3HM2A 5FULA 4YV0A 3G2PA 4OQEA 5F2KA 2HWKA 2JHPA 3UWPA 2GH1A 2EG5A 3BGVA 5DX1A 3B3GA 2UYOA 3EMBA 3GCZA 5EZSA 4FZVA 1XDZA 2WA2A 5HZMA 1R74A 5FADA 3GXOA 3KQWA 3P8ZA 1WXWA 2IGTA 2ZIFA 3HA5A 3SXJA 5EMLA 3KQPA 3OFKA 3B3FA 5EMMA 4HGZA 4X63A 3B3JA 4CWAA 4X1OA 5H02A 3EEYA 3EVZA 3HCDA 3V8VA 3A4TA 5JR3A 3P71T 5KQRA 2YX1A 8MHTA 3ORHA 4PONA 3GRZA 4MQ4A 1U2ZA 4YUWA 5BP7A 5K0FA 3LCUA 5K0BA 3KPUA 4RTSA 2JG3A 3PB3A 1EJ0A 1ORHA 3UJ9A 3FTDA 3LDUA 4LECA 3T7RA 1PJZA 4EKGA 3C6MA 3H2BA 3R24A 1JSZA 1PRYA 2PBFA 3M70A 4X61A 2Q41A 5C1IA 2FCAA 2OBFA 1JR4A 1Y8CA 3C3PA 4UOEA 1I4WA 1JG3A 3GO4A 3HVJA 3P9IA 2NXCA 1YFLA 4HTFB 1NT2A 5EQJB 10MHA 4V0QA 3SX0A 3TRKA 5DRYA 2BR3A 5FA8A 4IKPA 2G8NA 1DL5A 1G8SA 2K4MA 3NWEA 1X1CA 3FPFA 4QVGA 3JWHA 3KQVA 3BWYA 3D2LA 3NDJA 4EK9A 5ICEA 3HCEA 4RSRA 4YV1A 1VQ1A 5CVDA 4YMHA 5G02A 3PLAE 4OBXA 4PYKA 4MIKA 1M6YA 1BHJA 5K0CA 5GOZA 1JQDA 2XVAA 5LQAA 2BR5A 3G2OA 3IV6A 4HH4A 2ZWVA 4U7PB 2OO3A 2NNWB 1DUSA 5EEHA 1RJEA 4RTMA 2XBMA 2OPBA 1Q0SA 2GAFA 4PINA 1F38A 1HNNA 4CKBA 1SUIA 1KYWA 3PS9A 3FUXA 1AQJA 3HTXA 1SQFA 4E70A 4V0RA 4E2YA 4AZTA 3ER8A 4EQZA 4F84A 3RW9A 5DSTA 3KQQA 3PFHA 4YUYA 3DMHA 2FRXA 2IP2A 2C7PA 2UYCA 5E1MA 1P1CA 3DR5A 3MTIA 2I62A 4R6WA 3R3HA 2H1RA 3LDGA 4ER6A 5BXYA 2NXEA 2P41A 3MQ2A 3U81A 5EKXA 4LG1A 1P39A 2UZ4A 4RVHA 3SVZA 3LBYA 7MHTA 3JWGA 3P9CA 2XVMA 3KKZA 2V74B 1EIZA 1N7JA 4HRAA 1G8AA 3O4FA 3ID6C 4AUKA 2PLWA 2ERCA 4XUCA 1YFJA 2P35A 3KU1A 5GWXA 3FPEA 3WSTA 2FK7A 4FP9A 3OZRA 1KXZA 4ISCA 5CCBA 3CJTA 5CIYA 3P2IA 3BWBA 5K01A 1NV8A 2O0LA 4AX8A 2BM8A 4CKEA 3MERA 3CJQA 5GM2A 3FTCA 1H1DA 3C6KA 3G5TA 3UJDA 3VSEA 2ZTHA 5FHQA 1RI4A 1N7IA 5DTQA 3T7TA 3B89A 3DMGA 2ZCJA 2YUIA 3FRIA 1WZNA 1RI1A 4Z2YA 1INLA 2AOUA 1RJDA 3UJAA 1QAQA 3QV2A 3BKXA 4PIMA 3LPMA 2NXNA 3P2KA 5DRTA 4RVFA 3S68A 2EJTA 4RTQA 3NDIA 3SR4A 3DLIA 3OE5A 2ZLBA 4KIFA 2CMGA 4HC4A 4C06A 5GP1A 1NW7A 2N47A 3HVHA 5KS2A 5K09A 2FYTA 5EIFA 4BLVA 4P7GA 5FCDA 1FP2A 2AR0A 2AZTA 3KQYA 5EKUA 2QM3A 3LBFA 3CBGA 5F2OA 3M6XA 4WVLA 3C0KA 4PCLA 5EVJA 1P1BA 5EZQA 3EGEA 2I7CA 4QQNA 4POOA 2H11A 2GLUA 2DPMA 1VIDA 2PKWA 3SGLA 5K03A 3CVOA 2PX4A 1SQGA 3SSMA 1NV9A 1YZ3A 4P7JA 2IFTA 5E8RA 5P8WA 1KR5A 5T64A 1X1AA 2VP3A 5DSXA 2PVCA 4QDKA 5LSAA 2OYRA 4R8SA 4YMGA 4F85A 3NTVA 5K0EA 1L3BA 3GRRA 4OBWA 3UJ6A 5IKMA 3G7UA 4MWZA 2FK8A 5CCXA 2GB4A 3OPNA 1IM8A 3A27A 4CTKA 4QTUB 4DCMA 2I9KA 2UYHA 2JH9A 5ERGB 4NECA 1I1NA 3MCZA 1R18A 3G8BA 5E9QA 3BT7A 2OKCA 4P7FA 1RI2A 1VE3A 1NBHA 1NKVA 3KR9A 4X60A 4GOMD 5CVEA 1L9KA 3IHTA 4M36A 5HFJA 3ERCA 2NP6A 4AZVA 3MCTA 4Y2HA 2H00A 3K6RA 3X0DA 3PT9A 4BY9E 2AOTA 5E1BA 5IH3A 1FJXA 1XCJA 2P3OA 2PWYA 2ZW9A 3M33A 2ZULA 2B3TA 2ZSUA 3P2EA 4RVDA 4A6DA 5EG5A 4RTPA 5FWAA 4G56A 3EVFA 1QAOA 1JTEA 5MHTA 2YVLA 1YUBA 3BWMA 3DULA 3HP7A 3GWZA 3K0BA 3LL7A 3NVKI 2CMHA 4CKCA 4ER3A 1ZQ9A 3GGDA 3NJRA 4BP3A 4YUZA 5K05A 3NW9A 3EEOA 3CGGA 1VBFA 3FPHA 2WA1A 1NW5A 2PXXA 4ATNA 4F86A 4JXJA 4PYQA 5K0JA 5K0GA 2IH2A 1UWVA 3TQSA 2AOUB 4R6XA 4OA5A 3Q87B 3DMFA 3EGVA 1WXXA 4XUDA 2C7OA 5DX8A 3G2QA 5K0NA 2VS1A 3UFBA 3KQMA 4QVKA 3HCBA 3B5IA 3SSOA 3A25A 1RI3A 3ELDA 3HCFA 3KHKA 1BC5A 2ZZMA 1F3LA 1JQEA 1TW2A 4BLUA 3GRYA 5B1SA 4IWNA 3HCAA 1SKMA 5EIWA 5KYGA 2PXCA 3DH0A 3EMDA 4E2XA 3R9XB 1L3IA 5GINE 4BLWA 1O9HA 4BP1A 3LGAA 4DM3A 2G71A 4EMSA 2IBTA 3FUUA 3KQOA 3LECA 2PJDA 1WS6A 3I53A 4A6EA 1AF7A 2I6GA 2WK1A 5CD1A 1D2CA 4C05A 1I9GA 3QOWA 4RTKA 4OQDA 2A14A 1IXKA 4KDCA 4QPPA 3I5UA 3OZTA 4KW7A 1M6EX 1TPYA 1KIAA 1NW8A 2P1DA 2ZBRA 5E1OA 2QE6A 1JG4A 3OU6A 1YF3A 3ELYA 3BZBA 1KHHA 2ZIEA 1VP3A 3PTAA 4E31A 2ORED 5HEKA 3REOA 1VP9A 4RVGA 3SM3A 2B2CA 3PVCA 3R6TA 2CKDA 3GJYA 4CXMA 1XTPA 5DX0A 9MHTA 2VDWA 3TLJA 1G6Q1 1O54A 3DXYA 3LCVB 5D1HA 3ELWA 1ORIA 3G89A 4EKIA 4DKJA 4GOLD 5HIIA 3I64A 3M6VA 5EMKA 5GIOE 5K0LA 1RI5A 4QQKA 3ANXA 3VYWA 4M7RA 3KQTA 1N2XA 4YUVA 5FHRA 3V97A 3DXZA 5BW5A 3ER9A 1NBIA 2AOTB 3HA7A 2YTZA 1T43A 4MHTA 4PYNA 3OU2A 3UJCA 2C7QA 2XYQA 5ICGA 2B9EA 2JHAA 1OR8A 4DQ0A 3FRHA 5EGSA 1XDUA 3LHDA 4PYJA 2HTEA 2PGXA 3UA4A 3FTEA 2AN5A 2VDUE 3OCJA 4GEKA 3A7EA 4B17A 3LKDA 2NP7A 1ZHFA 1KYZA 4E30A 3I58A 5LQKA 3Q7EA 4E33A 1QAMA 4LWOA 1MHTA 4ZTBA 5C0OE 4HG2A 5CVUA 4U7TB 5LQNA 1XJ5A 3NVMB 4RTJA 3MGGA 5ICFA 4X41A 4E2WA 5HIJA 4GOOD 3BWCA 3G5LA 2UYQA 1NW6A 1ZKDA 3EVBA 4P58A 5DTMA 3G8AA 5U4XA 5LQJA 3R0QA 3BGDA 5GIPE 1FP1D 2R6ZA 2ZBPA 3EGIA 4Y30A 4GC5A 3JWJA 4IV8A 4PYIA 3M6UA 1JTFA 1R00A 1MJFA 2AOVA 3DXXA 5K8VA 1XVAA 5JUWA 3KPWA 2ZFUA 3KR1A 3QOXA 1B42A 5D1NA 5DTRA 3TR6A 1QANA 3UJBA 1BKYA 5DM1A 3CCFA 2GPYA 3FUWA 5LQCA 5E2BA 3G88A 4O29A 5CUQA 5EHIA 2AS0A 1D2GA 2GS9A 3KPYA 4C07A 5LR6A 1XCLA 5E9JA 4GF5A 4C08A 3NMUF 3CC8A 1ZGJA 2Z6UA 5C9ZA 2JJQA 1DCTA 3VC1A 2P8JA 4XCXA 3P97A 3AY0A 3IYLW 3PX2A 4FGZA 4E2ZA 3UA3A 2NYUA 4CTJA 3CKKA 2VDVE 1JG1A 3GU3A 5FQOA 1AQIA 1YZHA 2EFJA 2OB1A 4YUXA 3BGIA 5LQUA 1Z3CA 3HCCA 1JQ3A 4PYLA 2ZVJA 4QDJA 2PV0A 1X19A 4RTNA 4PNEA 5E1DA 2IDKA 2KW5A 1ZGAA 2O06A 2ADMA 2YR0A 3BUSA 4QPNA 4RWZA 2OXTA 3JWIA 3MTEA 1QZZA 2PX2A 4C4AA 4M37A 3THRA 2XYRA 1EJ6A 2ESRA 1NW3A 2BR4A 3OFJA 2P3QA 5FTWA 2BM9A 1KPIA 5DWQA 3A7DA 3I9FA 3EVEA 2ZIGA 1QYRA 1NE2A 5CVJA 4DCGA 1VL5A 2IH5A 3MB5A 2E5WA 3GIWA 3LX6A 2YXEA 4KRGA 3FYCA 4QTTB 3GRUA 1RJFA 2QRVA 2AOXA 2O07A 2AOWA 5LQRA 5M5BA 1G38A 5DPMA 3F4KA 3TFWA 2PT6A 4PGGA 5DXJA 1R8YA 2Z6QA 2VZ9A 2YXLA 4KVZA 2FHPA 4PWYA 2CWWA 3SSNA 2G1PA 3UBTA 4FR0A 2QY6A 4ER7A 2OB2A 2HNKA 1KP9A 4EVIA 4RTLA 5DT2A 1L3CA 3KPVA 4GUAA 3TM5A 4RYLA 3MAGA 3RODA 3THSA 5HIKA 1WG8A 4PGHA 3KQSA 3FUVA 5FWDA 3SMQA 3TKYA 1EAMA 4LWPA 4PYMA 5CVVA 3OU7A 4DF3A 1VLMA 2QYOA 3FYDA 4HSGA 5HILA 2P7HA 2O57A 3EVAA 4YV2A 5DM4A 4RTRA 3FTFA 1UIRA 2Z6AA 3FPGA 4FT4A 2P3LA 1EQAA 4KDRA 4GBED
chains in the Genus database with same CATH superfamily
4QWCA 1HW9A 3TW0A 4P52A 4D45A 2G1DA 1DZIA 1NSKL 1DWUA 4UY8T 4K0KJ 4LDAA 2IBSA 5CFMA 1XZDA 4XX1A 1L5QA 3HCPA 5ITWA 3ESXA 3T7SA 2VKZG 3H8JA 3OZSA 2X7JA 2PUVA 2F8TA 3GLJA 1R8BA 1FNSA 2B9WA 5FTMA 3UM9A 2VP2A 5KX5F 4UASA 2QTAA 4FYXB 5AXKA 3E01A 4ZN3A 2F4VJ 3MJRA 1UKVY 2D1SA 5BUCA 1QRTA 4FFRA 4JYAB 2QW8A 5JVDB 1HLPA 3LP6A 1AQLA 2XQJA 4PPYA 3WL8A 3NHLA 4UDOA 3OE4A 3QMMA 3B1FA 3EVOA 1NY5A 3Q5DA 1HWJA 4KZKA 2ZI3A 3ABSB 1ZFNA 1TF7A 2YNMC 3GXBA 3HYSA 5I9BA 2H4ZA 4O08A 2BFBA 1OZHA 3HXQA 4LOAA 4W6ZA 1NQAO 3F7OA 3HUTA 4IDDA 3GUHA 3SXJA 2ACMA 3OTHA 1LB1B 5KSWB 1K5GA 1R3DA 3GJTB 2OV6A 3JRWA 3AUFA 3C6TB 5FJIA 5BWMA 1G8KA 1VHLA 10MHA 3LAWA 1FS6A 1G3OA 1BDMA 1DL5A 2K4MA 1T1GA 2IZOA 1LDNA 1I33A 4ENVA 2EG1A 1JN0A 2NOAA 3AYXB 3L79A 4DN6A 3CD0A 2ZYDA 3TVKA 2VZ8A 1AS3A 1KYWA 4TRRA 5DHTA 4A6XA 1G0NA 1CUBA 5B0BA 4W5NA 3NC1C 1E94E 3MECA 4L8VA 4OO3A 2MJLA 4IJWA 4MQFB 8ATCB 1VL2A 4DHVA 2O3RA 3D31A 3UCGA 2YZ7A 3KNAA 4GZMA 2BCGY 3VSEA 2VTKA 1JF8A 3TA0A 4Y6LA 3AHJA 4ZCKA 3RRYA 4QJIA 3WXMA 3DMTC 2WKRA 4CLDA 4ZT3A 3P2KA 3FA2A 2WICA 3ECCA 2O0JA 3F6CA 4P7GA 2Q3LA 3UI3A 1VRWA 5KCMA 1RRKA 3I30X 3V5NA 3WIEA 3PV8A 3NUZA 2WD9A 3TLCA 3CFYA 1CJVB 1ULSA 1BE6A 3RD5A 1YASA 3RJZA 2JATA 3PC8A 4DR3J 3MMJA 2QUIA 2IVFA 1KJYA 2VB6A 1VE3A 4QYWA 4BNWA 1R0XA 2ENUA 2VU5A 2P3OA 821PA 5HJYA 1RTZA 4A3SA 3IAS1 2R47A 4DBZA 4GSYA 4IUDS 3IOCA 1T4GA 4H6VA 2ES4A 1P61B 3MM7A 4R5PB 1Q8BA 4WIQA 2QQEA 3LKBA 1WXXA 1LKZA 1NFFA 1ODTC 1TQLA 3GP8A 2DFPA 4MB2A 4RKRA 4YUDA 1L3IA 2IPOA 1R0ZA 2BMEA 4Q37A 4RZUA 5EJ4A 4DSOA 4KQMA 4BE9A 4DLVA 3TRGA 1VHJA 4BFWA 3OT1A 3KQKA 3SR0A 4B81A 2JEIA 2DCUB 2XIQA 2WMDA 3AI1A 2CKDA 4ZQBA 2O5VA 4XUGB 2VF5X 2FSPA 3L7BA 1PR3A 3HGMA 1LH0A 2AOTB 1K5PA 4BYMA 4Y1RB 2J7WA 2DYAA 2R8XA 1N4DA 4X94A 1R4ZA 3THTA 2HSEB 1XO1A 2C04A 3MCSA 3RBXA 1Y6GA 5ICFA 2AQKA 2G7ZA 3V6DA 4WHMA 2Z8YM 1FRKA 4P0TA 1AYEA 4OHUA 4L50A 3SZGA 1LXCA 3HSJA 3DLGA 4CM7A 2Y1RI 4E08A 1PT5A 2B4TO 4MTCA 1RR6A 4AIRA 4E2FA 2OD6A 4HR7A 1FS5A 3FAKA 2GEUA 4PIVA 1Z34A 3S7ZA 3CB2A 4GH5A 1JG1A 4E3ZA 4CL2A 4ITVA 3FWYA 1PYOB 3CZMA 5HMZA 4AF7A 3JAWB 3FKBA 5ALIA 3TH5A 3CD5A 2O2IA 1ML4A 4B7XA 4IG3B 2FHSA 4LSGA 5MFPA 4QW8A 4C3LA 3GCWA 4ESVA 2XYGB 5KCZA 1ZD2P 4Z4IA 4B3RB 2HYIC 2AYBA 3RJMB 4TOIA 3DZGA 3BH7B 3FYDA 1URPA 3Q7TA 2KS6A 4AKSA 4DWWA 3OUYA 2P5SA 1PAEX 2YVSA 1FVOA 4QFDA 3I9V9 3QVMA 2O66A 3QNWB 3RG6A 5EHXA 4JI5B 3ZE7A 1EVKA 2YKMB 4WASA 4HYQA 4MS1A 1E3TA 1XMXA 4ROSA 5CQGA 5IT5A 4X20A 3EG9B 1Q8IA 3V8PA 4N6GA 1RAGB 1FTYA 1WSWA 5HDQA 4M5DA 2X8JB 3JALA 1Z0ZA 1W85A 3MRSA 3SBDA 1Y63A 3AH6A 1MH9A 3K05A 2J3MA 1WOMA 5HUQA 4QXQA 1C0EA 1ZOSA 3DEJA 1ISGA 3LC7O 4FMDB 2YHBA 4FX5A 2GRAA 5HS4A 5FOQA 2VONA 1LNQA 1HQUA 4FZRA 3PG9A 3UMRA 3NM4A 4O2BF 3AT1B 1AQYA 2PD1A 1J0AA 2BFMA 4R54A 2WWFA 2E85A 3ELUA 4P80A 2PWPA 3D9QX 5JI2E 1X1RA 4MK7A 1WU7A 4AJ1A 1R8QA 4LF8J 1QLWA 1R6AA 3NXZA 1ECGA 1B1CA 3GGGA 1U1RA 2ZSHA 4FGKA 3QYAA 3K1YA 2XGMA 2R7QA 1UPCA 4DV5F 1P8JA 3V8VA 1FFBA 3BR9A 4F3RA 4HNRA 4Z1OA 1K73T 4LDPA 1PG5B 3W8FA 3JVEA 2CPJA 3A1SA 3WQHA 3TZZA 3MEEA 2D1QA 1KBOA 2HLTA 4AN0A 1EFPB 4DR7B 1WHSA 4LSNA 5IKOA 3PUYA 2E7XA 4HZUA 4KWEA 4TLDA 4DFKA 1X77A 4M1MA 4MEAA 1SBZA 4WXYB 5JSYA 2EHJA 2OPBA 1O5OA 3QVWA 4BMSA 1VGQA 4F84A 2F64A 2CPFA 3R3HA 1HORA 1GTZA 3OA2A 2NZ2A 3DHWC 1A8UA 2AK3A 3EZGA 3KUDA 4FW9A 3BBBA 4QA9A 3NTUA 2O2SA 3ZNUA 1EQ0A 3MVEA 1UVNA 4LQLA 2XSJA 2EARA 3LZCA 3VYTB 2P5UA 5K5EA 2G88A 1H65A 4JI6F 3HM9A 1ODCA 4EEZA 4P2BA 3I87A 5GJWC 1T9AA 3T9FA 2CNLA 2JJYA 4HDHA 3IDAA 2BEWB 2VJBA 3NTVA 3MR6A 2OZPA 1ZGHA 2BMAA 1AN9A 3R0IA 4PZ0A 1FX0B 4MJXA 1U28A 4C7XA 4F50A 5IMSA 2JFHA 1VPEA 3WL3A 2H5EA 1NZ8A 4Y6GB 1IPFA 2XOEA 1E3EA 3KYBA 1THTA 1WB4A 2LRHA 1J27A 3MFQA 3QIVA 2H59A 1DEKA 2GASA 2LECA 2YV4A 1NP7A 5KQPA 1T8EA 2WAQD 2H9IA 1S57A 1UFVA 3BE5A 1CNEA 5TQ0B 4QD3A 2I5JB 2RIPA 4S1VA 1OT3A 3DGVA 1I1QB 1BC5A 5B0GA 5IYZA 2QV6A 2WLTA 2DCMA 2PJDA 1I9GA 2BFWA 1JLSA 1NAQA 3AHPA 2VQFJ 2V7GA 5DISB 4OSPA 1IEVA 4DA0A 2MMCA 4IJ5A 4QCLA 1XKXA 1B43A 3WV5A 3M6VA 3OIGA 2UZIR 1SCDA 1GAJA 4TGLA 3K0FB 4ZT2A 3F74A 3K1JA 2KJWA 1L7EA 4IH7A 3X1LB 2PO5A 3KLEA 4CQMB 5C1PA 1WDKA 4PZYA 1ZHFA 1ECPA 2G1UA 1HV8A 3OOJA 3OM1A 2QL7B 2Z58B 5J3JA 3AX6A 4XGIA 2NUAA 4L16A 5DGTA 3U4DA 3DHYA 4C4SA 4ECXA 3PIDA 3H3XA 1FE8A 1KETA 4FI3F 4QAQA 1YG0A 1WEHA 4KLZA 3TTWA 3VR5A 5JUWA 4UW2A 1EZZA 1P7CA 2KHZA 1BUXA 4LYGA 5CUQA 3RRJA 1KAGA 1W8DA 1J97A 2XPCA 1F4VA 5F8LA 4LNAA 1OF1A 1S8NA 3P26A 4LJRA 5KFMA 4E11A 2ESRA 3OFSA 4HQKA 4ZZ0A 4XI9A 3I9FA 3DJFA 1JZQA 2CW5A 3J7AN 3FB1A 4TYBA 3EUNA 2K2WA 3NHJA 4RYLA 1DTEA 3BERA 4UBIA 4CP5A 2BE7D 1RU3A 4LNUA 1KIMA 3K30A 4YV2A 1NA5A 1VSBA 2QVYX 4KE6A 3C3YA 3TKLA 5YASA 1ZYQA 3U44A 4MPTA 3GMTA 1N6IA 3BM5A 4JSYA 4YAIA 1A5TA 3SC2A 3LUYA 2PCJA 2O05A 2IEAA 4F3TA 3PPVA 1EJ7L 4MQ6A 4OEHA 4I4TA 3FCUB 3L82B 1LLFA 1DHTA 3NBYC 3FOZA 1MRSA 1U6IA 2CY0A 2I1QA 1NPRA 1SOWA 4BECA 4AECA 2ZZNA 1WC3A 1ZAVA 2WIAA 4D8WA 1M8PA 2XNHA 2J3JA 4OUDA 3IEPA 3IBYA 4FDVA 3H0CA 2JCSA 3CW8X 3TPCA 4YOEA 4EHAA 2PT7A 2VBZA 1PVOA 2QAJA 3GIKA 4OHWA 2YW2A 1QE1A 2AD5A 4Y34A 4ECRA 1ENZA 3R97A 2FP4B 4EHLA 4V39A 1JA1A 3D6HA 5EEGA 4Q66C 3V8BA 4BXOB 2B7BA 3CNLA 2YH0A 5DLQC 2QMZA 2VHEA 3THWA 1LVUA 1U3VA 2NU6A 1ZMXA 2ZIFA 1GAOA 3AVWA 4NXMJ 1NE7A 3ETNA 5FLKA 3KRTA 2AHOB 1XZJA 1SJ9A 4FFVA 3BPSP 1AVTA 1VTKA 3ELHA 3C14B 3W7BA 1TYBE 2I71A 5EQJB 5DRYA 1R50A 2FJBB 4QUAA 4ZK2A 3HVTA 3DE1X 4P3NA 3KK3A 1RXIA 4F2GA 5K3OA 1AKMA 1PI3A 4LHEA 3RVOA 4DV6J 4RE5A 4B7ZA 1YJVA 1N2CE 2RB5A 4OLOA 3LSYA 1FKPA 1F7UA 2D7SA 1EUZA 2AKEA 3THYB 1R4MB 4P54A 1JFRA 1GPNA 3AESB 2A1IA 4NH4A 4EB3A 1TRHA 1NNUA 4HH0A 4MWGA 4DXHA 3ZHUA 2KB0A 3CCLS 2UZ3A 1R3UA 5JROA 1W88B 4YRFA 5BUQA 3GTYX 1KVSA 2VDJA 1T26A 1JLBB 4HNAB 4DUYJ 4QWBA 1OAOC 1UBCA 3B54A 5BQ5A 2OBYA 5EJEA 1YI2S 1TM7E 1UBEA 1P2DA 1IZYA 4X65F 1RWVA 1TC2A 5DHRA 1KQPA 2C77A 5LFAA 1CUAA 4J0KA 4FVCA 1TUGA 3C8UA 3QO9B 1JWWA 3BE8A 4X60A 3SXUB 2V8HA 3QVGA 1W73A 3NTXA 3M1IA 2BUBA 2I3BA 4RNMA 3MS4A 3D8UA 3QBDA 1RT6A 3FWHA 4CIOA 2MZ1A 4ID5A 3L07A 1X2EA 2MQ8A 2VJNA 3H9UA 1PTJA 2V6GA 4KLRA 1ZPVA 3UIEA 2W6JD 1ULBA 2K7KA 4F4WA 4F02A 1WKJA 2VA3A 4B9SA 3P49B 1M2VA 4DG5A 4PRLA 3Q7RA 3AD9C 1C81A 1C7EA 4XH9B 4B2PA 1XAHA 2PJZA 1PW7A 4ZCQA 4QUEA 4DIDA 4RMIA 4OKNA 4YRSA 1V6AA 3K0KA 2WIBA 1UEKA 4DLRA 2HX1A 2V50A 2XT9A 4ZLJA 3TEJA 5K14B 4C78A 2QROA 2EKBA 3LJKA 5EERA 1SUPA 2ZBEA 1AB8A 5IDXA 5KOWA 5IAOA 2W2MP 4EGLA 2W4CA 3OMLA 2BEUA 4RZSA 4DV0J 2IP1A 4OHBA 1Z5NA 4GM1A 2F3RA 2RARA 3ZGYA 5B30A 2ZJ7A 1Z6ZA 4ZOAA 6YASA 5K4HA 1PL0A 1OIAA 2IT1A 4QYIB 4ZCLA 1L7XA 4DQQA 5BYSA 4ENUA 3OCWA 4NL5A 3AD8C 3WHKA 3FJ1A 2PKCA 5DEOA 4DSJA 4PQEA 3AF5A 3STWA 4PUOA 5HSGA 1FRZA 3GFBA 2JPDA 1TQ2A 5DBEX 3R5SA 2VFAA 3IQXA 4E4TA 2Z5LA 4OZ1A 3T3NA 1JMYA 3R9IA 1R0RE 4DX5A 5FJ4A 3NIBA 1IBLB 2RRNA 3FDJA 2GJSA 1RXOB 4ZT4A 4TTQA 4O3OA 5JVGQ 2RGBA 1XCBA 3GE9A 1ORDA 2MSTA 2QYHA 3PYLA 2O3TA 1GITA 4FYXA 3W7VA 5A02A 2C5BA 2BOPA 4NLXA 2PT6A 1A7AA 1R0AB 4P92A 5JVDA 4JUIA 2XMTA 1FNMA 3F4BA 4Q0BB 3WIOA 2ATVA 3FYUC 3TL6A 4L3OA 4ME6A 4I55B 4BB6A 5DM4A 2M6RA 2OO5C 2JZ5A 3CCSS 5E4JA 1X92A 2TS1A 4RWWA 4E15A 4HGRA 4UXJA 4TWBA 2OORC 3WNVA 2QN9A 4B5LA 3G8SA 4PYOA 2CVFA 5BN5B 2LQ5A 3IODA 5CA0B 3FZEA 1F6TA 2G40A 2PUDA 1UJ5A 1V43A 1SD5A 6FDRA 5EXPA 3ZKWB 1HMYA 3GJTA 4KE9A 3N4WA 1X7ZB 4MYDA 3C6TA 4CDNA 4ZCMA 3MMXA 4CV0A 2NLWA 2XCQA 4A8PA 2J8SA 2SKCA 3SFZA 1FJEB 3U7RA 3CNQP 2RJ3A 5GVSA 4OM8A 1HRKA 3D7KA 2PH7A 2G0CA 2QU7A 4ARSA 1EVYA 4PHFA 1XCPA 1B8VA 4WGGA 1F6WA 4XGQA 3SPXA 3FDXA 1QNLA 1U3WA 2W70A 2P2SA 1UAWA 3PHEA 5DM0A 1BEZA 1NW9B 4W9MC 3ZZ0A 8ATCA 1RXWA 4JB2A 3IILA 3IAUA 1UODA 2WG2A 3B9PA 3HFRA 3F46A 4J6EA 3ZZZA 1BWEA 1PUXA 3FB4A 1XLWA 5K20B 4RGQA 5G1OA 1NURA 4AFNA 4FXOA 3GZ7A 1SC3B 1C4AA 2QD2A 4A23A 1WXGA 4B3IA 2PA3A 1KDTA 4ITUA 2FC8A 2OELA 3UN1A 1T34A 1AGRA 1BQNB 1PF7E 3NCTA 2FUG1 4QG3A 1GVNB 1H73A 1EFRD 4G4SP 1DDGA 2G06A 4KU4A 4XWKA 1CF2O 2FSHA 1CJVA 2ZWVA 1S9GB 4TUYB 2HMIB 2OOSA 1Y48E 2C2BA 1I1HA 4M88A 1FVQA 2HGNA 1BLUA 4YUAA 2O3QA 3BGLA 4EVRA 1OYDA 1DKMA 1Z0SA 3K8YA 3BWBA 4AX8A 4FF4A 3TQFA 5JE8A 2CD7A 1S97A 1JKIA 5B4TA 4NA2A 2FI1A 4EPTA 2VYQA 1HZZA 4WCDA 4XJVA 3EULA 4DV2F 4DCJB 1CP3A 4RTQA 1MMNA 3N28A 1Z33A 5L46A 4WFQA 3H5YA 2DPMA 3IOYA 4Y9DA 3WMWA 2GZSA 1IPHA 3AF2A 3NHYA 5D4LA 4V2UA 4CDIA 5B1DA 4R0VA 3CIZA 5DLGA 2DCUA 3AVPA 1ADFA 3B6KA 4BRWA 3RS7A 1KYTA 3ERCA 4QEZA 3AYZB 5IZHA 2P3SA 1HKAA 1FQJA 2AOTA 1CQWA 2WWIA 3X1MA 2ZW9A 4Y1RA 1H2XA 4V0KA 3ZWVA 4CR8A 4XARA 3B85A 1URNA 2HSEA 3MHYA 1VBFA 1JP7A 1SZDA 4UQGA 4HRYA 3TRJA 3D8SA 2REQB 5F5NA 1G3MA 2A5JA 4QECA 3BJIC 4DC1A 3O7MA 5IN5A 1GKLA 1RNLA 4QYSA 4USWA 4F8RA 4LOLA 4B34A 4G36A 2WBMA 4C7VA 4W8HA 2OG1A 5CT4A 2R79A 4PG6A 1WMSA 2OILA 5HM8A 4R9RA 3UWOA 4BVBA 1MD9A 1NVVQ 1GGVA 1PYOA 3WKCA 5J2UF 3JAWA 3BJEA 4EECA 2P4QA 4IG3A 5DYGA 2QRGA 3H6HA 2XYGA 5B0EA 4FB5A 3QVSA 4I9NA 3BRQA 4PFKA 3VX3A 3H20A 2ZYVX 4G8JA 3AHDA 2RHDA 3RJMA 4OV6B 4WCFA 3QJGA 2XB6A 2HREA 1NSTA 3BH7A 1ZM3A 3GJ7A 1EFLA 3MW8A 3W61A 2FUEA 4BDTA 1ZJZA 1DI0A 3QNWA 4R2MA 5T41A 2YKMA 1D8AA 2RH4A 4LR8A 1G63A 2NZVG 3LRPA 3EG9A 5DN6D 3QLEA 5CFOA 1RAGA 5FLXU 3OZUA 4EKNB 1Y5MA 1OFVA 5HMYA 4N5SA 5CNKA 2BE7A 4LEIA 1UBSB 2KDOA 2X8JA 4PSKA 2Z3VA 1WY5A 4IUBS 3K92A 5I8ZA 2OGSA 1GU7A 3H2YA 3JD3A 4UVDA 4KVZA 2IHR1 1P2FA 3V46A 2OB2A 3QSYB 4FFWA 4KACA 1FFEA 3KAQA 2PZGA 2ZBFA 4Y7DA 2GEFA 3TKYA 3GUCA 3HL4A 3AT1A 4DR5F 2CHUA 2YC4C 2ZKIA 5AI9A 3ZTSA 4B7CA 1QLJA 5M2PA 1FTRA 2CJQA 1FTSA 3EW9A 1VJ0A 1SC1A 3BMNB 1LOUA 2FZEA 3AL2A 2ON6A 4JR0A 1X0FA 1G6BA 1LRLA 5C25B 1K98A 2P9QA 3VM6A 1T9CA 3RTAA 4UCQA 1UFKA 2Y6VA 3F2IA 1U8WA 1XU7A 2O1WA 1CUGA 2P9YA 1E2EA 1AZWA 1SUSA 1PG5A 1TM1E 3U3DA 2VA2A 4D9NA 3WK8A 3J81j 4E1AA 4LHXA 2ZJPQ 2VPYA 3LSTA 2EKQA 4UU8A 1EFPA 4A8XA 2BKEA 1YFKA 5JSQA 4O3FA 1F14A 5AQ1A 5FQNA 2EG2A 4Q82A 5I4BA 1C1HA 3MUMP 1PWYE 3M8RA 3TCXB 2REXB 5G0VA 3CZAA 2CXSA 2RI1A 1OYWA 2D5AA 3OQIB 1WUYA 4WINA 2J9XB 2ASLA 2X9NA 4O4GB 2BBOA 3P9NA 4N77A 5E2IA 4RU9A 3QWIA 3ZE8A 4NEGA 4DSNA 5KHAA 2R6AA 3GJ5A 1BEEA 3HZEA 4X3PA 5BUSA 4HN2A 2ZT6A 4NNOA 3X2FA 3IPXA 2W2QA 4MV7A 4OJMX 2KJQA 2AH5A 1CB0A 3F3KA 4XTRA 5BOSB 1BS1A 1DBQA 3HF5A 2R7WA 4ZVPB 2HRCA 4P33A 1U3UA 2HV8A 2JAOA 4PQRA 1LDEA 3NNAA 2BEWA 3ESZA 4NYMQ 3B5EA 3NHBA 1RDFA 5EHHA 5JD4A 3L0ZA 2GHPA 1CJMA 1FX0A 3TXXA 2P5VA 1V48A 1PD1A 3CW2C 5EWEA 5JNLA 4EEKA 4E6PA 2DGXA 3URMA 1LLCA 1WEYA 2PYIA 1U2TA 1S3GA 5DHQA 1SA0B 3QPBA 1V3VA 3MCUA 1IL0A 2P65A 1S72S 1B6GA 1WDLA 1IMOA 1QY7A 2C5EA 2ZTHA 3U9SA 1T1JA 5GV7A 1N57A 2QAIA 3FSIA 4IIHA 2G83A 5ERXA 5TQ0A 2BW0A 2EJTA 2I5JA 4PZVA 2N47A 1VG8A 3BFXA 2ZYWX 3RUPA 2FVRA 3Q3EA 3ZS8A 4UTXA 3FFTA 4J0GA 3VNSA 1QHYA 2LXFA 3FNGA 1N36J 4DSAA 5L9XA 2V7TA 3RPEA 4RY8A 4YMGA 4HNHA 5HW0A 2NTEA 3W5VA 1M8GA 3T3HA 3CNEA 4H7DA 4O1HA 1U9IC 1J5EJ 4FGWA 3CW9A 2W6JA 5GGYA 4NBNA 1E5TA 3VKWA 1NATA 1Z4NA 1W2GA 3K0FA 3KKFA 3BCSA 4PPQA 3O92A 1EP9A 2Q0QA 4HWRA 3NJRA 1OPRA 2LGJA 3T5DA 1WETA 1MG7A 3DE7X 5HKKD 2QL7A 2Z58A 4DV4B 4PZZA 1B7YB 1KMHB 1N33J 1TQ4A 3CUKA 4Q4JB 2ZQ5A 4JX8A 3GFRA 3N76A 3DBVO 1K8XB 2A7QA 1S1TB 4KLCA 3ZHZA 2CZVC 4C7KA 3T5CA 3DGPB 4Q3NA 3QOWA 1UH5A 1FYXA 3N2YA 4IRUB 1E2MA 2PMCA 3DLGB 3NATA 1Z62A 4MHOA 5JNVA 4WYLA 2I67A 3N2IA 3OECA 1J99A 3BJZA 2KLBA 3DNFA 4EKIA 4GOLD 3U1MA 4CMKA 1J06A 1YIDA 4EJ2A 1PK7A 3QVTA 5D86A 4PRYA 2XB9A 2YQ5A 1BCSB 4MCHA 4WKBA 1Z4UA 4X5OA 4MK4A 4G25A 3O8CA 4MJLA 2VA8A 3ENNA 3CO5A 1WUHS 4C2UA 1ZJWA 2PX6A 4XIYA 4G1VA 3ZU3A 4BWFB 4K26A 4HPXB 1R5JA 5ECGC 4JZKA 2LWIA 2JNWA 4G4GA 4TTVA 4B3FX 1TYZA 2Q2WA 2IM1A 1LVGA 1PLJA 2DHQA 2KXFA 3DZCA 4AMVA 3VC1A 4PO1A 4EYKA 2QE5A 2V8OA 1GP2A 3FCSB 2ZH3A 3H8VA 1L7RA 1UDRA 4AAYA 1G42A 4MV5A 3IO5A 2R00C 1A8IA 2WKWA 4V0OA 4CHTA 2CQBA 1W87A 4F45A 3ET4A 3L92A 2W93A 5FFNA 4M5DB 3FH0A 3TYTA 1A97A 1W85B 4FR0A 2JFNA 2Q5HA 4QUJA 5BSTA 4F9EA 4QYXA 4MRMB 4XYGA 1TP7A 4ZPWR 3CO0P 3AA8A 1AUPA 4PNHA 4K1XA 4P32A 1JKFA 1O6CA 3OO0A 1UPPA 1AKNA 4XDHA 1CY6A 5KOHB 1Z8FA 2Z4PA 1P91A 1YQWA 4KV8B 1VLQA 4ZHRB 5G2OA 1U6KA 2P75A 2CXQA 3D2WA 2H8KA 4EL5A 5FA5A 4EFMA 4BXOA 3C5CA 2ONZA 3EA0A 1DKOA 2IYZA 1WMBA 5F1YA 4YJGB 3T4EA 2IOFA 4XGRA 3SJUA 3LWDA 3ADDA 1M1UA 5LP6C 5A06A 1EJ2A 1ZC3A 4WKRA 1M2NA 4BC7A 3SF8B 2NZJA 2G9OA 1PILA 5ERYA 1XMIA 1YQTA 5CYGA 3R76A 1HBNB 3C14A 4QKQA 1XNQJ 3IUNA 3QYFA 4BC0A 2GBPA 3NT4A 4QJ3A 3BK7A 1I3LA 1K86A 3MMNA 4CM2A 2V7WA 3MEEB 2X23A 3A58B 1H72C 2W6OA 5JPIA 1K0VA 1KJZA 2XVYA 4LSNB 4FGSA 5AVVA 2ZI6A 3MXTA 3QFRA 2EWWA 2WOJA 3T38A 5B0AA 1KD1T 4KOAA 3KLGA 3DFKA 8GPBA 1W9HA 4L08A 3TOSA 1ZXLA 3D4IA 1E7WA 1WY7A 3THYA 4YP0A 1R4MA 4I2NA 2GH1A 1UJ2A 3AESA 3ZCXA 2HHLA 2C8JA 2WA2A 1QRSA 3VI3B 1RACB 2CZQA 4NARA 3OFKA 3TINA 3PHLA 1EFRA 4MQ4A 4RTSA 1LDMA 2XUOA 1W88A 3JQBC 4MKGA 1B7FA 2F8EX 3M7VA 1MEJA 2W6IA 3WMRA 1JLBA 2JD2A 4HNAA 3OLVA 1RQPA 1TDJA 4B2IA 1HLDA 3VJRA 2C9YA 2XSJB 2ODWA 2QQ5A 3GFZA 2YZGA 1FUUA 4TM8A 2EVWX 4J90A 2JNJA 4I6WA 1FK9A 1B16A 2NO7A 3D4LA 4ED6A 4PPDA 3JX9A 1E9BA 2BP7B 3KFWX 1K7YA 3QO9A 2CNKB 1NF2A 3SXUA 3PL1A 4IYQA 2QSYA 3ZBQA 2ZJFA 4MPPA 4FFSA 2FA9A 4MULA 2VYVD 2G63A 4HLNA 4MCIA 1RWWB 1E7YA 1EVZA 3W2VB 3P0HA 4RH0A 3SYZA 1FU7A 4CR7A 3A3OA 5CLLA 2DT8A 1VQ9S 1E62A 5E6UB 1ZPDA 3KC2A 3AU9A 2EFCB 4DMZA 2DF8A 4IG0B 1CZKA 2M5YA 3BR8A 3LBFA 1SK8A 2DB1A 1I7SB 3CVVA 1ZZFA 2C8LA 3N3BC 3ZY2A 1PGJA 5SYMA 2B99A 3NBMA 4JJEA 4BIIA 5IZCC 3L6BA 3H5OA 5LYJB 5K14A 3DAYA 3AF4A 2XCSB 1Q57A 2HRQA 4DL0C 4G9BA 4C4WA 3VALA 2CZ9A 1OWMA 3SYTA 2NT4A 2QRHA 2ZUDA 2CKWA 3I1FA 3A6FA 2B1IA 3V4VB 2VXBA 3VI4B 3CISA 2FGOA 3JQ9C 1CQZA 1YVFA 3F71A 4QYIA 3KLEB 4ZJOA 2FPSA 4ALLA 5IASA 2QIOA 3U26A 4YP7A 3OQ2A 3GJZA 1GXUA 3NAIA 2WKPA 4C05A 1ZS9A 2YN0A 2O0KA 3BZWA 2FOIA 4LXXA 4BNGA 3EXFB 1O03A 1YJCA 2DRIA 3I0MA 4DLNA 1B3RA 2F4FA 2GX8A 4LFCJ 7MDHA 2BMJA 1A9NB 5KAKA 3MAJA 1E5LA 5IKPA 5IW8A 2FG5A 5FBLB 1Q91A 4JXZA 4WEOA 1Y6QA 3GNTA 1WNEA 4B8WA 5AXNA 1MB2A 2UVPB 2H5LA 3FTEA 1R0AA 3L7UA 4B02A 3NLLA 1U0SA 5HE9A 2H3EB 4G63A 5F8NA 2XM3A 5J2QB 1YCHA 4PYAA 3K9GA 4Q0BA 3CV3A 2ZJ1A 1ZVQA 2DY0A 4I55A 4IGEA 4KQCA 5DN6A 3H5AA 1JE1A 1PT9A 4ZVNA 2GPAA 1J56A 4DNFA 1ZGJA 1IATA 3OZBA 3CLTC 5BN5A 4RMGA 5CA0A 2C7GA 1QYCA 3KUGA 5TNXA 2W7AA 3ZKWA 4C6RA 2XJ9A 3S2UA 4POAA 2GVZB 1EKSA 1X7ZA 4M4SA 4CF6A 3DFEA 5F5XA 5T5QA 4KQIA 1WB9A 2HDHA 2HW3A 3EC2A 1D2EA 3U4MA 3WZMA 2ISQA 2OMEA 3VISA 3J7A1 2QR5A 3T6BA 3ZK9A 4YT2A 4TKUB 1IJFB 3K9LA 1Q82T 5LMNF 4KX3A 3QXCA 5CB8A 5ECWA 2J6IA 3U7JA 2D2EA 4KWCA 2A9FA 1O6FA 1PAUB 1QPBA 5B08A 5DBHX 2FJWA 1G0OA 4RULA 1WTAA 3Q0IA 4V0LA 5I7AA 4GPIB 1GARA 1ZM7A 3PA8A 4K5RA 1SC9A 2G70A 3IFSA 4J0FA 4Y6SA 1XWIA 1NVTA 2QVZX 2OFWA 1W5SA 3SE7A 1GPDG 4EHJA 1QKJA 5K20A 1CRZA 2NLOA 1SC3A 3L8ZA 2HHCA 1N2HA 3B6IA 3CZPA 2KE5A 3PXEA 4B48A 2HRYA 3O2IA 1YBHA 4L3VA 3CX8A 2QP3A 1A9XB 2OT3B 5A5FA 5F8JA 4UE6A 1K06A 2ETXA 1JNZB 2F1RA 3ZU2A 3BIXA 3QBEA 5EP4A 1GAQA 1XOIA 2Q2VA 1XXLA 2PX5A 1WF3A 2GJAA 4F3MA 2WD7B 2APOA 1IM5A 1S9GA 4TUYA 3AM1A 4NI2B 1N2CB 2HMIA 3G86A 5HP4A 4N9WA 5CXQA 4DCPB 4HGYA 1ZVVA 2V0GA 3K9QO 2GM4A 1MPTA 3BQ0A 2ZUSA 4CH0S 5HUJA 2DGVA 1Y6ZA 5D2CA 1DRKA 1JR6A 3LNTA 3VPXA 4AXIA 1RLJA 3G23A 1Q7BA 1IN4A 4ZPCA 5HGXA 2XB4A 2NPFA 5JR3A 4B71A 3NAHA 1YZVA 4PONA 2YASA 5A71A 3WGVA 1Y33E 1HNWJ 4DCJA 1O7JA 1T0PA 2OHFA 2Z2YB 3UATA 4KBFA 3TRKA 1XXHE 3DU6A 3HUUA 5C52B 1PR2A 4FBMA 2RJNA 2ZU0C 4MIKA 4JP8A 3WFJA 1LGYA 3QX9A 5CPBA 1BVHA 2XF8A 5J1EB 1C9NA 3N8GA 1Q84A 1CIPA 5B2FA 4I1RA 2BMDA 4QHYA 4RESA 4FEAA 5D0GA 2AJ1A 3QY0A 3RBDA 4ER6A 4ZVSB 2AZDA 3HR8A 2C5AA 2WHOA 4H7IA 4AUKA 4INOA 3IBFB 4N3AA 5CCBA 4NLOA 2HJWA 4Z7YA 2CXHA 3OIDA 1L8AA 4BQPA 2YXNA 3U3MA 1VLZA 4GXRA 2Q43A 1N5SA 1CCWA 3VRHA 1JZSA 3C3CA 2IYIA 2REQA 3COVA 3NWOA 4CO2A 3S68A 4XZ3A 4DDWA 2BY4A 1OBFO 2FG7C 4PO3X 2HA6A 1G3QA 2DGQA 1PDWA 3HHLC 2A33A 4EF6A 4OQQA 2CJXB 1HBOB 1EX9A 3CINA 2DHGA 4PFQA 4HVTA 2QZPA 2RD5C 3H59A 2ZB2A 2OFHX 2JLQA 3GCXP 3DZIA 4FHEA 3FMFA 2MOKA 3BKFA 2HJGA 1JIVA 5CD4A 4CTKA 5C32A 4LE0A 3DLBA 1PR0A 5HKKA 3RANA 1YDHA 2CL7X 4X6LA 2GJ8A 4X64J 1L5OA 2WTUA 4PNPA 3FMBA 2JRCA 2O54A 1NGSA 4KH1B 1CUEA 1T5OA 1ZQ9A 1U1LA 3H5SA 1R6BX 2MKYA 2HQRA 4Q5IA 1MF7A 2QLMA 2YRWA 3PW2A 5K0JA 1U11A 2PFDA 4Y2KA 2C94A 3LOUA 2X9LA 2HIQA 2HCRA 2OHOA 3UFBA 1ZN8A 4X62F 1MC1A 1E6UA 1EGAA 2QMHA 4E22A 3DLEB 5B58T 4RTKA 4MUIA 1S2LA 4FOSA 3I6YA 3Q85A 5FLXY 4OJHA 2GETA 2Y0BB 1LLUA 1QO7A 3A1YG 4DAEA 1O54A 3VKVA 4QJ5A 3KEFA 1T9UA 5LU8A 3I64A 1T9GR 3LPYA 1NVBA 3VGUA 1C1YA 1XU4A 2B4QA 2VTVA 4MAMA 3BRCA 3QEKA 8OHMA 1B76A 4IQFA 1P62B 4EPXA 1FFHA 2B7LA 1G3UA 5FP0A 4A26A 3UA4A 2F48A 4ZVOA 2PD3A 3VHRA 3U7QA 3X3UA 2Q46A 4B3XA 1C1BB 1MJGA 2Q50A 3MOGA 3Q3JB 1Y10A 3QSYA 1J0XO 4OIFA 5ALQA 1YR8A 1TTTA 3OHSX 4LZZA 3G8AA 3KDOA 4X4NA 3D8HA 1LSUA 4CTMA 2I91A 4NK4A 1GUBA 5TR9A 2DXIA 5F98A 4Y6RA 3BMNA 3KPYA 2WONB 5EGNA 5C25A 3SHQA 2ABWA 3C1TA 2VAPA 5FUWA 4ZGGA 5JXGA 2PV0A 4RWZA 1YZUA 1V6SA 2CXPA 2DH6A 3A9RA 4HXYA 4U7CA 1QGDA 2VTDA 5KFEA 3NMAA 3UPDA 2VWHA 5F3WB 4JV5B 4U7UK 4WZAB 3BZUA 1JNRB 1A72A 3I55S 4L4RA 4CV1A 2B4UA 4N41A 1DJQA 1QPGA 4LTNA 1ECLA 4I4BA 3FDIA 4QEKA 3E2PA 4EGJA 3GV7B 4AMUA 3F1LA 1ZMOA 4JLVA 1QYVA 1YCGA 1KP2A 5KFYA 3OQIA 2MTBA 3QVUA 3G5AA 5UKDA 1C4OA 1G5PA 2DBQA 2O48X 1EWKA 2OPRB 4N12A 1Q7LB 4O4GA 4C20A 2WJPA 3AM4A 2D0DA 1NH8A 1Q3HA 4M0UA 5DGBA 4TLEA 1KYYA 2AE2A 4CO1A 2X4DA 4IVNA 1SBTA 4ZPBA 5LT5A 5FBHA 2Q45A 5EX3A 4IDQA 4FSDA 1Q15A 2CQIA 2ZWAA 3VR4D 2VATA 4BV8A 3C15B 1GFIA 3GT7A 3PFFA 5BOSA 2V2KA 3NT2A 1VK3A 4FS2A 3TFQA 4ZVPA 4L8WB 3WVNA 4F5YA 1K1EA 4HFMA 3IHWA 5C8YF 2FDRA 4BO5A 3G4SS 4D5GA 4B2YA 1PFWA 4A4DA 4EJ6A 1SG9A 1RYBA 4H0NA 1TCCA 1DC5A 3HVRA 4LZOA 1P80A 4DV1B 3WKEA 2HVEA 5M2QA 1SA0A 3ZDXB 5JEEA 1AZSC 2J9FB 1TMYA 1U2GA 4BUZA 2UZ0A 5CH7B 1TMMA 4EI7A 1ZIDA 2CJAA 1RT7B 4DV7J 5CCDA 4UVIA 1L4KA 1AX9A 2I8LA 2P1ZA 1JLHA 4JZYA 1RJ9B 4E07A 4G5YA 1P5RA 2PZMA 1XAJA 2LIPA 1QU3A 1OY6A 2RKWA 1M5PC 3AJAA 3UKOA 5G4LA 4UNRA 3UANA 2XVAA 1MG0A 2F3SA 2VYVA 4RWEA 1W29A 4DRXB 1KJJA 1UR5A 3QLJA 1D1SA 1PV4A 2LUOA 2WRMA 2PEZA 1CVJA 5TQ2A 4RBUA 1YA8A 2Q2NA 4R2WA 3TVDA 1EIZA 1XTQA 4AG5A 3WB2A 1KAHA 3M6FA 2B1QA 5FOXA 3GZNB 3D3JA 3ZH2A 1TT5A 4C5AA 3IVXA 4C3ZA 4Z86A 4HDKB 3OT5A 4TS3A 1D4OA 1KMHA 2XSFA 1XQXA 4DCNA 4J7CA 2VF4X 4TY8B 4Q4JA 2CT8A 1VRVA 1JDJA 1HUQA 3NDIA 1KSPA 2ZKUA 2PQ6A 1FWKA 4DZZA 1S1TA 4NE9C 4TKZA 1A2BA 1CBKA 3VH3A 5H1YA 4MQLA 3OTOJ 3DGPA 1XVTA 5HJ2A 1UJ4A 4TLQA 5LBIA 4ND3A 3G79A 4MVJM 1UZNA 2Y0PA 4CKBB 3G7UA 4H4MB 4S04A 4NLYA 2FX5A 4KH0B 1BJRE 2G1HA 1Z5UA 4CYUB 1FRIA 3OQPA 4KMSA 1NDPA 3C46A 5DQHA 3IGVA 3Q0EA 4C22A 2F9JA 3IMEA 3H7AA 5L9NA 3NVKI 1XKQA 1BCSA 2R0QC 4D4JA 3K7EA 3OICA 3HCRA 4AJKA 2ZRBA 2RHRA 3F7MA 3U80A 3S6JA 1DAHA 1ZVMA 4D1YA 2JRSA 4WCFB 1O9HA 1NZAA 4UPEA 1D09B 5JDIC 5CCEA 4WV3A 3QKTA 4OREX 3X1KA 2MQPA 5F8IA 2Q3DA 4Y9RA 2IOYA 3PTAA 3E9RA 3IA0A 3H5RA 3U9LA 3L7OA 4C0OC 2I8AA 5DX0A 4DCOB 4UBLA 2K7ZA 4TLMB 3QG1A 2AZ1A 2ZT8A 3V3KA 2AN5A 3MMBB 4KQKA 3KXDA 3NG1A 1P4AA 2IHYA 3UO8B 4B7AA 2X8WA 1LK7A 3LC1O 3C3WA 4MRMA 2QIFA 3DKKA 3P96A 2EX0A 3R75A 2C8KA 5JZVA 4Y00A 1YWXA 4CT8A 2BFAA 3DXXA 1JKHB 1JQAA 3L3BA 3A6KA 5KOHA 3N59A 5A1TA 2WF9A 4MYUA 4KV8A 2J0QD 4ZHRA 1UJMA 3CC8A 1QIEA 1V9OA 1JEDA 2LP4A 1UP1A 2VWGA 1LX7A 4BATA 2VT3A 1SC1B 4YJGA 5AOCA 2DISA 1ZGAA 1YQEA 1GT6A 4RHFA 4PGAA 4RW7B 1CQPA 1DARA 2DFLA 5HLFB 1KGSA 3VO1A 3LH5A 3SF8A 1BHQ1 3VWSA 5GPBA 4C43A 1HBNA 3PGLA 1I94B 1XZMA 3NP7A 5CK4A 1Y3DE 3IVCA 4LPKA 1M5UA 1LBEA 1U80A 3TJZA 5DHAA 4EVIA 1X1TA 1TUEA 3HJTA 2VPYB 2HA2A 2DHRA 3VSCA 2J3HA 3WAKA 3BXEA 1O8BA 4HSGA 1K1QA 1LWNA 3KCQA 2P3LA 1M0SA 2OM2A 4B82A 2VJKA 1CY8A 1Z0IA 3IG1B 3FNRA 5HAOA 2IUTA 1GQOA 3FMIA 4P7KA 4U9RA 3SZUA 4R9UC 1E3SA 2WSMA 3A9VA 3HHNB 1RACA 2NO6A 2ONYA 4DN9A 2X0NA 3RUDA 1IC6A 4KPYA 4NAUA 3NV9A 3NC4A 3EZ5A 3J7YI 2R8BA 2H1SA 3SWWA 2IDJA 4KR7A 4A36A 5C7OO 4W7HA 3GZTB 1BGXT 1SQEA 4I14A 4ZDNA 1ONSA 2P68A 2R7VA 3SFVA 1IWGA 4B33A 3KVOA 3WSWA 4CLXA 2XJ4A 1L3UA 2BP7A 2BXJA 1PSDA 2CNKA 2IY7A 2P0EA 5B55A 4J4BA 1RYRA 5KOIA 3A32A 1FUKA 1YQ9A 5B1HA 2UU9B 4MWOA 3FPJA 1TZBA 2ZE2B 3QXJA 3L4SO 3R0VA 1UPTA 1YL7A 1RWWA 3W2VA 4XEUA 2ZCUA 1H5QA 2DIRA 4NLWA 2KTQA 2C92A 2X76A 4F5EA 5E6UA 3Q1LA 3C3PA 3N6MA 3OEHD 3R5HA 1NX9A 1TKXB 4IG0A 4JELA 4V0QA 1PEDA 2RQKA 1ZDMA 2XLIA 2ZHBA 2A2ZA 1YHNA 4ENRA 1QPZA 1MO5A 1CU1A 5M7EA 3R5AA 2ZAIA 2ATEA 1M6YA 3EBLA 5EWJB 3G2OA 4XAQA 3GFPA 5LYJA 4USUA 3ZZTA 1XAGA 1FMLA 3PUXA 1RRPA 3GPDG 4DZTA 4DLLA 1S4QA 2GK4A 4AWXA 2E9TA 2D3UA 2PLWA 4XWTA 3WAGA 4OUKX 1Z07A 2WFZA 3L5KA 2HI0A 2GCOB 3NBFA 4FNAA 3WLIA 3M49A 5ALKA 1X7WB 5IJAA 3R2CJ 4R01A 3A9TA 3EF3A 3B82A 3AR3A 1SVSA 5JPCA 1E32A 4UU1A 3H8SA 3CNNA 3ZH9B 1N1GA 1DKUA 4DFJA 3EXFA 4R8SA 1NUEA 1JLLB 1FZQA 3QT5A 2XODA 3B60A 3D5MA 5HQLA 4UDYX 1VMAA 4QWEA 3CRZA 1I4DD 2DNOA 2AJ2A 1WZCA 1G5TA 3AFGA 1S8AA 3EVFA 4IEIA 1X9GA 3E3MA 2UVPA 2I6TA 2L9WA 2E2WA 3NR2A 1B2LA 2H3EA 3TE6A 3RARA 5J2QA 1MNQA 1OKKD 1HBUA 2ZXFA 1OU4A 4OK6A 3G9QA 1RKUA 2J09A 4WNIA 1V47A 3QENA 3ICLA 4QLOA 4L6CA 2PXCA 5SYAA 1WUIS 1N8TA 2AV5A 2I2DA 2QTWB 1KA9H 2G0JA 1ZUNB 3GJ0A 3IHKA 4QM6A 3OZTA 1IK6A 3HDSA 5AK3A 3LP8A 1KY3A 4J9NA 2BQ3A 3EEBA 3PUIA 2AGOA 1P74A 3G89A 1PR1A 4GYYA 1ZK4A 1UDCA 2J5XA 3SSRA 3JB9k 2OV2A 2GVZA 4KYTA 3H0KA 1AB5A 3I31A 4CLYA 1TK0A 4Z53A 4FJ2A 4AF6A 3N6VA 4EATA 5LQNA 3NGTA 4JOSA 4PLWA 1P6TA 3T9ZA 2GNPA 4TKUA 1IJFA 5D87A 4EBFA 4F3CA 3O82A 5KFKA 3CUVA 1CP2A 2NPOA 3CEPB 4G37A 4W1RA 1HY3A 3PNLA 4L5IA 1NVAA 1PAUA 3FNHA 3CF6R 5BXIA 1PBUA 4KOEC 1H7XA 1KOOA 4JMLA 4HV4A 3OTCA 1E6KA 1YGYA 1Z3CA 3BF4A 1I2AA 3Q8RB 3TX0A 2CSUA 2FOLA 4ZEVA 3SI8A 521PA 1ULTA 3LMKA 1XNRJ 3ZDCA 4O3PA 2QOEA 4MS3B 1N0HA 2IHNA 1OLXB 1UANA 1AKTA 4ZFNA 4BLOA 3AVTA 1A9XA 3C7AA 2VHTA 4F7VA 3DUFB 3SSNA 3ODPA 1NLYA 1PBTA 1YDWA 3Q2SC 3IAHA 4EQ6A 4EYEA 5D84A 2WD7A 3LIIA 4NI2A 2KM8B 1N2CA 4HWGA 4A2CA 4XFJA 4DCPA 5HMWA 6CHYA 4AZWA 3GC6A 3M9MB 1VHQA 3GEMA 4OLPA 1VI6A 3UOWA 3VR4A 2DULA 2W2NA 5DBOA 3HH8A 4J9LA 1T8UA 3KLGB 4DR4B 4MK9A 3O21A 4K9NA 1HNVA 2WSSD 1MVOA 4GWKA 4QXMA 5ILGA 2DR0A 3GVCA 5JBQA 4Y9TA 4ARIA 4JB3A 3ZV3A 1IOLA 4P71A 2GN6A 2Z2YA 5ANRB 4MO9A 3ZDQA 1IN1A 5KEIA 1DJ0A 2B78A 2GEKA 4EO4A 4MTLA 1HIYA 5BYRA 1Q2UA 4F4AA 3FE2A 2XZWA 1VIOA 4DLEA 1FDBA 3T4UA 2VJVA 5JISA 8ADHA 5L3SA 4JI4F 2PUCA 3RIEA 5J1EA 4MDHA 4J2TA 5AQEA 3DDWA 5JAOA 5K8UA 5H9EJ 1FK9B 3T1YJ 2Z9BA 1XP5A 4TLRA 3LUGA 5B36A 4ZVSA 3MWDB 2J3KA 4K4XA 4RTMA 3CT9A 1IUPA 1Z0JA 2C88A 3F2VA 3IBFA 4JBXA 1Z2ZA 2ZRNA 3SMZA 4RFSB 5BWBA 4Y65A 1Z0AA 4MI1A 1SKQA 1RA6A 1SCJB 5EN4A 3FTDA 4RQTA 4X61A 3BG5A 4XIUA 1W2IA 3A3OB 3GPAA 2BR3A 2R4QA 4QVGA 1LUAA 1XEZA 4FKYA 2CJXA 1HBOA 1VQ1A 5IT9A 4O3RA 4BMNA 4OBXA 4U02A 2XE7A 4N1AA 4DR6J 4WKNA 4C7BA 2CLDX 3S4YA 3II6X 1U09A 1AGPA 1NI4B 3OT4A 4YAJA 5C53B 3AUJB 4R9NA 2P41A 4QBGB 1A76A 2WZDA 4OQMA 2ZRGA 4PLVA 4BS2A 1S0UA 3MD3A 1JLQB 1FA9A 1C4XA 3PHBE 2I29A 4KH1A 1PZMA 1XJQA 5HI7A 1HNXF 2W2MA 2HFZA 1DP4A 4NL4H 2VCEA 2QAGB 4JI1J 3LC2O 4IDHA 4KQXA 1W6UA 4BNZA 4PO8A 5LZ5A 2R25B 4YHHB 1RWPB 4JV0A 1Y9EA 3ZXWA 4DL9A 2BCEA 4JP1A 3UGKA 3DHXA 3DLEA 3L0DA 2FRVA 2NTYC 1JUDA 4RNNA 1LY1A 1TV6B 1DOZA 2CLHB 4F6RA 1SKAA 2FPMA 5K0EA 2Y0BA 5AW4A 4CQ1A 1T13A 2E82A 2AFVA 2D13A 2IYYA 3TNDA 1X13A 1QQ7A 1QE0A 3LLCA 1R5NA 1MN6A 3OIFA 3EC1A 4DBQA 4FKZA 1SPBS 3TI7A 4U5XA 1S5PA 1C1BA 1YJWS 1DE0A 5L3RA 1ZU5A 2DO4A 1QFYA 4EZ6A 2KBFA 4CIYA 4DR2J 2WI8A 3O4IA 4OMFG 4M1TA 1RRFA 2O20A 5IV3A 3W5BA 3I5YA 4U3JB 4G2NA 1T8YA 2DUMA 1GGKA 1WSRA 2WK1A 2UXDJ 2QK4A 3I76A 4J1NA 4XPCA 4KW7A 1YK9A 3VTZA 2HXYA 2WONA 4XJXA 5LKAA 2TECE 1J90A 1HNIB 5HBRA 1UMKA 2JIBA 4DF8A 5MN5A 5LOQA 4UHCA 1KFDA 4M0CA 3PUKA 4WPGA 4PGMA 1B64A 1CR0A 3K59A 4UOGA 1FDTA 2EIXA 2YNFB 4WZAA 1VCIA 4GD3Q 2C99A 1ZMTA 2J0QA 3GHYA 4U7TB 5FBKA 4OGGA 2JFBA 4LVNP 3PNSA 1HTWA 1NPPA 1GXLA 3KOXA 1FSSA 1NTOA 4WLVA 3NCRA 1KXJA 2QYTA 4XVHA 1TM4E 2OPRA 1J8YF 4ZCIA 2HHAA 2CFCA 1L8XA 3DXFA 2D9PA 3IQFA 4WBNF 2A6OA 3FOBA 1OZ0A 2V3WA 2IDKA 4PZLA 4KPCA 4MV4A 2PKYX 1Y0BA 4RVUA 5D6OA 3FLBA 4FS1A 1T4MA 2ODEA 1GZ7A 1R27A 3BXGA 2VTEA 5KDLA 3S28A 1BQ4A 3FF1A 3NUGA 5G1PA 1Q7CA 3C15A 5AM0A 2CZGA 1C2TA 2CPEA 3QVVA 3EQ2A 3SCLE 1J8DA 1C0PA 3IRUA 4EW3A 4YYZA 3VNRA 3CNOA 2Y68A 5JFTA 4KXFB 4I5GA 1NK8A 4FS8A 4HR2A 1LBTA 3N9IA 2XYVA 2IH4A 3IMKA 1E1CB 3MR3A 5DK6A 4F38A 4MLPA 3S8YA 2IA5A 2NQ2C 4G5RA 2FJAB 2C3PA 2Z83A 4WZQA 2P6NA 1JJVA 2BDEA 4JJ8A 4KHMA 5KJFA 1FI4A 2J9FA 2BH2A 4HSEA 3ZE1B 2ZJ0A 2BZGA 3KG0A 1RT7A 3H19A 4DDFA 2NN3C 4BEVA 2TYSB 1NAHA 3OIWA 3IE0A 1VPVA 4WESB 1XXHB 1NL3A 2GRJA 3ROKA 4BQOA 3W04A 1RJ9A 2P2ZA 2BKVA 1JHDA 4R7GA 1RTTA 3W1WA 1ONPA 4E98A 4OJ3A 3AWIA 1PWXA 5B0FA 1AW0A 1PZGA 5LCXA 3EOZA 1FRFS 4MV6A 1PFKA 1MEEA 3W1YC 3AONB 3TE7A 3OD2A 4DRXA 1X8DA 1PNQA 4GGMX 2ZBCA 4DDKA 1UEUA 1XCMA 5DE3A 3T0IA 3AOCA 1B0VA 2N9UA 4EJMA 3RQSA 3G0OA 2G82A 1EWVA 4YV0A 3OEHA 3INYA 2VXYA 1GTVA 1UMBB 3AUKA 3GZNA 2YZMA 2J76E 1NHUA 5KQRA 4HDKA 1UWBB 5B5SA 5DZ7A 4CIWA 3Q2IA 2WNSA 1EJ0A 3INTA 4TY8A 4CZCA 3BIJA 3ZPXA 4WZ6A 1G3IA 1Q44A 1JHOA 2GVDB 4OL9A 2RUSA 1TNDA 1N6HA 3D2LA 5F21A 2O19A 1HD0A 4Y2UA 5IAAA 3N01A 4RL1A 2NNWB 1EMDA 1NAIA 3FJYA 2GPNA 4CKBA 3RTCA 4H4MA 2N3OA 4V0RA 4ZU6X 4RV5A 1H0RA 1C4CA 4KH0A 2BGMA 3UHFA 5IV4A 3PY8A 1XZGA 1J39A 4Y2RA 4CYUA 3G0IA 3P9CA 4ECEA 3PGJA 1ZI9A 2XDAA 3GGPA 3FLEA 1TKBA 2JDID 1W30A 2R7OA 5CIYA 3Q8WA 1II8B 2CV0A 5HK4A 5AXDA 3I9JA 1V6CA 3MT7A 2B30A 2CJPA 1I4LD 4F2SA 5DGDA 1OXVA 1O95C 1UZHA 1S0OA 2Z2IA 4NI5A 5K8CA 4BLVA 1C7ZA 3LZDA 5JUMA 2JVRA 1OPXA 1V0JA 1D09A 2QLLA 3EIQA 1WTCA 1YBUA 3PPXA 4L75A 1VYVA 1WABA 1RDRA 1OMSA 1H3NA 3LP5A 3CLHA 4C7QA 1CJTC 4DCOA 5FWYB 4ED3A 1OKKA 2B37A 5GZ6A 2YN2A 1ZM4A 3IPAA 5CDUA 5FXMA 5MHTA 1IFXA 1CUJA 4WU3A 3AI7A 3Q3GE 3TGLA 3MMBA 4X66J 3EYWA 3IESA 3TEMA 4BN4A 4FN5A 1ZBDA 4OA5A 1VPWA 1YJNS 3AY3A 4MUNA 4NCIA 4P5PA 3EGVA 4ZVOB 3WX8A 3U7QB 1UP4A 1U63A 2ACYA 1A5SB 1FHTA 1ORWA 4E5MA 1JKHA 1JG6A 3DL4A 3OX1A 2R8ZA 4G24A 1B73A 1L1FA 4I4IA 1TPYA 2CIMA 3QFFA 4OX8A 3ZE0B 5ADHA 1KWMA 1Y4SA 3BZQA 2PRJA 4HRXA 5IULC 2OIHA 4N0DA 1UCNA 2HA3A 1SRQA 3V4MA 4H77A 5D5HA 4RHCA 4DKJA 3U1NA 4RW7A 5HLFA 2FPUA 3KKNA 1WORA 5K3EA 3H5WA 4AI6A 1XMQF 2I6XA 1GQSA 1MN7A 3F96A 2M70A 1P9WA 4ICLB 3U7HB 2Q07A 4ZTBA 4QDZA 4E5SA 4ZP7A 3C3BA 3SIRA 4I8XA 1PSZA 4UD2A 4Q1DA 2CLOB 3BQ1A 3RIXA 3GLQA 1FP6A 5DLDA 4TU9A 4EHBA 2VYND 1UBLS 1JLFB 4GKJJ 4F3KA 3IG1A 4GI5A 5F73A 2PRIA 1W48A 3NNNA 3BSSA 4E51A 1Z0UA 1N0WA 1D3WA 4F1JA 2ORWA 4YY3B 1HG1A 3OHMA 5FBZA 1XQYA 4DV5B 4A8MP 1KORA 1SQ5A 1UKUA 2PZBA 4LXUA 1I13A 5DFAA 3JPWA 5IDYA 3SKYA 3FTPA 3RAMA 2AC7A 4NOKA 1GSHA 3D6VA 4WKGA 2QL5B 4BUJA 3QPCA 4JEMA 3MIZA 5HNKA 5CDHA 4NPOA 3HU5A 4ZLLA 3LHSA 1DLOA 4AE5A 2WSSA 3RGGA 2QTLA 1LF0A 1BRTA 3UOGA 3ZUGA 3ZDEA 1WC4A 1NWHA 2B4PA 1UVMA 1RHMB 1REGX 1CUUA 1RYSA 3MF4A 1G21E 2ZE2A 4LYYA 1XRLA 2WVHA 2PRSA 4RD1A 2NUHA 1YTYA 1WXHA 1DQYA 2PX8A 4LJYA 4OM7A 1QGUB 3R7LA 4PXEA 4K50A 3NWGA 4C2MA 3K9FC 2BHSA 1FWLA 4DOMA 3BTSA 1B6SA 4X90A 3Q8KA 2XS5A 2NIPA 4K9RA 1TKXA 3OKFA 5E4FA 2FVSA 2HHXA 4NFLA 3NANA 3PDIB 1B70B 5D0EA 4R8KA 4JI6B 1HF3A 3WY9A 4D3SA 3DOCA 1PNRA 2P5TB 2FQQB 3C4QA 5EWJA 5TDHA 4CU2A 4N5NA 1MLDA 2X4IA 1QJHA 2H7VA 2RDMA 2OMOA 3RIMA 2QEXS 3T7DA 3GLGE 4O4IF 5FULA 1L5FA 4MS4A 3PWTA 1TL1B 4HHEA 1JVNA 5TQ2B 2GCOA 2A2DA 2ZUUA 3MYRA 3ZJYA 5H9EK 5EMMA 4W5WA 1VQSA 4L3KA 2RAFA 3WDKA 1J8FA 1X7WA 4E1BA 1F0KA 5JZ9A 3E5HA 3T1HF 1TT5B 2HMVA 5KT6A 1J1IA 1VKOA 1JALA 5CDYA 2O6LA 4C21A 3HG7A 2C5GA 3NU1A 1JLLA 4IQ0A 5D8HB 2RD2A 2NZXA 4EPYA 1SU6A 1CJUC 5E1MA 1MB9A 4C98A 2X9VA 3JTEA 4LF4F 2IZ5A 4PC7A 4YIKA 1QYIA 1U0HB 4JVMA 4O1MA 1T0HB 1GRVA 2CYBA 2G07A 1TKDA 1GMWD 2AXEA 1YVPA 3FPEA 4C2BA 4AW9A 1PL6A 3U1TA 4LCJA 3CJQA 5CGQB 3N2ZB 1URRA 1LZKA 2W4IA 1BOFA 3D5EA 2HB6A 3TOQA 3EXG1 5KDDA 2AJQA 2YBEA 3A1NA 3LLMA 4OCZA 4MX8A 2QLFB 4YR3A 3QKIA 1S1WB 2EKLA 4PSCA 4ZIVA 5EVJA 1Z4LA 3Q72A 2QTWA 3ZJUA 5FX2A 1ZUNA 4MSUA 3V33A 2NSJA 5D4PA 2OTCA 4LQDA 3OOWA 3VJKA 5BW8A 4YMLA 3D2AA 2C58A 1FJ7A 4MQBA 1NYLA 1ND5A 3MCZA 1DRWA 1Z6XA 3U4CA 2BSAA 1UIMA 2VQEB 1KOFA 2ZITA 5ALZA 3BDPA 3IMFA 4I4LA 2APJA 1JT9A 4B87A 3ISZA 1EESA 1NNLA 5KWEA 2OPSB 2YVLA 3ANNA 3KYLA 1YI1A 3KZCA 4GLJA 4ZZ3A 4MV0A 1IQPA 5I3PA 3LL4A 4L0CA 1TU4A 1RLCL 3T8YA 2FN3A 4LVCA 1EINA 2P9CA 3RSZA 3H5TA 3NQ41 3TZBA 3LPNA 1A7KA 4J1SA 4FYKA 4ZVRB 3IN5A 3MSCA 2FMTA 1HQEB 4TL9A 1CQNA 3GLHE 3O3LA 4RZHA 1KI1A 4OQDA 1M6VB 4UTRA 4Z3KA 4N6NA 3J7YU 3L4BC 1OX4B 5TLSA 3OU6A 1A9OA 4LYAA 2B2CA 2XA1A 2ROQA 3IERA 3K17A 1Y7TA 4RADA 1U48A 2ISSD 2PVSA 3AEKB 2FQXA 3PC6A 1R8JA 4MS3A 3D7NA 1MO4A 1OLXA 2I4NA 5DULA 1V9LA 1T94A 1WE2A 3GLKA 5KG5A 1RWMB 3MLAA 1PE0A 1F6BA 3H25A 1CEZA 3DUFA 2WVEA 4X41A 3L41A 4EJSC 3GLSA 1DT5A 2QX0A 4OZ2A 2Q0HA 1DX9A 3I04A 2RBEA 2G13A 5CM9C 2X0FA 3LFUA 4AJ4A 5AK0A 1UPUA 2I80A 5HKAA 1KFSA 3BH6B 2E4VA 1H2AS 2JFPA 3MPUB 2HWTA 1DHRA 2AXNA 3DT8A 4NONA 5C9ZA 5HIAA 3DKVA 2QWXA 2OA0A 5K6AC 1RAIB 1YR3A 2P2NA 4D5EA 1WUTA 2TRSB 1DMSA 4DCTA 3FMPB 2J85A 3NIFB 3SMVA 3LF0A 2J5RA 1CNMA 1IYZA 2WT9A 1VG9B 5H83A 1CUCA 1ST3A 2PJUA 3GRUA 1SUDA 1GMUA 2EJBA 2VZ9A 1IM2A 2PQ0A 5HDBB 1IR0A 5JZOA 2NVUB 2VG7A 2FLWA 1T9ZA 2XMVA 1GAXA 4OYOA 3VAGA 3CCUS 4RTRA 5JAUA 4YDHB 2I2CA 4EA7A 4CBVA 2K1RB 4CF7A 3TQEA 3MWDA 4PFJA 1Z6QA 2AHRA 3WLNA 4UHKA 4Z8YA 2VVTA 1BS9A 1DJNA 3LV8A 5LA6F 1HHTP 3UR3C 1IXYA 3QT7A 5BY2A 4RFSA 1XDWA 1GNSA 3NORA 1MG5A 4ANFA 4YRGA 1SCJA 1W1UA 1PVDA 5D3GB 2O2HA 3GNLA 2Q1XA 3LCRA 2BEFA 3QIPB 4ETIA 3D8TA 3OLZA 4FVTA 2ZNYA 2VDPB 1UBKS 2BW7A 3RNLA 2PMBA 4DG8A 2DJIA 4L1KA 3A9CA 1HGXA 5KC8A 3EIXA 4ETWA 1THMA 1M0EA 5EOVA 5JCOA 1R8CA 3BHNA 2E3JA 5IJZA 4X65B 2WTXA 3IVMA 2DT9A 2FWJA 3HJCA 1SCQA 3H6KA 3LHIA 4WXHA 3T6JA 4YDDB 1KGDA 1NI4A 1HDXA 3TECE 4QGSA 4BNNA 3TPFA 5GM1A 5TMEA 2JLUA 4F2DA 1LJUA 1IEQA 3HCOA 3W79A 1JLQA 3EG5A 2FGKA 4B4WA 5ALXA 3G5MA 5TEVA 1BQ3A 2QAGA 4OZLA 1FRXA 2BJ7A 3RR7A 1EWTA 3LCUA 3UJ9A 3T7KA 1E7SA 2CXXA 3LO8A 1RWPA 1TF5A 4HTFB 1E7MA 1BFKA 4AXBA 4NC9A 2PNFA 3C3AA 4RGYA 5ICEA 3I5BA 4M0MA 3SSAA 1TV6A 4BQRA 4NSNA 2MCFA 1I3CA 2JDIA 1IG3A 5EIEA 3MEGB 3W1VA 1KVUA 1TFYA 2QYSA 1U0BB 4X7BA 1OSCA 2DNMA 2BZ2A 4IUFA 3IKMB 2B4VA 4FKBA 3FSEA 2CG4A 6Q21A 3IT0A 3T5AA 1QFJA 3PXUA 2FV8A 2GHQA 3ECAA 3HYNA 5KTOA 2R44A 4NK5A 2OFGX 3UTCA 4DR1F 5F9LA 3T3FA 1WRBA 4CU5A 3ACBA 4U3JA 1HBUB 1C3VA 3I83A 5DI3B 1E3IA 4RPCA 3SX2A 1J2VA 1CSEE 1IBRA 5JWRA 2WIGA 4RUBA 1H1TA 4NQZA 1HNIA 4TTTS 4B3SF 3LGNA 5BJRA 2VWQA 3G8BA 3I39X 4P7FA 2CVPA 1M1NB 2FPPB 2AKYA 1QZ3A 2OCBA 3C41J 3S2EA 2BDUA 5KX5A 2YNFA 1J7KA 3QKWA 3KTAB 2O7RA 4WJBA 1EPUA 2X0RA 1W2BR 2JS7A 4X6XA 2CMHA 2V96A 4RHXA 2W43A 4LF7J 4KXYA 2W90A 4UNPA 2CVIA 4KDEA 1MR3F 5JMOA 4ELVA 1EDBA 3OX4A 1ENPA 3D66A 1DEXA 2YHUA 4O4HF 1JQEA 4PBTA 1BFDA 3QU4A 3SKXA 2QTBA 4LISA 1U8XX 3QAEA 4BNJA 4HAZA 1XF9A 1YH3A 2RGUA 3B6MA 1IXKA 1EFCA 2D5IA 1YB4A 1JDUA 1Q16B 3CCRS 5IXYA 1SZCA 3PCOB 4MDFA 3IR5B 1LZLA 1BSVA 1ZN9A 1N3YA 5BN3B 1RI5A 1Y82A 4NYIR 3G2XA 3P2YA 4LRSB 1U1DA 2FW0A 5H81A 2OYSA 3VPHA 2VYNA 3LQ2A 5EQTA 3WGHA 4EELA 3BSOA 4NP6A 3W1EA 3FHLA 5BRNA 3PQEA 3IAFA 4C4TA 1JKMA 1OH8A 2JA2A 1N8KA 3MJCA 3S7RA 1Z37A 3JATB 3QYJA 2GCEA 1E2LA 2HVIA 4EQ6B 1TFUA 1E1CA 2IYFA 5I9IA 1B0ZA 5E2BA 3VBEA 3OURA 1RKQA 4ZAGA 3C3MA 5DYNA 2VJMB 1K0TA 1DCTA 621PA 2IF0A 4KI0A 4TQ9A 4L9AA 3R9WA 3H75A 4AXJA 1PTKA 5CXTA 1NLZA 3DF9A 3ZJTA 4I4CA 4ILKA 1CPZA 3JW8A 1UK9A 2P3QA 3QW2A 3KBBA 1HNVB 1T5LA 3P9SA 4WESA 4Y8VA 3K2EA 1XXHA 3KUCA 3BE4A 3B3AA 3EZ7A 4Z7NB 1NCLA 2EQ5A 4PR0A 2NT3A 3EUWA 3G8CA 1DEAA 3C1AA 2XOKD 4Q02A 4F2RA 1GNRA 1Z2OX 5CVVA 1Y6RA 1CIJA 2RMLA 5JS6A 3CBQA 5DIZA 4C03A 3FAZA 1XE3A 3HD1A 5L3SB 2ACWA 2ZT7A 4RD0A 3TTYA 4MDYA 2NVWA 5ADWA 1LV5A 5JTUA 2JJ2D 1UMBA 1VRTB 4B08A 1ORVA 4CM4B 3TLZA 5DXAA 4PAMA 3S1SA 1UWBA 1LBQA 2ZUEA 2HQDA 1HYHA 1Y3HA 1UFQA 4INJA 2NV0A 2VICA 2JC3A 4DV2B 4S1PA 1C8BA 2C5HA 3HP6A 3RASA 4N3GA 2RK6A 2GVDA 2IIBA 3ETMA 4AC9A 2Q7OE 1RKVA 3TZEA 3H5NA 2RQ4A 2I76A 2C9DA 5B6PA 1YB2A 2V8DA 5HK8A 1LBIA 4UOZA 1FRQA 2DQZA 4ECUA 5FJJA 1R9MA 3Q9LA 1HETA 1IVZA 4W4MA 4PW0A 4LYFA 1NJSA 4EOGA 3TTXA 3TUPA 4X4OA 1II8A 3NAMA 4TKLA 5KDOA 3STVA 2BN4A 5REQB 4X63A 1D07A 3EEYA 4MMYB 1U0SY 4NOMA 1NXTA 1L4UA 4HO1X 4NXNB 3CPHA 2ZAOA 3G6KA 1YFZA 3NO4A 4P5EA 3CLSC 3BN7A 1NSAA 4P84A 2ATXA 4UBJA 2Z9CA 3O47A 3M32B 3Q8UA 5K8NA 1Z4JA 4Z37A 3WRXC 1SULA 4NWIA 2MB0B 1ZJ4A 4XCVA 1GMWA 2A9QA 2ZUBA 3DRYA 2IP4A 1OC4A 4L6AA 3SNHA 3RR8A 4FEYA 2GT1A 1R8PA 5FF9A 4J1TC 4F6RB 5FWYA 1TKAA 4L0DA 2CXRA 2O3SA 2M9KA 5AVQA 1OWNA 5EHQA 2RGXA 1IB6A 2WE8A 3VSBA 3DBLB 1GA4A 2G5PA 1PNVA 2WJAA 3DYVA 3MS7A 1P2UA 4HBGA 4EUNA 1R8HA 4BV9A 2FUCA 3WYAA 4MYCA 3NGRA 1J21A 3LY9A 4KHPJ 2AX1A 3EGEA 3VVTA 1SU7A 3KG2A 4K87A 3POTB 2ZEJA 4HLUA 4H1VA 1UK7A 2VG8A 4NRDA 5IKMA 1N77A 1RK8A 2FK8A 4YP9A 4WWHA 4JJ6A 1GT8A 2Y1CA 3GHHA 1GSAA 1P75A 1XTVA 3QF7A 1K9MT 4DMCA 3JTNA 4F7WA 3AIKA 4JA0A 3FFWA 4HAYA 2C2YA 1YRYE 4BCBA 4JQZA 3CNBA 5CAEB 4ICLA 4BAZA 4DPOA 2D3WA 3ONEA 2DR7A 1AA9A 3W2GA 1XRMA 3H5UA 1WVGA 4E94A 2J45A 4NCHA 1ZEMA 2UUTA 4O2BA 4DR5B 4LBPA 3KQHA 1GTJ1 2DPYA 3U0BA 1FEEA 1JLFA 1TD1A 2IEYA 3KQOA 3K6SA 2OJ3A 1TKCA 2VPQA 4KDCA 5AOBA 4NCBA 3RU9A 4NZ7A 2HHQA 5LD2B 4XCQA 3NFYA 4PKDB 4HDNB 3G7SA 5IVDA 2IPLA 2O52A 2CFXA 4WI1A 3NM6B 1RYMA 4F11A 4HD8A 3C85A 3VZDA 3MNFA 4G1MB 4YPFA 1U6JA 1UMCA 4URSA 1BHNA 2X3DA 1VE6A