The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
30
|
sequence length |
101
|
structure length |
101
|
Chain Sequence |
LAKGYRGQRSRSYRRAKEAVMRALYYQYRDRKLRKREFRRLWIARINAAVRAYGLNYSTFINGLKKAGIELDRKILADMAVRDPQAFEQVVNKVKEALQVQ
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Coexistence of two protein folding states in the crystal structure of ribosomal protein L20
pubmed doi rcsb |
| molecule tags |
Structural protein
|
| source organism |
Aquifex aeolicus
|
| molecule keywords |
50S ribosomal protein L20
|
| total genus |
30
|
| structure length |
101
|
| sequence length |
101
|
| chains with identical sequence |
B, D, E
|
| ec nomenclature | |
| pdb deposition date | 2006-03-27 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00453 | Ribosomal_L20 | Ribosomal protein L20 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | c-terminal domain of poly(a) binding protein | Ribosomal protein L20 |
#chains in the Genus database with same CATH superfamily 2GHJ A; 1GYZ A; #chains in the Genus database with same CATH topology 3KTR A; 4KXF B; 2LKL A; 3KUT A; 2RQG B; 3NTW A; 3PKN A; 3KUS A; 3KUJ A; 1JH4 A; 3KTP A; 1I2T A; 3KUR A; 3PTH A; 2HH6 A; 1GYZ A; 1NMR A; 4IVE A; 2RQH B; 2DYD A; 1G9L A; 2O3L A; 1IFW A; 2GHJ A; 1JGN A; 2O4T A; 3KUI A; 3M92 A; 2X04 A; #chains in the Genus database with same CATH homology 2GHJ A; 1GYZ A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
