2I5NL

1.96 a x-ray structure of photosynthetic reaction center from rhodopseudomonas viridis:crystals grown by microfluidic technique
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
273
structure length
273
Chain Sequence
ALLSFERKYRVRGGTLIGGDLFDFWVGPYFVGFFGVSAIFFIFLGVSLIGYAASQGPTWDPFAISINPPDLKYGLGAAPLLEGGFWQAITVCALGAFISWMLREVEISRKLGIGWHVPLAFCVPIFMFCVLQVFRPLLLGSWGHAFPYGILSHLDWVNNFGYQYLNWHYNPGHMSSVSFLFVNAMALGLHGGLILSVANPGDGDKVKTAEHENQYFRDVVGYSIGALSIHRLGLFLASNIFLTGAFGTIASGPFWTRGWPEWWGWWLDIPFWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nanoliter microfluidic hybrid method for simultaneous screening and optimization validated with crystallization of membrane proteins.
pubmed doi rcsb
molecule keywords Photosynthetic reaction center cytochrome c subunit
molecule tags Photosynthesis
total genus 102
structure length 273
sequence length 273
ec nomenclature
pdb deposition date 2006-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00124 Photo_RC Photosynthetic reaction centre protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.85.10 Mainly Alpha Up-down Bundle Photosynthetic Reaction Center, subunit M; domain 1 Photosystem II protein D1-like 2i5nL01
1.20.85.10 Mainly Alpha Up-down Bundle Photosynthetic Reaction Center, subunit M; domain 1 Photosystem II protein D1-like 2i5nL02
4HBHM 2UX3L 3DU2L 2UWUL 2WX5L 2UWWM 1DV6M 1R2CL 2GNUM 3T6EM 1FNPL 2BNPA 1MPSM 4H99M 4H9LL 4LWYL 3ZUWL 3DU2M 1DXRM 1PCRL 2UWUM 1RZZL 7PRCM 3DTAL 3ZUMM 3DUQL 5LRIM 2HH1M 4IN7M 3DTRL 3WMML 1JH0L 1QOVM 1UMXL 1VRNM 4HBJL 2J8DL 1K6LM 2UXKL 4IN6M 3I4DM 2JBLL 1FNQL 2HG9M 2UXLL 1PSSM 2UXML 2UX4L 3PRCL 4TQQL 4CASC 2HJ6L 1JGZL 2X5UM 1JH0M 1PSTM 1S00M 2WJNM 3DSYL 1JGYM 2BOZL 1DS8L 2UX5L 1OGVM 1L9JL 2GMRL 1JGWL 1K6NM 2BNSA 2UXMM 1PRCM 1DV3L 1JGZM 2UWVL 3DSYM 2HITL 1RGNL 3T6EL 1RY5L 1L9JM 2UX3M 2WX5M 1L9BL 2UWTL 2UWVM 3G7FL 1R2CM 3D38L 1FNPM 1RGNM 1F6NL 2J8CL 1AIJL 4H9LM 1RVJL 4IN5L 1JGXL 4LWYM 3ZUWM 1PCRM 1RZZM 1EYSL 1RG5L 2UWTM 2BNPB 3DTAM 3D38M 1F6NM 3DUQM 1YSTL 2X5VL 1RVJM 1JGXM 2I5NL 2UWSL 1E14L 5LSEL 3DTRM 3DU3L 1RG5M 3WMMM 1RZHL 1UMXM 4HBJM 2J8DM 2UXKM 1M3XL 2RCRL 2JJ0L 3DTSL 2JBLM 1FNQM 2UWSM 1E14M 2UXLM 2WJML 2UX4M 3PRCM 4N7LL 4TQQM 2HJ6M 1KBYL 4CASB 6PRCL 1AIGL 4N7KL 2BOZM 1DS8M 1E6DL 1M3XM 2UX5M 2UXJL 2GMRM 1JGWM 6PRCM 5PRCL 1DV3M 1KBYM 3V3YL 3V3ZL 2PRCL 2HITM 1RY5M 3T6DL 4RCRL 2BNSB 1RQKL 2JIYL 1L9BM 2HG3L 3G7FM 2J8CM 1AIJM 1DV6L 2GNUL 4IN5M 1MPSL 4H99L 1DXRL 2HG3M 1EYSM 7PRCL 1YSTM 2X5VM 3ZUML 2I5NM 5LRIL 2HH1L 5LSEM 1YF6L 3DU3M 1RZHM 4IN7L 1QOVL 1VRNL 2RCRM 1K6LL 2HHKL 2JJ0M 3DTSM 4IN6L 4N7LM 2WJMM 3I4DL 1YF6M 2HG9L 1PSSL 2X5UL 1AIGM 4N7KM 1PSTL 1E6DM 1S00L 2WJNL 2HHKM 1JGYL 2UXJM 1OGVL 4HBHL 1K6NL 5PRCM 3V3YM 1PRCL 3V3ZM 2PRCM 2UWWL 3T6DM 4RCRM 1RQKM 2JIYM
chains in the Genus database with same CATH superfamily
4HBHM 2UX3L 3DU2L 2UWUL 2WX5L 2UWWM 1DV6M 1R2CL 2GNUM 3T6EM 1FNPL 2BNPA 1MPSM 4H99M 4H9LL 4LWYL 3ZUWL 3DU2M 1DXRM 1PCRL 2UWUM 1RZZL 7PRCM 3DTAL 3ZUMM 3DUQL 5LRIM 2HH1M 4IN7M 3DTRL 3WMML 1JH0L 1QOVM 1UMXL 1VRNM 4HBJL 2J8DL 1K6LM 2UXKL 4IN6M 3I4DM 2JBLL 1FNQL 2HG9M 2UXLL 1PSSM 2UXML 2UX4L 3PRCL 4TQQL 4CASC 2HJ6L 1JGZL 2X5UM 1JH0M 1PSTM 1S00M 2WJNM 3DSYL 1JGYM 2BOZL 1DS8L 2UX5L 1OGVM 1L9JL 2GMRL 1JGWL 1K6NM 2BNSA 2UXMM 3WRYC 1PRCM 1DV3L 1JGZM 2UWVL 3DSYM 2HITL 1RGNL 3T6EL 1RY5L 1L9JM 2UX3M 2WX5M 3VKWA 1L9BL 2UWTL 2UWVM 3G7FL 1R2CM 3D38L 1FNPM 1RGNM 1F6NL 2J8CL 1AIJL 4H9LM 1RVJL 4IN5L 1JGXL 4LWYM 3ZUWM 1PCRM 1RZZM 1EYSL 1RG5L 2UWTM 2BNPB 3DTAM 3D38M 1F6NM 3DUQM 1YSTL 2X5VL 1RVJM 1JGXM 2I5NL 2UWSL 1E14L 5LSEL 3WRXC 3DTRM 3DU3L 1RG5M 3WMMM 1RZHL 1UMXM 4HBJM 2J8DM 2UXKM 1M3XL 2RCRL 2JJ0L 3DTSL 2JBLM 1FNQM 2UWSM 1E14M 2UXLM 2WJML 2UX4M 3PRCM 4N7LL 4TQQM 2HJ6M 1KBYL 4CASB 6PRCL 1AIGL 4N7KL 2BOZM 1DS8M 1E6DL 1M3XM 2UX5M 2UXJL 2GMRM 1JGWM 6PRCM 5PRCL 1DV3M 1KBYM 3V3YL 3V3ZL 2PRCL 2HITM 1RY5M 3T6DL 4RCRL 2BNSB 1RQKL 2JIYL 1L9BM 2HG3L 3G7FM 2J8CM 1AIJM 1DV6L 2GNUL 4IN5M 1MPSL 4H99L 1DXRL 2HG3M 1EYSM 7PRCL 1YSTM 2X5VM 3ZUML 2I5NM 5LRIL 2HH1L 5LSEM 1YF6L 3DU3M 1RZHM 4IN7L 1QOVL 1VRNL 2RCRM 1K6LL 2HHKL 2JJ0M 3DTSM 4IN6L 4N7LM 2WJMM 3I4DL 1YF6M 2HG9L 1PSSL 2X5UL 1AIGM 4N7KM 1PSTL 1E6DM 1S00L 2WJNL 2HHKM 1JGYL 2UXJM 1OGVL 4HBHL 1K6NL 5PRCM 3V3YM 1PRCL 3V3ZM 2PRCM 2UWWL 3T6DM 4RCRM 1RQKM 2JIYM
chains in the Genus database with same CATH topology
4HBHM 2UX3L 3DU2L 2UWUL 2WX5L 2UWWM 1DV6M 1R2CL 2GNUM 3T6EM 1FNPL 2BNPA 1MPSM 4H99M 4H9LL 4LWYL 3ZUWL 3DU2M 1DXRM 1PCRL 2UWUM 1RZZL 7PRCM 3DTAL 3ZUMM 3DUQL 5LRIM 2HH1M 4IN7M 3DTRL 3WMML 1JH0L 1QOVM 1UMXL 1VRNM 4HBJL 2J8DL 1K6LM 2UXKL 4IN6M 3I4DM 2JBLL 1FNQL 2HG9M 2UXLL 1PSSM 2UXML 2UX4L 3PRCL 4TQQL 4CASC 2HJ6L 1JGZL 2X5UM 1JH0M 1PSTM 1S00M 2WJNM 3DSYL 1JGYM 2BOZL 1DS8L 2UX5L 1OGVM 1L9JL 2GMRL 1JGWL 1K6NM 2BNSA 2UXMM 1PRCM 1DV3L 1JGZM 2UWVL 3DSYM 2HITL 1RGNL 3T6EL 1RY5L 1L9JM 2UX3M 2WX5M 1L9BL 2UWTL 2UWVM 3G7FL 1R2CM 3D38L 1FNPM 1RGNM 1F6NL 2J8CL 1AIJL 4H9LM 1RVJL 4IN5L 1JGXL 4LWYM 3ZUWM 1PCRM 1RZZM 1EYSL 1RG5L 2UWTM 2BNPB 3DTAM 3D38M 1F6NM 3DUQM 1YSTL 2X5VL 1RVJM 1JGXM 2I5NL 2UWSL 1E14L 5LSEL 3DTRM 3DU3L 1RG5M 3WMMM 1RZHL 1UMXM 4HBJM 2J8DM 2UXKM 1M3XL 2RCRL 2JJ0L 3DTSL 2JBLM 1FNQM 2UWSM 1E14M 2UXLM 2WJML 2UX4M 3PRCM 4N7LL 4TQQM 2HJ6M 1KBYL 4CASB 6PRCL 1AIGL 4N7KL 2BOZM 1DS8M 1E6DL 1M3XM 2UX5M 2UXJL 2GMRM 1JGWM 6PRCM 5PRCL 1DV3M 1KBYM 3V3YL 3V3ZL 2PRCL 2HITM 1RY5M 3T6DL 4RCRL 2BNSB 1RQKL 2JIYL 1L9BM 2HG3L 3G7FM 2J8CM 1AIJM 1DV6L 2GNUL 4IN5M 1MPSL 4H99L 1DXRL 2HG3M 1EYSM 7PRCL 1YSTM 2X5VM 3ZUML 2I5NM 5LRIL 2HH1L 5LSEM 1YF6L 3DU3M 1RZHM 4IN7L 1QOVL 1VRNL 2RCRM 1K6LL 2HHKL 2JJ0M 3DTSM 4IN6L 4N7LM 2WJMM 3I4DL 1YF6M 2HG9L 1PSSL 2X5UL 1AIGM 4N7KM 1PSTL 1E6DM 1S00L 2WJNL 2HHKM 1JGYL 2UXJM 1OGVL 4HBHL 1K6NL 5PRCM 3V3YM 1PRCL 3V3ZM 2PRCM 2UWWL 3T6DM 4RCRM 1RQKM 2JIYM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HBH M;  2UX3 L;  3DU2 L;  2UWU L;  2WX5 L;  2UWW M;  1DV6 M;  1R2C L;  2GNU M;  3T6E M;  1FNP L;  2BNP A;  1MPS M;  4H99 M;  4H9L L;  4LWY L;  3ZUW L;  3DU2 M;  1DXR M;  1PCR L;  2UWU M;  1RZZ L;  7PRC M;  3DTA L;  3ZUM M;  3DUQ L;  5LRI M;  2HH1 M;  4IN7 M;  3DTR L;  3WMM L;  1JH0 L;  1QOV M;  1UMX L;  1VRN M;  4HBJ L;  2J8D L;  1K6L M;  2UXK L;  4IN6 M;  3I4D M;  2JBL L;  1FNQ L;  2HG9 M;  2UXL L;  1PSS M;  2UXM L;  2UX4 L;  3PRC L;  4TQQ L;  4CAS C;  2HJ6 L;  1JGZ L;  2X5U M;  1JH0 M;  1PST M;  1S00 M;  2WJN M;  3DSY L;  1JGY M;  2BOZ L;  1DS8 L;  2UX5 L;  1OGV M;  1L9J L;  2GMR L;  1JGW L;  1K6N M;  2BNS A;  2UXM M;  1PRC M;  1DV3 L;  1JGZ M;  2UWV L;  3DSY M;  2HIT L;  1RGN L;  3T6E L;  1RY5 L;  1L9J M;  2UX3 M;  2WX5 M;  1L9B L;  2UWT L;  2UWV M;  3G7F L;  1R2C M;  3D38 L;  1FNP M;  1RGN M;  1F6N L;  2J8C L;  1AIJ L;  4H9L M;  1RVJ L;  4IN5 L;  1JGX L;  4LWY M;  3ZUW M;  1PCR M;  1RZZ M;  1EYS L;  1RG5 L;  2UWT M;  2BNP B;  3DTA M;  3D38 M;  1F6N M;  3DUQ M;  1YST L;  2X5V L;  1RVJ M;  1JGX M;  2I5N L;  2UWS L;  1E14 L;  5LSE L;  3DTR M;  3DU3 L;  1RG5 M;  3WMM M;  1RZH L;  1UMX M;  4HBJ M;  2J8D M;  2UXK M;  1M3X L;  2RCR L;  2JJ0 L;  3DTS L;  2JBL M;  1FNQ M;  2UWS M;  1E14 M;  2UXL M;  2WJM L;  2UX4 M;  3PRC M;  4N7L L;  4TQQ M;  2HJ6 M;  1KBY L;  4CAS B;  6PRC L;  1AIG L;  4N7K L;  2BOZ M;  1DS8 M;  1E6D L;  1M3X M;  2UX5 M;  2UXJ L;  2GMR M;  1JGW M;  6PRC M;  5PRC L;  1DV3 M;  1KBY M;  3V3Y L;  3V3Z L;  2PRC L;  2HIT M;  1RY5 M;  3T6D L;  4RCR L;  2BNS B;  1RQK L;  2JIY L;  1L9B M;  2HG3 L;  3G7F M;  2J8C M;  1AIJ M;  1DV6 L;  2GNU L;  4IN5 M;  1MPS L;  4H99 L;  1DXR L;  2HG3 M;  1EYS M;  7PRC L;  1YST M;  2X5V M;  3ZUM L;  2I5N M;  5LRI L;  2HH1 L;  5LSE M;  1YF6 L;  3DU3 M;  1RZH M;  4IN7 L;  1QOV L;  1VRN L;  2RCR M;  1K6L L;  2HHK L;  2JJ0 M;  3DTS M;  4IN6 L;  4N7L M;  2WJM M;  3I4D L;  1YF6 M;  2HG9 L;  1PSS L;  2X5U L;  1AIG M;  4N7K M;  1PST L;  1E6D M;  1S00 L;  2WJN L;  2HHK M;  1JGY L;  2UXJ M;  1OGV L;  4HBH L;  1K6N L;  5PRC M;  3V3Y M;  1PRC L;  3V3Z M;  2PRC M;  2UWW L;  3T6D M;  4RCR M;  1RQK M;  2JIY M; 
#chains in the Genus database with same CATH topology
 4HBH M;  2UX3 L;  3DU2 L;  2UWU L;  2WX5 L;  2UWW M;  1DV6 M;  1R2C L;  2GNU M;  3T6E M;  1FNP L;  2BNP A;  1MPS M;  4H99 M;  4H9L L;  4LWY L;  3ZUW L;  3DU2 M;  1DXR M;  1PCR L;  2UWU M;  1RZZ L;  7PRC M;  3DTA L;  3ZUM M;  3DUQ L;  5LRI M;  2HH1 M;  4IN7 M;  3DTR L;  3WMM L;  1JH0 L;  1QOV M;  1UMX L;  1VRN M;  4HBJ L;  2J8D L;  1K6L M;  2UXK L;  4IN6 M;  3I4D M;  2JBL L;  1FNQ L;  2HG9 M;  2UXL L;  1PSS M;  2UXM L;  2UX4 L;  3PRC L;  4TQQ L;  4CAS C;  2HJ6 L;  1JGZ L;  2X5U M;  1JH0 M;  1PST M;  1S00 M;  2WJN M;  3DSY L;  1JGY M;  2BOZ L;  1DS8 L;  2UX5 L;  1OGV M;  1L9J L;  2GMR L;  1JGW L;  1K6N M;  2BNS A;  2UXM M;  3WRY C;  1PRC M;  1DV3 L;  1JGZ M;  2UWV L;  3DSY M;  2HIT L;  1RGN L;  3T6E L;  1RY5 L;  1L9J M;  2UX3 M;  2WX5 M;  3VKW A;  1L9B L;  2UWT L;  2UWV M;  3G7F L;  1R2C M;  3D38 L;  1FNP M;  1RGN M;  1F6N L;  2J8C L;  1AIJ L;  4H9L M;  1RVJ L;  4IN5 L;  1JGX L;  4LWY M;  3ZUW M;  1PCR M;  1RZZ M;  1EYS L;  1RG5 L;  2UWT M;  2BNP B;  3DTA M;  3D38 M;  1F6N M;  3DUQ M;  1YST L;  2X5V L;  1RVJ M;  1JGX M;  2I5N L;  2UWS L;  1E14 L;  5LSE L;  3WRX C;  3DTR M;  3DU3 L;  1RG5 M;  3WMM M;  1RZH L;  1UMX M;  4HBJ M;  2J8D M;  2UXK M;  1M3X L;  2RCR L;  2JJ0 L;  3DTS L;  2JBL M;  1FNQ M;  2UWS M;  1E14 M;  2UXL M;  2WJM L;  2UX4 M;  3PRC M;  4N7L L;  4TQQ M;  2HJ6 M;  1KBY L;  4CAS B;  6PRC L;  1AIG L;  4N7K L;  2BOZ M;  1DS8 M;  1E6D L;  1M3X M;  2UX5 M;  2UXJ L;  2GMR M;  1JGW M;  6PRC M;  5PRC L;  1DV3 M;  1KBY M;  3V3Y L;  3V3Z L;  2PRC L;  2HIT M;  1RY5 M;  3T6D L;  4RCR L;  2BNS B;  1RQK L;  2JIY L;  1L9B M;  2HG3 L;  3G7F M;  2J8C M;  1AIJ M;  1DV6 L;  2GNU L;  4IN5 M;  1MPS L;  4H99 L;  1DXR L;  2HG3 M;  1EYS M;  7PRC L;  1YST M;  2X5V M;  3ZUM L;  2I5N M;  5LRI L;  2HH1 L;  5LSE M;  1YF6 L;  3DU3 M;  1RZH M;  4IN7 L;  1QOV L;  1VRN L;  2RCR M;  1K6L L;  2HHK L;  2JJ0 M;  3DTS M;  4IN6 L;  4N7L M;  2WJM M;  3I4D L;  1YF6 M;  2HG9 L;  1PSS L;  2X5U L;  1AIG M;  4N7K M;  1PST L;  1E6D M;  1S00 L;  2WJN L;  2HHK M;  1JGY L;  2UXJ M;  1OGV L;  4HBH L;  1K6N L;  5PRC M;  3V3Y M;  1PRC L;  3V3Z M;  2PRC M;  2UWW L;  3T6D M;  4RCR M;  1RQK M;  2JIY M; 
#chains in the Genus database with same CATH homology
 4HBH M;  2UX3 L;  3DU2 L;  2UWU L;  2WX5 L;  2UWW M;  1DV6 M;  1R2C L;  2GNU M;  3T6E M;  1FNP L;  2BNP A;  1MPS M;  4H99 M;  4H9L L;  4LWY L;  3ZUW L;  3DU2 M;  1DXR M;  1PCR L;  2UWU M;  1RZZ L;  7PRC M;  3DTA L;  3ZUM M;  3DUQ L;  5LRI M;  2HH1 M;  4IN7 M;  3DTR L;  3WMM L;  1JH0 L;  1QOV M;  1UMX L;  1VRN M;  4HBJ L;  2J8D L;  1K6L M;  2UXK L;  4IN6 M;  3I4D M;  2JBL L;  1FNQ L;  2HG9 M;  2UXL L;  1PSS M;  2UXM L;  2UX4 L;  3PRC L;  4TQQ L;  4CAS C;  2HJ6 L;  1JGZ L;  2X5U M;  1JH0 M;  1PST M;  1S00 M;  2WJN M;  3DSY L;  1JGY M;  2BOZ L;  1DS8 L;  2UX5 L;  1OGV M;  1L9J L;  2GMR L;  1JGW L;  1K6N M;  2BNS A;  2UXM M;  1PRC M;  1DV3 L;  1JGZ M;  2UWV L;  3DSY M;  2HIT L;  1RGN L;  3T6E L;  1RY5 L;  1L9J M;  2UX3 M;  2WX5 M;  1L9B L;  2UWT L;  2UWV M;  3G7F L;  1R2C M;  3D38 L;  1FNP M;  1RGN M;  1F6N L;  2J8C L;  1AIJ L;  4H9L M;  1RVJ L;  4IN5 L;  1JGX L;  4LWY M;  3ZUW M;  1PCR M;  1RZZ M;  1EYS L;  1RG5 L;  2UWT M;  2BNP B;  3DTA M;  3D38 M;  1F6N M;  3DUQ M;  1YST L;  2X5V L;  1RVJ M;  1JGX M;  2I5N L;  2UWS L;  1E14 L;  5LSE L;  3DTR M;  3DU3 L;  1RG5 M;  3WMM M;  1RZH L;  1UMX M;  4HBJ M;  2J8D M;  2UXK M;  1M3X L;  2RCR L;  2JJ0 L;  3DTS L;  2JBL M;  1FNQ M;  2UWS M;  1E14 M;  2UXL M;  2WJM L;  2UX4 M;  3PRC M;  4N7L L;  4TQQ M;  2HJ6 M;  1KBY L;  4CAS B;  6PRC L;  1AIG L;  4N7K L;  2BOZ M;  1DS8 M;  1E6D L;  1M3X M;  2UX5 M;  2UXJ L;  2GMR M;  1JGW M;  6PRC M;  5PRC L;  1DV3 M;  1KBY M;  3V3Y L;  3V3Z L;  2PRC L;  2HIT M;  1RY5 M;  3T6D L;  4RCR L;  2BNS B;  1RQK L;  2JIY L;  1L9B M;  2HG3 L;  3G7F M;  2J8C M;  1AIJ M;  1DV6 L;  2GNU L;  4IN5 M;  1MPS L;  4H99 L;  1DXR L;  2HG3 M;  1EYS M;  7PRC L;  1YST M;  2X5V M;  3ZUM L;  2I5N M;  5LRI L;  2HH1 L;  5LSE M;  1YF6 L;  3DU3 M;  1RZH M;  4IN7 L;  1QOV L;  1VRN L;  2RCR M;  1K6L L;  2HHK L;  2JJ0 M;  3DTS M;  4IN6 L;  4N7L M;  2WJM M;  3I4D L;  1YF6 M;  2HG9 L;  1PSS L;  2X5U L;  1AIG M;  4N7K M;  1PST L;  1E6D M;  1S00 L;  2WJN L;  2HHK M;  1JGY L;  2UXJ M;  1OGV L;  4HBH L;  1K6N L;  5PRC M;  3V3Y M;  1PRC L;  3V3Z M;  2PRC M;  2UWW L;  3T6D M;  4RCR M;  1RQK M;  2JIY M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...