The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
29
|
sequence length |
94
|
structure length |
94
|
Chain Sequence |
STRGDLIRILGEIEEKMNELKMDGFNPDIILFGREAYNFLSNLLKKEMEEEGPFTHVSNIKIEILEELGGDAVVIDSKVLGLVPGAAKRIKIIK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structure of the hypothetical protein PF0899 from Pyrococcus furiosus at 1.85 A resolution.
pubmed doi rcsb |
| molecule keywords |
Uncharacterized protein PF0899
|
| molecule tags |
Structural genomics, unknown function
|
| source organism |
Pyrococcus furiosus dsm 3638
|
| total genus |
29
|
| structure length |
94
|
| sequence length |
94
|
| ec nomenclature | |
| pdb deposition date | 2007-04-17 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF08967 | DUF1884 | Domain of unknown function (DUF1884) |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | hypothetical protein PF0899 fold | hypothetical protein PF0899 domain |
#chains in the Genus database with same CATH superfamily 2FT1 A; 2PK8 A; 2FSY A; 3E8K A; 2E0Z A; 1OHG A; 3DKT A; #chains in the Genus database with same CATH topology 3A43 A; 5AUN A; 3E8K A; 2KDX A; 3V6I A; 2DMA A; 3A44 A; 4DT0 A; 1WZ2 A; 2FT1 A; 2PK8 A; 4EFA E; 2FSY A; 3K5B A; 1QU3 A; 4DL0 E; 5AUO A; 2LC0 A; 2E0Z A; 1OHG A; 3DKT A; 1YUE A; 5AUP A; 2DM9 A; #chains in the Genus database with same CATH homology 2FT1 A; 2PK8 A; 2FSY A; 3E8K A; 2E0Z A; 1OHG A; 3DKT A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...