The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
29
|
sequence length |
73
|
structure length |
73
|
Chain Sequence |
EIDTLREEIDRLDAEILALVKRRAEVSKAIGKARMASGGTRLVHSREMKVIERYSELGPDGKDLAILLLRLGR
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Isomerase
|
source organism |
Mycobacterium tuberculosis
|
publication title |
A comparative biochemical and structural analysis of the intracellular chorismate mutase (Rv0948c) from Mycobacterium tuberculosis H(37)R(v) and the secreted chorismate mutase (y2828) from Yersinia pestis.
pubmed doi rcsb |
molecule keywords |
CHORISMATE MUTASE
|
total genus |
29
|
structure length |
73
|
sequence length |
73
|
ec nomenclature |
ec
5.4.99.5: Chorismate mutase. |
pdb deposition date | 2007-06-18 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF01817 | CM_2 | Chorismate mutase type II |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Up-down Bundle | Chorismate Mutase Domain, subunit A | Chorismate mutase |
#chains in the Genus database with same CATH superfamily 3TFC A; 1YBZ A; 2H9C A; 2VKL A; 2QBV A; 2D8E A; 3HGW A; 3REM A; 2W19 C; 1ECM A; 3RMI A; 3RET A; 2D8D A; 3HGX A; 3NVT A; 5CKX C; 2W1A C; 2H9D A; 2GTV X; #chains in the Genus database with same CATH topology 3TFC A; 1YBZ A; 2H9C A; 1NI5 A; 2VKL A; 2QBV A; 2D8E A; 3HGW A; 3REM A; 3A2K A; 2W19 C; 2E21 A; 1ECM A; 3RMI A; 2E89 A; 3RET A; 2D8D A; 3HGX A; 3NVT A; 5CKX C; 1WY5 A; 2W1A C; 2H9D A; 2GTV X; #chains in the Genus database with same CATH homology 3TFC A; 1YBZ A; 2H9C A; 2VKL A; 2QBV A; 2D8E A; 3HGW A; 3REM A; 2W19 C; 1ECM A; 3RMI A; 3RET A; 2D8D A; 3HGX A; 3NVT A; 5CKX C; 2W1A C; 2H9D A; 2GTV X;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...