The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
57
|
sequence length |
206
|
structure length |
203
|
Chain Sequence |
GMALQLSREQGITARGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDLELIKYLNNVVEQLKDWLYKSSVQKLVVVISNIESGEVLERWQFDIESDKTASAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEEVRLRSFTTTIHKVNSMVAYKIPVND
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Insights Into MAD2 Regulation in the Spindle Checkpoint Revealed by the Crystal Structure of the Symmetric MAD2 Dimer.
pubmed doi rcsb |
| molecule keywords |
MITOTIC SPINDLE ASSEMBLY CHECKPOINT PROTEIN MAD2A
|
| molecule tags |
Cell cycle
|
| source organism |
Homo sapiens
|
| total genus |
57
|
| structure length |
203
|
| sequence length |
206
|
| chains with identical sequence |
B, C, D, E, F, G, H, I, J, K, L
|
| ec nomenclature | |
| pdb deposition date | 2007-11-05 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF02301 | HORMA | HORMA domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | Cell Cycle, Spindle Assembly Checkpoint Protein; Chain A | HORMA domain |
#chains in the Genus database with same CATH superfamily 4J2G A; 4TZM A; 1S2H A; 2V64 A; 4TZQ A; 5LCW Z; 1DUJ A; 2VFX A; 4TZO A; 4TZS A; 2QYF A; 3ABD A; 3ABE C; 4YK8 B; 4GK5 A; 3VU7 C; 2V64 D; 3GMH A; 4FJO C; 1GO4 A; 4AEZ B; 5C50 B; 4TZL A; 4TZN A; 4EXT C; 1KLQ A; 4TZJ A; 4TRK A; 4GK0 A; #chains in the Genus database with same CATH topology 4J2G A; 4TZM A; 1S2H A; 2V64 A; 4TZQ A; 5LCW Z; 1DUJ A; 2VFX A; 4TZO A; 4TZS A; 2QYF A; 3ABD A; 3ABE C; 4YK8 B; 4GK5 A; 3VU7 C; 2V64 D; 3GMH A; 4FJO C; 1GO4 A; 4AEZ B; 2QYF B; 5C50 B; 4TZL A; 4TZN A; 4EXT C; 1KLQ A; 4TZJ A; 4TRK A; 4GK0 A; #chains in the Genus database with same CATH homology 4J2G A; 4TZM A; 1S2H A; 2V64 A; 4TZQ A; 5LCW Z; 1DUJ A; 2VFX A; 4TZO A; 4TZS A; 2QYF A; 3ABD A; 3ABE C; 4YK8 B; 4GK5 A; 3VU7 C; 2V64 D; 3GMH A; 4FJO C; 1GO4 A; 4AEZ B; 5C50 B; 4TZL A; 4TZN A; 4EXT C; 1KLQ A; 4TZJ A; 4TRK A; 4GK0 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...