The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
50
|
sequence length |
193
|
structure length |
193
|
Chain Sequence |
SITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDLELIKYLNNVVEQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEEVRLRSFTTTIHKVNSMVAYKIP
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structure of an intermediate conformer of the spindle checkpoint protein Mad2.
pubmed doi rcsb |
molecule tags |
Cell cycle
|
source organism |
Homo sapiens
|
molecule keywords |
Mitotic spindle assembly checkpoint protein MAD2A
|
total genus |
50
|
structure length |
193
|
sequence length |
193
|
chains with identical sequence |
B, C, D, E, F, G, H, I, J, K, L
|
ec nomenclature | |
pdb deposition date | 2009-03-13 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF02301 | HORMA | HORMA domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | Cell Cycle, Spindle Assembly Checkpoint Protein; Chain A | HORMA domain |
#chains in the Genus database with same CATH superfamily 4GK0 A; 4TZO A; 1DUJ A; 4TZL A; 2VFX A; 4TRK A; 2V64 D; 4YK8 B; 3ABD A; 4J2G A; 4AEZ B; 1KLQ A; 4EXT C; 3GMH A; 4TZN A; 4TZJ A; 4TZQ A; 2QYF A; 5C50 B; 2V64 A; 4FJO C; 4TZS A; 4TZM A; 3ABE C; 5LCW Z; 1S2H A; 4GK5 A; 3VU7 C; 1GO4 A; #chains in the Genus database with same CATH topology 2QYF B; 4GK0 A; 4TZO A; 1DUJ A; 4TZL A; 2VFX A; 4TRK A; 2V64 D; 4YK8 B; 3ABD A; 4J2G A; 4AEZ B; 1KLQ A; 4EXT C; 3GMH A; 4TZN A; 4TZJ A; 4TZQ A; 2QYF A; 5C50 B; 2V64 A; 4FJO C; 4TZS A; 4TZM A; 3ABE C; 5LCW Z; 1S2H A; 4GK5 A; 3VU7 C; 1GO4 A; #chains in the Genus database with same CATH homology 4GK0 A; 4TZO A; 1DUJ A; 4TZL A; 2VFX A; 4TRK A; 2V64 D; 4YK8 B; 3ABD A; 4J2G A; 4AEZ B; 1KLQ A; 4EXT C; 3GMH A; 4TZN A; 4TZJ A; 4TZQ A; 2QYF A; 5C50 B; 2V64 A; 4FJO C; 4TZS A; 4TZM A; 3ABE C; 5LCW Z; 1S2H A; 4GK5 A; 3VU7 C; 1GO4 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...