The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
39
|
sequence length |
99
|
structure length |
99
|
Chain Sequence |
MKTPEDCTGLADIREAIDRIDLDIVQALGRRMDYVKAASRFAASEAAIPAPERVAAMLPERARWAEENGLDAPFVEGLFAQIIHWYIAEQIKYWRQTRG
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structure-function analyses of isochorismate-pyruvate lyase from Pseudomonas aeruginosa suggest differing catalytic mechanisms for the two pericyclic reactions of this bifunctional enzyme.
pubmed doi rcsb |
| molecule tags |
Lyase
|
| source organism |
Pseudomonas aeruginosa
|
| molecule keywords |
Salicylate biosynthesis protein pchB
|
| total genus |
39
|
| structure length |
99
|
| sequence length |
99
|
| chains with identical sequence |
B
|
| ec nomenclature |
ec
4.2.99.21: Isochorismate lyase. |
| pdb deposition date | 2009-05-14 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF01817 | CM_2 | Chorismate mutase type II |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Up-down Bundle | Chorismate Mutase Domain, subunit A | Chorismate mutase |
#chains in the Genus database with same CATH superfamily 2D8E A; 2QBV A; 2D8D A; 5CKX C; 2H9C A; 3NVT A; 1YBZ A; 2W19 C; 2GTV X; 2VKL A; 3HGW A; 2W1A C; 1ECM A; 2H9D A; 3RET A; 3HGX A; 3RMI A; 3TFC A; 3REM A; #chains in the Genus database with same CATH topology 2D8E A; 2QBV A; 2D8D A; 5CKX C; 2H9C A; 3NVT A; 1YBZ A; 3A2K A; 1NI5 A; 2W19 C; 2GTV X; 1WY5 A; 2VKL A; 3HGW A; 2W1A C; 1ECM A; 2H9D A; 3RET A; 2E21 A; 3HGX A; 2E89 A; 3RMI A; 3TFC A; 3REM A; #chains in the Genus database with same CATH homology 2D8E A; 2QBV A; 2D8D A; 5CKX C; 2H9C A; 3NVT A; 1YBZ A; 2W19 C; 2GTV X; 2VKL A; 3HGW A; 2W1A C; 1ECM A; 2H9D A; 3RET A; 3HGX A; 3RMI A; 3TFC A; 3REM A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
