The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
74
|
sequence length |
377
|
structure length |
376
|
Chain Sequence |
EDVERLLCQKYPGLAAELQPSGACIIRGVLGSEDTWRRLKLYLPHHPALHGFQLYVQESLEYKLYTSANLKLQDDWLLEDFLDHLPKILPAQKAPTVPELCREGNIYYDILALYKSNEYCLQVDEACSMIRFSEFTDFEQHYLELKIPSLLLLDHSLPDCVSLGEMLTKSAGNLEEALNLFRKLLEDLRPFYDNFMDIDELCHVLQPSPISSKHKTRLFPLKDRVYLKLTIADPFACIASMSLKIIGPTEEVARLRHVLSDGLSNWDSEMNIHKNLLRMFDLCYFPMPDWSDGPKLDEEDNEELRCNICFAYRLDGGEVPLVSCDNAKCVLKCHAVCLEEWFKTLMDGKTFLEVSFGQCPFCKAKLSTSFAALLND
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
The structure of the catalytic subunit FANCL of the Fanconi anemia core complex
pubmed doi rcsb |
| molecule tags |
Ligase
|
| source organism |
Drosophila melanogaster
|
| molecule keywords |
Fancl
|
| total genus |
74
|
| structure length |
376
|
| sequence length |
377
|
| chains with identical sequence |
B
|
| ec nomenclature |
ec
6.3.2.19: Transferred entry: 2.3.2.23, 2.3.2.27 and 6.2.1.45. |
| pdb deposition date | 2009-09-28 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF09765 | WD-3 | WD-repeat region |
| A | PF11793 | FANCL_C | FANCL C-terminal domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | Copper Amine Oxidase; Chain A, domain 1 | Copper Amine Oxidase; Chain A, domain 1 | ||
| Alpha Beta | 2-Layer Sandwich | Copper Amine Oxidase; Chain A, domain 1 | Copper Amine Oxidase; Chain A, domain 1 |
#chains in the Genus database with same CATH superfamily 3K1L A; #chains in the Genus database with same CATH topology 5TCS D; 2FV4 A; 1QAK A; 2WGQ A; 2W0Q A; 1JRQ A; 2WOF A; 2FTX A; 1D6Y A; 1D6U A; 4GEQ A; 3VZA A; 2WOH A; 1DYU A; 1OAC A; 3K1L A; 1QAL A; 4DZO A; 3VZ9 B; 5T6J B; 1QAF A; 2WO0 A; 1SPU A; 1D6Z A; 1LVN A; #chains in the Genus database with same CATH homology 5TCS D; 2FTX A; 2FV4 A; 3K1L A; 3VZA A; 4DZO A; 3VZ9 B; 4GEQ A; 5T6J B;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
