5TCSD

Crystal structure of a dwarf ndc80 tetramer
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
114
structure length
114
Chain Sequence
b'ASIDAFSDLERRMDGFQKDVAQVLARQQNHVALYERLLQLRVLPGASDVHDVRFVFGDDSRCWIEVAMHGDHVIGNSHPALDPKSRATLEHVLTVQGDLAAFLVVARDMLLASL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kinetochore protein NDC80
publication title Conserved Tetramer Junction in the Kinetochore Ndc80 Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Replication
total genus 27
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2016-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.457.50 Alpha Beta 2-Layer Sandwich Copper Amine Oxidase; Chain A, domain 1 Copper Amine Oxidase; Chain A, domain 1 5tcsD00
2FV4A 3VZ9B 5T6JB 5TCSD 4GEQA 3VZAA 2FTXA
chains in the Genus database with same CATH superfamily
3VZ9B 1QAFA 1QALA 5TCSD 2WGQA 3VZAA 2FTXA 1SPUA 4GEQA 2WOFA 2WOHA 1D6UA 2WO0A 1QAKA 1JRQA 3K1LA 1OACA 2W0QA 4DZOA 2FV4A 5T6JB 1LVNA 1DYUA 1D6YA 1D6ZA
chains in the Genus database with same CATH topology
2FV4A 3VZ9B 3K1LA 5T6JB 5TCSD 4GEQA 4DZOA 3VZAA 2FTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FV4 A;  3VZ9 B;  5T6J B;  5TCS D;  4GEQ A;  3VZA A;  2FTX A; 
#chains in the Genus database with same CATH topology
 3VZ9 B;  1QAF A;  1QAL A;  5TCS D;  2WGQ A;  3VZA A;  2FTX A;  1SPU A;  4GEQ A;  2WOF A;  2WOH A;  1D6U A;  2WO0 A;  1QAK A;  1JRQ A;  3K1L A;  1OAC A;  2W0Q A;  4DZO A;  2FV4 A;  5T6J B;  1LVN A;  1DYU A;  1D6Y A;  1D6Z A; 
#chains in the Genus database with same CATH homology
 2FV4 A;  3VZ9 B;  3K1L A;  5T6J B;  5TCS D;  4GEQ A;  4DZO A;  3VZA A;  2FTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...