3T6DL

Crystal structure of the reaction centre from blastochloris viridis strain dsm 133 (atcc 19567) substrain-08
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
273
structure length
273
Chain Sequence
ALLSFERKYRVRGGTLIGGDLFDFWVGPYFVGFFGVSAIFFIFLGVSLIGYAASQGPTWDPFAISINPPDLKYGLGAAPLLEGGFWQAITVCALGAFISWMLREVEISRKLGIGWHVPLAFCVPIFMFCVLQVFRPLLLGSWGHAFPYGILSHLDWVNNFGYQYLNWHYNPGHMSSVSFLFVNAMALGLHGGLILSVANPGDGDKVKTAEHENQYFRDVVGYSIGALSIHRLGLFLASNIFLTGAFGTIASGPFWTRGWPEWWGWWLDIPFWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Electron transport
molecule keywords Photosynthetic reaction center cytochrome c subunit
publication title New insights into the structure of the reaction centre from Blastochloris viridis: evolution in the laboratory.
pubmed doi rcsb
total genus 103
structure length 273
sequence length 273
ec nomenclature
pdb deposition date 2011-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00124 Photo_RC Photosynthetic reaction centre protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.85.10 Mainly Alpha Up-down Bundle Photosynthetic Reaction Center, subunit M; domain 1 Photosystem II protein D1-like 3t6dL01
1.20.85.10 Mainly Alpha Up-down Bundle Photosynthetic Reaction Center, subunit M; domain 1 Photosystem II protein D1-like 3t6dL02
2JJ0L 1M3XL 2WJML 1UMXL 2GNUL 3I4DM 1JGWM 2UXMM 4LWYM 4N7KL 1JH0L 2HH1L 2RCRM 4H9LL 3ZUWM 1PCRM 1FNQM 2UX4L 2HG3L 2UWVM 1EYSL 4CASC 1RQKM 2UX3M 2WX5M 1YSTL 3DTRM 2WJNL 1PSTM 4IN7L 1AIGL 3DU3L 2I5NL 5PRCL 1RZHL 2J8CL 1JGYL 1R2CM 2PRCM 1E6DM 3V3ZM 1DXRL 2X5VM 3V3YL 3ZUML 2UXLL 1VRNM 3DTSL 1FNPL 1E14M 1RVJM 2HG9L 2UX5L 4HBJM 1RY5M 1QOVL 1KBYL 2UXKL 3PRCL 3G7FM 1K6NL 1K6LL 1L9JM 2BNPB 1DV3L 2HHKL 2JBLL 2UXJM 7PRCM 1RG5M 1JH0M 2HJ6M 1MPSL 4HBHM 2HITM 1AIJL 2UWSM 2JIYM 4IN5L 1L9BM 1JGZL 1PSSL 1S00L 2UWTL 3DSYL 4TQQL 6PRCL 1RZZM 1OGVL 1PRCL 3T6EM 3WMMM 5LRIM 5LSEM 1DV6M 1RGNM 1YF6L 2J8DM 3DU2L 4CASB 3D38M 3DUQM 5PRCM 1JGXM 2X5UL 1DS8L 4N7LM 4IN6M 2GMRM 2BNSA 2UXLM 3I4DL 4RCRM 2UWWM 1JGWL 2UWUM 2UXML 3DTAM 4H99M 4LWYL 2RCRL 3ZUWL 1PCRL 2BOZM 1FNQL 2UWVL 2JJ0M 1M3XM 2WJMM 1UMXM 2GNUM 1RQKL 2UX3L 4N7KM 2WX5L 1F6NL 2HH1M 3DTRL 1PSTL 4H9LM 2UX4M 2HG3M 1EYSM 1R2CL 4IN5M 2PRCL 1E6DL 3V3ZL 2X5VL 1YSTM 2WJNM 4IN7M 1VRNL 1AIGM 3DU3M 2I5NM 1E14L 1RVJL 1RZHM 2J8CM 4HBJL 1JGYM 3G7FL 3T6DM 1DXRM 3ZUMM 3V3YM 1L9JL 2UXJL 3DTSM 7PRCL 1FNPM 1RG5L 2HJ6L 2HG9M 2UX5M 4HBHL 1QOVM 1KBYM 2HITL 2UXKM 3PRCM 2UWSL 2JIYL 1L9BL 2BNSB 1K6NM 1K6LM 2JBLM 2HHKM 1DV3M 1RZZL 3T6EL 1F6NM 3WMML 5LRIL 5LSEL 1DV6L 1MPSM 1RGNL 2J8DL 1AIJM 3D38L 3DUQL 1S00M 1JGZM 1JGXL 1PSSM 2UWTM 3DSYM 4TQQM 6PRCM 4N7LL 1OGVM 4IN6L 1PRCM 2GMRL 3T6DL 4RCRL 1YF6M 2BNPA 2UWWL 2UWUL 3DTAL 4H99L 3DU2M 1RY5L 2X5UM 2BOZL 1DS8M
chains in the Genus database with same CATH superfamily
2JJ0L 1M3XL 2WJML 1UMXL 2GNUL 3I4DM 1JGWM 2UXMM 4LWYM 4N7KL 1JH0L 2HH1L 2RCRM 4H9LL 3ZUWM 1PCRM 1FNQM 2UX4L 2HG3L 2UWVM 1EYSL 4CASC 1RQKM 2UX3M 2WX5M 1YSTL 3DTRM 2WJNL 1PSTM 4IN7L 1AIGL 3DU3L 2I5NL 5PRCL 1RZHL 2J8CL 1JGYL 1R2CM 2PRCM 1E6DM 3V3ZM 1DXRL 2X5VM 3V3YL 3ZUML 2UXLL 1VRNM 3DTSL 1FNPL 1E14M 1RVJM 2HG9L 2UX5L 4HBJM 1RY5M 1QOVL 1KBYL 2UXKL 3PRCL 3G7FM 1K6NL 1K6LL 1L9JM 2BNPB 1DV3L 2HHKL 2JBLL 2UXJM 7PRCM 1RG5M 3WRXC 1JH0M 2HJ6M 1MPSL 4HBHM 2HITM 1AIJL 2UWSM 2JIYM 4IN5L 1L9BM 1JGZL 1PSSL 1S00L 2UWTL 3DSYL 4TQQL 6PRCL 1RZZM 1OGVL 1PRCL 3T6EM 3WMMM 5LRIM 5LSEM 1DV6M 1RGNM 1YF6L 2J8DM 3DU2L 4CASB 3D38M 3DUQM 5PRCM 1JGXM 2X5UL 1DS8L 4N7LM 4IN6M 2GMRM 2BNSA 2UXLM 3I4DL 4RCRM 2UWWM 1JGWL 2UWUM 2UXML 3DTAM 4H99M 4LWYL 2RCRL 3ZUWL 1PCRL 2BOZM 1FNQL 2UWVL 2JJ0M 1M3XM 2WJMM 1UMXM 2GNUM 1RQKL 2UX3L 4N7KM 2WX5L 1F6NL 2HH1M 3DTRL 1PSTL 3VKWA 4H9LM 2UX4M 2HG3M 1EYSM 1R2CL 4IN5M 2PRCL 1E6DL 3V3ZL 2X5VL 1YSTM 2WJNM 4IN7M 1VRNL 3WRYC 1AIGM 3DU3M 2I5NM 1E14L 1RVJL 1RZHM 2J8CM 4HBJL 1JGYM 3G7FL 3T6DM 1DXRM 3ZUMM 3V3YM 1L9JL 2UXJL 3DTSM 7PRCL 1FNPM 1RG5L 2HJ6L 2HG9M 2UX5M 4HBHL 1QOVM 1KBYM 2HITL 2UXKM 3PRCM 2UWSL 2JIYL 1L9BL 2BNSB 1K6NM 1K6LM 2JBLM 2HHKM 1DV3M 1RZZL 3T6EL 1F6NM 3WMML 5LRIL 5LSEL 1DV6L 1MPSM 1RGNL 2J8DL 1AIJM 3D38L 3DUQL 1S00M 1JGZM 1JGXL 1PSSM 2UWTM 3DSYM 4TQQM 6PRCM 4N7LL 1OGVM 4IN6L 1PRCM 2GMRL 3T6DL 4RCRL 1YF6M 2BNPA 2UWWL 2UWUL 3DTAL 4H99L 3DU2M 1RY5L 2X5UM 2BOZL 1DS8M
chains in the Genus database with same CATH topology
2JJ0L 1M3XL 2WJML 1UMXL 2GNUL 3I4DM 1JGWM 2UXMM 4LWYM 4N7KL 1JH0L 2HH1L 2RCRM 4H9LL 3ZUWM 1PCRM 1FNQM 2UX4L 2HG3L 2UWVM 1EYSL 4CASC 1RQKM 2UX3M 2WX5M 1YSTL 3DTRM 2WJNL 1PSTM 4IN7L 1AIGL 3DU3L 2I5NL 5PRCL 1RZHL 2J8CL 1JGYL 1R2CM 2PRCM 1E6DM 3V3ZM 1DXRL 2X5VM 3V3YL 3ZUML 2UXLL 1VRNM 3DTSL 1FNPL 1E14M 1RVJM 2HG9L 2UX5L 4HBJM 1RY5M 1QOVL 1KBYL 2UXKL 3PRCL 3G7FM 1K6NL 1K6LL 1L9JM 2BNPB 1DV3L 2HHKL 2JBLL 2UXJM 7PRCM 1RG5M 1JH0M 2HJ6M 1MPSL 4HBHM 2HITM 1AIJL 2UWSM 2JIYM 4IN5L 1L9BM 1JGZL 1PSSL 1S00L 2UWTL 3DSYL 4TQQL 6PRCL 1RZZM 1OGVL 1PRCL 3T6EM 3WMMM 5LRIM 5LSEM 1DV6M 1RGNM 1YF6L 2J8DM 3DU2L 4CASB 3D38M 3DUQM 5PRCM 1JGXM 2X5UL 1DS8L 4N7LM 4IN6M 2GMRM 2BNSA 2UXLM 3I4DL 4RCRM 2UWWM 1JGWL 2UWUM 2UXML 3DTAM 4H99M 4LWYL 2RCRL 3ZUWL 1PCRL 2BOZM 1FNQL 2UWVL 2JJ0M 1M3XM 2WJMM 1UMXM 2GNUM 1RQKL 2UX3L 4N7KM 2WX5L 1F6NL 2HH1M 3DTRL 1PSTL 4H9LM 2UX4M 2HG3M 1EYSM 1R2CL 4IN5M 2PRCL 1E6DL 3V3ZL 2X5VL 1YSTM 2WJNM 4IN7M 1VRNL 1AIGM 3DU3M 2I5NM 1E14L 1RVJL 1RZHM 2J8CM 4HBJL 1JGYM 3G7FL 3T6DM 1DXRM 3ZUMM 3V3YM 1L9JL 2UXJL 3DTSM 7PRCL 1FNPM 1RG5L 2HJ6L 2HG9M 2UX5M 4HBHL 1QOVM 1KBYM 2HITL 2UXKM 3PRCM 2UWSL 2JIYL 1L9BL 2BNSB 1K6NM 1K6LM 2JBLM 2HHKM 1DV3M 1RZZL 3T6EL 1F6NM 3WMML 5LRIL 5LSEL 1DV6L 1MPSM 1RGNL 2J8DL 1AIJM 3D38L 3DUQL 1S00M 1JGZM 1JGXL 1PSSM 2UWTM 3DSYM 4TQQM 6PRCM 4N7LL 1OGVM 4IN6L 1PRCM 2GMRL 3T6DL 4RCRL 1YF6M 2BNPA 2UWWL 2UWUL 3DTAL 4H99L 3DU2M 1RY5L 2X5UM 2BOZL 1DS8M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JJ0 L;  1M3X L;  2WJM L;  1UMX L;  2GNU L;  3I4D M;  1JGW M;  2UXM M;  4LWY M;  4N7K L;  1JH0 L;  2HH1 L;  2RCR M;  4H9L L;  3ZUW M;  1PCR M;  1FNQ M;  2UX4 L;  2HG3 L;  2UWV M;  1EYS L;  4CAS C;  1RQK M;  2UX3 M;  2WX5 M;  1YST L;  3DTR M;  2WJN L;  1PST M;  4IN7 L;  1AIG L;  3DU3 L;  2I5N L;  5PRC L;  1RZH L;  2J8C L;  1JGY L;  1R2C M;  2PRC M;  1E6D M;  3V3Z M;  1DXR L;  2X5V M;  3V3Y L;  3ZUM L;  2UXL L;  1VRN M;  3DTS L;  1FNP L;  1E14 M;  1RVJ M;  2HG9 L;  2UX5 L;  4HBJ M;  1RY5 M;  1QOV L;  1KBY L;  2UXK L;  3PRC L;  3G7F M;  1K6N L;  1K6L L;  1L9J M;  2BNP B;  1DV3 L;  2HHK L;  2JBL L;  2UXJ M;  7PRC M;  1RG5 M;  1JH0 M;  2HJ6 M;  1MPS L;  4HBH M;  2HIT M;  1AIJ L;  2UWS M;  2JIY M;  4IN5 L;  1L9B M;  1JGZ L;  1PSS L;  1S00 L;  2UWT L;  3DSY L;  4TQQ L;  6PRC L;  1RZZ M;  1OGV L;  1PRC L;  3T6E M;  3WMM M;  5LRI M;  5LSE M;  1DV6 M;  1RGN M;  1YF6 L;  2J8D M;  3DU2 L;  4CAS B;  3D38 M;  3DUQ M;  5PRC M;  1JGX M;  2X5U L;  1DS8 L;  4N7L M;  4IN6 M;  2GMR M;  2BNS A;  2UXL M;  3I4D L;  4RCR M;  2UWW M;  1JGW L;  2UWU M;  2UXM L;  3DTA M;  4H99 M;  4LWY L;  2RCR L;  3ZUW L;  1PCR L;  2BOZ M;  1FNQ L;  2UWV L;  2JJ0 M;  1M3X M;  2WJM M;  1UMX M;  2GNU M;  1RQK L;  2UX3 L;  4N7K M;  2WX5 L;  1F6N L;  2HH1 M;  3DTR L;  1PST L;  4H9L M;  2UX4 M;  2HG3 M;  1EYS M;  1R2C L;  4IN5 M;  2PRC L;  1E6D L;  3V3Z L;  2X5V L;  1YST M;  2WJN M;  4IN7 M;  1VRN L;  1AIG M;  3DU3 M;  2I5N M;  1E14 L;  1RVJ L;  1RZH M;  2J8C M;  4HBJ L;  1JGY M;  3G7F L;  3T6D M;  1DXR M;  3ZUM M;  3V3Y M;  1L9J L;  2UXJ L;  3DTS M;  7PRC L;  1FNP M;  1RG5 L;  2HJ6 L;  2HG9 M;  2UX5 M;  4HBH L;  1QOV M;  1KBY M;  2HIT L;  2UXK M;  3PRC M;  2UWS L;  2JIY L;  1L9B L;  2BNS B;  1K6N M;  1K6L M;  2JBL M;  2HHK M;  1DV3 M;  1RZZ L;  3T6E L;  1F6N M;  3WMM L;  5LRI L;  5LSE L;  1DV6 L;  1MPS M;  1RGN L;  2J8D L;  1AIJ M;  3D38 L;  3DUQ L;  1S00 M;  1JGZ M;  1JGX L;  1PSS M;  2UWT M;  3DSY M;  4TQQ M;  6PRC M;  4N7L L;  1OGV M;  4IN6 L;  1PRC M;  2GMR L;  3T6D L;  4RCR L;  1YF6 M;  2BNP A;  2UWW L;  2UWU L;  3DTA L;  4H99 L;  3DU2 M;  1RY5 L;  2X5U M;  2BOZ L;  1DS8 M; 
#chains in the Genus database with same CATH topology
 2JJ0 L;  1M3X L;  2WJM L;  1UMX L;  2GNU L;  3I4D M;  1JGW M;  2UXM M;  4LWY M;  4N7K L;  1JH0 L;  2HH1 L;  2RCR M;  4H9L L;  3ZUW M;  1PCR M;  1FNQ M;  2UX4 L;  2HG3 L;  2UWV M;  1EYS L;  4CAS C;  1RQK M;  2UX3 M;  2WX5 M;  1YST L;  3DTR M;  2WJN L;  1PST M;  4IN7 L;  1AIG L;  3DU3 L;  2I5N L;  5PRC L;  1RZH L;  2J8C L;  1JGY L;  1R2C M;  2PRC M;  1E6D M;  3V3Z M;  1DXR L;  2X5V M;  3V3Y L;  3ZUM L;  2UXL L;  1VRN M;  3DTS L;  1FNP L;  1E14 M;  1RVJ M;  2HG9 L;  2UX5 L;  4HBJ M;  1RY5 M;  1QOV L;  1KBY L;  2UXK L;  3PRC L;  3G7F M;  1K6N L;  1K6L L;  1L9J M;  2BNP B;  1DV3 L;  2HHK L;  2JBL L;  2UXJ M;  7PRC M;  1RG5 M;  3WRX C;  1JH0 M;  2HJ6 M;  1MPS L;  4HBH M;  2HIT M;  1AIJ L;  2UWS M;  2JIY M;  4IN5 L;  1L9B M;  1JGZ L;  1PSS L;  1S00 L;  2UWT L;  3DSY L;  4TQQ L;  6PRC L;  1RZZ M;  1OGV L;  1PRC L;  3T6E M;  3WMM M;  5LRI M;  5LSE M;  1DV6 M;  1RGN M;  1YF6 L;  2J8D M;  3DU2 L;  4CAS B;  3D38 M;  3DUQ M;  5PRC M;  1JGX M;  2X5U L;  1DS8 L;  4N7L M;  4IN6 M;  2GMR M;  2BNS A;  2UXL M;  3I4D L;  4RCR M;  2UWW M;  1JGW L;  2UWU M;  2UXM L;  3DTA M;  4H99 M;  4LWY L;  2RCR L;  3ZUW L;  1PCR L;  2BOZ M;  1FNQ L;  2UWV L;  2JJ0 M;  1M3X M;  2WJM M;  1UMX M;  2GNU M;  1RQK L;  2UX3 L;  4N7K M;  2WX5 L;  1F6N L;  2HH1 M;  3DTR L;  1PST L;  3VKW A;  4H9L M;  2UX4 M;  2HG3 M;  1EYS M;  1R2C L;  4IN5 M;  2PRC L;  1E6D L;  3V3Z L;  2X5V L;  1YST M;  2WJN M;  4IN7 M;  1VRN L;  3WRY C;  1AIG M;  3DU3 M;  2I5N M;  1E14 L;  1RVJ L;  1RZH M;  2J8C M;  4HBJ L;  1JGY M;  3G7F L;  3T6D M;  1DXR M;  3ZUM M;  3V3Y M;  1L9J L;  2UXJ L;  3DTS M;  7PRC L;  1FNP M;  1RG5 L;  2HJ6 L;  2HG9 M;  2UX5 M;  4HBH L;  1QOV M;  1KBY M;  2HIT L;  2UXK M;  3PRC M;  2UWS L;  2JIY L;  1L9B L;  2BNS B;  1K6N M;  1K6L M;  2JBL M;  2HHK M;  1DV3 M;  1RZZ L;  3T6E L;  1F6N M;  3WMM L;  5LRI L;  5LSE L;  1DV6 L;  1MPS M;  1RGN L;  2J8D L;  1AIJ M;  3D38 L;  3DUQ L;  1S00 M;  1JGZ M;  1JGX L;  1PSS M;  2UWT M;  3DSY M;  4TQQ M;  6PRC M;  4N7L L;  1OGV M;  4IN6 L;  1PRC M;  2GMR L;  3T6D L;  4RCR L;  1YF6 M;  2BNP A;  2UWW L;  2UWU L;  3DTA L;  4H99 L;  3DU2 M;  1RY5 L;  2X5U M;  2BOZ L;  1DS8 M; 
#chains in the Genus database with same CATH homology
 2JJ0 L;  1M3X L;  2WJM L;  1UMX L;  2GNU L;  3I4D M;  1JGW M;  2UXM M;  4LWY M;  4N7K L;  1JH0 L;  2HH1 L;  2RCR M;  4H9L L;  3ZUW M;  1PCR M;  1FNQ M;  2UX4 L;  2HG3 L;  2UWV M;  1EYS L;  4CAS C;  1RQK M;  2UX3 M;  2WX5 M;  1YST L;  3DTR M;  2WJN L;  1PST M;  4IN7 L;  1AIG L;  3DU3 L;  2I5N L;  5PRC L;  1RZH L;  2J8C L;  1JGY L;  1R2C M;  2PRC M;  1E6D M;  3V3Z M;  1DXR L;  2X5V M;  3V3Y L;  3ZUM L;  2UXL L;  1VRN M;  3DTS L;  1FNP L;  1E14 M;  1RVJ M;  2HG9 L;  2UX5 L;  4HBJ M;  1RY5 M;  1QOV L;  1KBY L;  2UXK L;  3PRC L;  3G7F M;  1K6N L;  1K6L L;  1L9J M;  2BNP B;  1DV3 L;  2HHK L;  2JBL L;  2UXJ M;  7PRC M;  1RG5 M;  1JH0 M;  2HJ6 M;  1MPS L;  4HBH M;  2HIT M;  1AIJ L;  2UWS M;  2JIY M;  4IN5 L;  1L9B M;  1JGZ L;  1PSS L;  1S00 L;  2UWT L;  3DSY L;  4TQQ L;  6PRC L;  1RZZ M;  1OGV L;  1PRC L;  3T6E M;  3WMM M;  5LRI M;  5LSE M;  1DV6 M;  1RGN M;  1YF6 L;  2J8D M;  3DU2 L;  4CAS B;  3D38 M;  3DUQ M;  5PRC M;  1JGX M;  2X5U L;  1DS8 L;  4N7L M;  4IN6 M;  2GMR M;  2BNS A;  2UXL M;  3I4D L;  4RCR M;  2UWW M;  1JGW L;  2UWU M;  2UXM L;  3DTA M;  4H99 M;  4LWY L;  2RCR L;  3ZUW L;  1PCR L;  2BOZ M;  1FNQ L;  2UWV L;  2JJ0 M;  1M3X M;  2WJM M;  1UMX M;  2GNU M;  1RQK L;  2UX3 L;  4N7K M;  2WX5 L;  1F6N L;  2HH1 M;  3DTR L;  1PST L;  4H9L M;  2UX4 M;  2HG3 M;  1EYS M;  1R2C L;  4IN5 M;  2PRC L;  1E6D L;  3V3Z L;  2X5V L;  1YST M;  2WJN M;  4IN7 M;  1VRN L;  1AIG M;  3DU3 M;  2I5N M;  1E14 L;  1RVJ L;  1RZH M;  2J8C M;  4HBJ L;  1JGY M;  3G7F L;  3T6D M;  1DXR M;  3ZUM M;  3V3Y M;  1L9J L;  2UXJ L;  3DTS M;  7PRC L;  1FNP M;  1RG5 L;  2HJ6 L;  2HG9 M;  2UX5 M;  4HBH L;  1QOV M;  1KBY M;  2HIT L;  2UXK M;  3PRC M;  2UWS L;  2JIY L;  1L9B L;  2BNS B;  1K6N M;  1K6L M;  2JBL M;  2HHK M;  1DV3 M;  1RZZ L;  3T6E L;  1F6N M;  3WMM L;  5LRI L;  5LSE L;  1DV6 L;  1MPS M;  1RGN L;  2J8D L;  1AIJ M;  3D38 L;  3DUQ L;  1S00 M;  1JGZ M;  1JGX L;  1PSS M;  2UWT M;  3DSY M;  4TQQ M;  6PRC M;  4N7L L;  1OGV M;  4IN6 L;  1PRC M;  2GMR L;  3T6D L;  4RCR L;  1YF6 M;  2BNP A;  2UWW L;  2UWU L;  3DTA L;  4H99 L;  3DU2 M;  1RY5 L;  2X5U M;  2BOZ L;  1DS8 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...