3T6EL

Crystal structure of the reaction centre from blastochloris viridis strain dsm 133 (atcc 19567) substrain-94
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
273
structure length
273
Chain Sequence
ALLSFERKYRVRGGTLIGGDLFDFWVGPYFVGFFGVSAIFFIFLGVSLIGYAASQGPTWDPFAISINPPDLKYGLGAAPLLEGGFWQAITVCALGAFISWMLREVEISRKLGIGWHVPLAFCVPIFMFCVLQVFRPLLLGSWGHAFPYGILSHLDWVNNFGYQYLNWHYNPGHMSSVSFLFVNAMALGLHGGLILSVANPGDGDKVKTAEHENQYFRDVVGYSIGALSIHRLGLFLASNIFLTGAFGTIASGPFWTRGWPEWWGWWLDIPFWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Photosynthetic reaction center cytochrome c subunit
publication title New insights into the structure of the reaction centre from Blastochloris viridis: evolution in the laboratory.
pubmed doi rcsb
total genus 104
structure length 273
sequence length 273
ec nomenclature
pdb deposition date 2011-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00124 Photo_RC Photosynthetic reaction centre protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.85.10 Mainly Alpha Up-down Bundle Photosynthetic Reaction Center, subunit M; domain 1 Photosystem II protein D1-like 3t6eL01
1.20.85.10 Mainly Alpha Up-down Bundle Photosynthetic Reaction Center, subunit M; domain 1 Photosystem II protein D1-like 3t6eL02
1VRNM 3ZUWL 1M3XL 1UMXM 6PRCL 1MPSL 1JGZL 1L9JL 1RY5L 2JIYL 4IN5L 3T6DM 1R2CM 2HITL 2WX5L 4HBJL 1RGNM 3PRCL 3DTAL 2BNPA 3DU2M 1KBYL 3DTSM 2BOZM 1R2CL 2JBLL 1S00M 2J8CM 1OGVM 2BNPB 1DXRL 2HJ6L 4RCRM 2PRCM 2GMRM 1RVJM 2UWVM 1JGXM 2I5NM 3DTRL 1PSSL 1F6NM 3ZUMM 1AIJM 6PRCM 2UXLL 2UWWL 3V3ZL 1OGVL 2J8DL 1YF6M 1M3XM 4RCRL 1EYSL 2HH1M 1MPSM 1JGZM 1JGXL 1L9JM 2I5NL 2JIYM 2WJNL 4IN5M 1AIJL 2X5UM 2UXML 4CASC 4CASB 2HITM 1YF6L 3PRCM 2HH1L 2BNSA 1JGYL 3DTAM 2UX5L 1RQKM 1RZZL 2X5UL 1KBYM 2JBLM 1RG5M 2X5VL 4HBHL 2BNSB 3DU3M 4IN7L 4N7LM 2UWTM 1DXRM 1RQKL 2HJ6M 3DTRM 1PSSM 1FNPL 2UXLM 1RG5L 2UWWM 3V3ZM 2J8DM 3DU3L 4H9LL 4N7LL 2UWTL 1DV6L 1AIGL 4N7KL 1EYSM 1QOVM 2WJNM 2UXJL 2UXMM 5PRCL 2UX3M 2HG3L 4IN6L 5LRIM 3DSYL 1QOVL 1JGYM 2UXKM 2UX5M 1RZZM 3V3YL 5LSEM 2UX3L 2HHKL 2HG9M 1E6DL 4HBHM 2X5VM 3D38L 4IN7M 5LRIL 1JH0L 2UXKL 3DUQL 1DS8L 2GNUL 5LSEL 2WJML 1PSTL 2HG9L 1FNPM 1RZHL 1K6LM 1L9BL 4H99M 4H9LM 3I4DL 7PRCM 1DV6M 1AIGM 4N7KM 2UX4L 1E14L 3T6EL 1DV3L 2UXJM 1JGWL 1PRCL 5PRCM 1K6LL 2UWSL 4H99L 3WMML 2HG3M 4IN6M 7PRCL 2RCRL 3DSYM 4LWYL 3G7FL 3V3YM 2HHKM 1E6DM 3D38M 1JH0M 2JJ0L 2UWUM 3DUQM 1DS8M 2GNUM 2WJMM 1PSTM 4HBJM 1RZHM 1L9BM 1VRNL 3I4DM 1UMXL 2UWUL 2UX4M 1E14M 3T6EM 1DV3M 3T6DL 1JGWM 1PCRM 1PRCM 2UWSM 3WMMM 1YSTM 4TQQM 1RGNL 1K6NM 2RCRM 3DU2L 4LWYM 3DTSL 3G7FM 2BOZL 1PCRL 1S00L 1FNQM 1YSTL 2J8CL 4TQQL 1K6NL 3ZUWM 2JJ0M 2PRCL 2GMRL 1RVJL 2UWVL 1RY5M 3ZUML 1F6NL 1FNQL 2WX5M
chains in the Genus database with same CATH superfamily
1VRNM 3ZUWL 1M3XL 1UMXM 6PRCL 1MPSL 1JGZL 1L9JL 1RY5L 2JIYL 4IN5L 3T6DM 1R2CM 2HITL 2WX5L 4HBJL 1RGNM 3PRCL 3DTAL 2BNPA 3DU2M 1KBYL 3DTSM 2BOZM 1R2CL 2JBLL 1S00M 2J8CM 1OGVM 2BNPB 1DXRL 2HJ6L 4RCRM 2PRCM 2GMRM 1RVJM 2UWVM 1JGXM 2I5NM 3DTRL 1PSSL 1F6NM 3ZUMM 1AIJM 6PRCM 2UXLL 2UWWL 3V3ZL 1OGVL 2J8DL 1YF6M 1M3XM 4RCRL 1EYSL 2HH1M 1MPSM 1JGZM 1JGXL 1L9JM 2I5NL 2JIYM 2WJNL 4IN5M 1AIJL 2X5UM 2UXML 4CASC 4CASB 2HITM 1YF6L 3PRCM 2HH1L 2BNSA 1JGYL 3DTAM 2UX5L 1RQKM 1RZZL 2X5UL 1KBYM 2JBLM 1RG5M 2X5VL 4HBHL 2BNSB 3DU3M 4IN7L 4N7LM 2UWTM 1DXRM 1RQKL 2HJ6M 3DTRM 1PSSM 1FNPL 2UXLM 1RG5L 2UWWM 3V3ZM 2J8DM 3DU3L 4H9LL 4N7LL 2UWTL 1DV6L 1AIGL 4N7KL 1EYSM 1QOVM 2WJNM 2UXJL 2UXMM 5PRCL 2UX3M 2HG3L 4IN6L 5LRIM 3DSYL 1QOVL 1JGYM 2UXKM 2UX5M 1RZZM 3V3YL 5LSEM 2UX3L 2HHKL 2HG9M 3WRXC 1E6DL 4HBHM 2X5VM 3D38L 4IN7M 5LRIL 1JH0L 2UXKL 3DUQL 1DS8L 2GNUL 5LSEL 2WJML 1PSTL 2HG9L 1FNPM 1RZHL 1K6LM 1L9BL 4H99M 4H9LM 3I4DL 7PRCM 1DV6M 1AIGM 4N7KM 3VKWA 2UX4L 1E14L 3T6EL 1DV3L 2UXJM 1JGWL 1PRCL 5PRCM 1K6LL 2UWSL 4H99L 3WMML 2HG3M 4IN6M 7PRCL 2RCRL 3DSYM 4LWYL 3G7FL 3V3YM 2HHKM 1E6DM 3D38M 1JH0M 2JJ0L 2UWUM 3DUQM 1DS8M 2GNUM 2WJMM 1PSTM 4HBJM 1RZHM 1L9BM 1VRNL 3I4DM 1UMXL 2UWUL 2UX4M 1E14M 3T6EM 1DV3M 3T6DL 1JGWM 1PCRM 1PRCM 2UWSM 3WMMM 1YSTM 4TQQM 1RGNL 1K6NM 3WRYC 2RCRM 3DU2L 4LWYM 3DTSL 3G7FM 2BOZL 1PCRL 1S00L 1FNQM 1YSTL 2J8CL 4TQQL 1K6NL 3ZUWM 2JJ0M 2PRCL 2GMRL 1RVJL 2UWVL 1RY5M 3ZUML 1F6NL 1FNQL 2WX5M
chains in the Genus database with same CATH topology
1VRNM 3ZUWL 1M3XL 1UMXM 6PRCL 1MPSL 1JGZL 1L9JL 1RY5L 2JIYL 4IN5L 3T6DM 1R2CM 2HITL 2WX5L 4HBJL 1RGNM 3PRCL 3DTAL 2BNPA 3DU2M 1KBYL 3DTSM 2BOZM 1R2CL 2JBLL 1S00M 2J8CM 1OGVM 2BNPB 1DXRL 2HJ6L 4RCRM 2PRCM 2GMRM 1RVJM 2UWVM 1JGXM 2I5NM 3DTRL 1PSSL 1F6NM 3ZUMM 1AIJM 6PRCM 2UXLL 2UWWL 3V3ZL 1OGVL 2J8DL 1YF6M 1M3XM 4RCRL 1EYSL 2HH1M 1MPSM 1JGZM 1JGXL 1L9JM 2I5NL 2JIYM 2WJNL 4IN5M 1AIJL 2X5UM 2UXML 4CASC 4CASB 2HITM 1YF6L 3PRCM 2HH1L 2BNSA 1JGYL 3DTAM 2UX5L 1RQKM 1RZZL 2X5UL 1KBYM 2JBLM 1RG5M 2X5VL 4HBHL 2BNSB 3DU3M 4IN7L 4N7LM 2UWTM 1DXRM 1RQKL 2HJ6M 3DTRM 1PSSM 1FNPL 2UXLM 1RG5L 2UWWM 3V3ZM 2J8DM 3DU3L 4H9LL 4N7LL 2UWTL 1DV6L 1AIGL 4N7KL 1EYSM 1QOVM 2WJNM 2UXJL 2UXMM 5PRCL 2UX3M 2HG3L 4IN6L 5LRIM 3DSYL 1QOVL 1JGYM 2UXKM 2UX5M 1RZZM 3V3YL 5LSEM 2UX3L 2HHKL 2HG9M 1E6DL 4HBHM 2X5VM 3D38L 4IN7M 5LRIL 1JH0L 2UXKL 3DUQL 1DS8L 2GNUL 5LSEL 2WJML 1PSTL 2HG9L 1FNPM 1RZHL 1K6LM 1L9BL 4H99M 4H9LM 3I4DL 7PRCM 1DV6M 1AIGM 4N7KM 2UX4L 1E14L 3T6EL 1DV3L 2UXJM 1JGWL 1PRCL 5PRCM 1K6LL 2UWSL 4H99L 3WMML 2HG3M 4IN6M 7PRCL 2RCRL 3DSYM 4LWYL 3G7FL 3V3YM 2HHKM 1E6DM 3D38M 1JH0M 2JJ0L 2UWUM 3DUQM 1DS8M 2GNUM 2WJMM 1PSTM 4HBJM 1RZHM 1L9BM 1VRNL 3I4DM 1UMXL 2UWUL 2UX4M 1E14M 3T6EM 1DV3M 3T6DL 1JGWM 1PCRM 1PRCM 2UWSM 3WMMM 1YSTM 4TQQM 1RGNL 1K6NM 2RCRM 3DU2L 4LWYM 3DTSL 3G7FM 2BOZL 1PCRL 1S00L 1FNQM 1YSTL 2J8CL 4TQQL 1K6NL 3ZUWM 2JJ0M 2PRCL 2GMRL 1RVJL 2UWVL 1RY5M 3ZUML 1F6NL 1FNQL 2WX5M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VRN M;  3ZUW L;  1M3X L;  1UMX M;  6PRC L;  1MPS L;  1JGZ L;  1L9J L;  1RY5 L;  2JIY L;  4IN5 L;  3T6D M;  1R2C M;  2HIT L;  2WX5 L;  4HBJ L;  1RGN M;  3PRC L;  3DTA L;  2BNP A;  3DU2 M;  1KBY L;  3DTS M;  2BOZ M;  1R2C L;  2JBL L;  1S00 M;  2J8C M;  1OGV M;  2BNP B;  1DXR L;  2HJ6 L;  4RCR M;  2PRC M;  2GMR M;  1RVJ M;  2UWV M;  1JGX M;  2I5N M;  3DTR L;  1PSS L;  1F6N M;  3ZUM M;  1AIJ M;  6PRC M;  2UXL L;  2UWW L;  3V3Z L;  1OGV L;  2J8D L;  1YF6 M;  1M3X M;  4RCR L;  1EYS L;  2HH1 M;  1MPS M;  1JGZ M;  1JGX L;  1L9J M;  2I5N L;  2JIY M;  2WJN L;  4IN5 M;  1AIJ L;  2X5U M;  2UXM L;  4CAS C;  4CAS B;  2HIT M;  1YF6 L;  3PRC M;  2HH1 L;  2BNS A;  1JGY L;  3DTA M;  2UX5 L;  1RQK M;  1RZZ L;  2X5U L;  1KBY M;  2JBL M;  1RG5 M;  2X5V L;  4HBH L;  2BNS B;  3DU3 M;  4IN7 L;  4N7L M;  2UWT M;  1DXR M;  1RQK L;  2HJ6 M;  3DTR M;  1PSS M;  1FNP L;  2UXL M;  1RG5 L;  2UWW M;  3V3Z M;  2J8D M;  3DU3 L;  4H9L L;  4N7L L;  2UWT L;  1DV6 L;  1AIG L;  4N7K L;  1EYS M;  1QOV M;  2WJN M;  2UXJ L;  2UXM M;  5PRC L;  2UX3 M;  2HG3 L;  4IN6 L;  5LRI M;  3DSY L;  1QOV L;  1JGY M;  2UXK M;  2UX5 M;  1RZZ M;  3V3Y L;  5LSE M;  2UX3 L;  2HHK L;  2HG9 M;  1E6D L;  4HBH M;  2X5V M;  3D38 L;  4IN7 M;  5LRI L;  1JH0 L;  2UXK L;  3DUQ L;  1DS8 L;  2GNU L;  5LSE L;  2WJM L;  1PST L;  2HG9 L;  1FNP M;  1RZH L;  1K6L M;  1L9B L;  4H99 M;  4H9L M;  3I4D L;  7PRC M;  1DV6 M;  1AIG M;  4N7K M;  2UX4 L;  1E14 L;  3T6E L;  1DV3 L;  2UXJ M;  1JGW L;  1PRC L;  5PRC M;  1K6L L;  2UWS L;  4H99 L;  3WMM L;  2HG3 M;  4IN6 M;  7PRC L;  2RCR L;  3DSY M;  4LWY L;  3G7F L;  3V3Y M;  2HHK M;  1E6D M;  3D38 M;  1JH0 M;  2JJ0 L;  2UWU M;  3DUQ M;  1DS8 M;  2GNU M;  2WJM M;  1PST M;  4HBJ M;  1RZH M;  1L9B M;  1VRN L;  3I4D M;  1UMX L;  2UWU L;  2UX4 M;  1E14 M;  3T6E M;  1DV3 M;  3T6D L;  1JGW M;  1PCR M;  1PRC M;  2UWS M;  3WMM M;  1YST M;  4TQQ M;  1RGN L;  1K6N M;  2RCR M;  3DU2 L;  4LWY M;  3DTS L;  3G7F M;  2BOZ L;  1PCR L;  1S00 L;  1FNQ M;  1YST L;  2J8C L;  4TQQ L;  1K6N L;  3ZUW M;  2JJ0 M;  2PRC L;  2GMR L;  1RVJ L;  2UWV L;  1RY5 M;  3ZUM L;  1F6N L;  1FNQ L;  2WX5 M; 
#chains in the Genus database with same CATH topology
 1VRN M;  3ZUW L;  1M3X L;  1UMX M;  6PRC L;  1MPS L;  1JGZ L;  1L9J L;  1RY5 L;  2JIY L;  4IN5 L;  3T6D M;  1R2C M;  2HIT L;  2WX5 L;  4HBJ L;  1RGN M;  3PRC L;  3DTA L;  2BNP A;  3DU2 M;  1KBY L;  3DTS M;  2BOZ M;  1R2C L;  2JBL L;  1S00 M;  2J8C M;  1OGV M;  2BNP B;  1DXR L;  2HJ6 L;  4RCR M;  2PRC M;  2GMR M;  1RVJ M;  2UWV M;  1JGX M;  2I5N M;  3DTR L;  1PSS L;  1F6N M;  3ZUM M;  1AIJ M;  6PRC M;  2UXL L;  2UWW L;  3V3Z L;  1OGV L;  2J8D L;  1YF6 M;  1M3X M;  4RCR L;  1EYS L;  2HH1 M;  1MPS M;  1JGZ M;  1JGX L;  1L9J M;  2I5N L;  2JIY M;  2WJN L;  4IN5 M;  1AIJ L;  2X5U M;  2UXM L;  4CAS C;  4CAS B;  2HIT M;  1YF6 L;  3PRC M;  2HH1 L;  2BNS A;  1JGY L;  3DTA M;  2UX5 L;  1RQK M;  1RZZ L;  2X5U L;  1KBY M;  2JBL M;  1RG5 M;  2X5V L;  4HBH L;  2BNS B;  3DU3 M;  4IN7 L;  4N7L M;  2UWT M;  1DXR M;  1RQK L;  2HJ6 M;  3DTR M;  1PSS M;  1FNP L;  2UXL M;  1RG5 L;  2UWW M;  3V3Z M;  2J8D M;  3DU3 L;  4H9L L;  4N7L L;  2UWT L;  1DV6 L;  1AIG L;  4N7K L;  1EYS M;  1QOV M;  2WJN M;  2UXJ L;  2UXM M;  5PRC L;  2UX3 M;  2HG3 L;  4IN6 L;  5LRI M;  3DSY L;  1QOV L;  1JGY M;  2UXK M;  2UX5 M;  1RZZ M;  3V3Y L;  5LSE M;  2UX3 L;  2HHK L;  2HG9 M;  3WRX C;  1E6D L;  4HBH M;  2X5V M;  3D38 L;  4IN7 M;  5LRI L;  1JH0 L;  2UXK L;  3DUQ L;  1DS8 L;  2GNU L;  5LSE L;  2WJM L;  1PST L;  2HG9 L;  1FNP M;  1RZH L;  1K6L M;  1L9B L;  4H99 M;  4H9L M;  3I4D L;  7PRC M;  1DV6 M;  1AIG M;  4N7K M;  3VKW A;  2UX4 L;  1E14 L;  3T6E L;  1DV3 L;  2UXJ M;  1JGW L;  1PRC L;  5PRC M;  1K6L L;  2UWS L;  4H99 L;  3WMM L;  2HG3 M;  4IN6 M;  7PRC L;  2RCR L;  3DSY M;  4LWY L;  3G7F L;  3V3Y M;  2HHK M;  1E6D M;  3D38 M;  1JH0 M;  2JJ0 L;  2UWU M;  3DUQ M;  1DS8 M;  2GNU M;  2WJM M;  1PST M;  4HBJ M;  1RZH M;  1L9B M;  1VRN L;  3I4D M;  1UMX L;  2UWU L;  2UX4 M;  1E14 M;  3T6E M;  1DV3 M;  3T6D L;  1JGW M;  1PCR M;  1PRC M;  2UWS M;  3WMM M;  1YST M;  4TQQ M;  1RGN L;  1K6N M;  3WRY C;  2RCR M;  3DU2 L;  4LWY M;  3DTS L;  3G7F M;  2BOZ L;  1PCR L;  1S00 L;  1FNQ M;  1YST L;  2J8C L;  4TQQ L;  1K6N L;  3ZUW M;  2JJ0 M;  2PRC L;  2GMR L;  1RVJ L;  2UWV L;  1RY5 M;  3ZUM L;  1F6N L;  1FNQ L;  2WX5 M; 
#chains in the Genus database with same CATH homology
 1VRN M;  3ZUW L;  1M3X L;  1UMX M;  6PRC L;  1MPS L;  1JGZ L;  1L9J L;  1RY5 L;  2JIY L;  4IN5 L;  3T6D M;  1R2C M;  2HIT L;  2WX5 L;  4HBJ L;  1RGN M;  3PRC L;  3DTA L;  2BNP A;  3DU2 M;  1KBY L;  3DTS M;  2BOZ M;  1R2C L;  2JBL L;  1S00 M;  2J8C M;  1OGV M;  2BNP B;  1DXR L;  2HJ6 L;  4RCR M;  2PRC M;  2GMR M;  1RVJ M;  2UWV M;  1JGX M;  2I5N M;  3DTR L;  1PSS L;  1F6N M;  3ZUM M;  1AIJ M;  6PRC M;  2UXL L;  2UWW L;  3V3Z L;  1OGV L;  2J8D L;  1YF6 M;  1M3X M;  4RCR L;  1EYS L;  2HH1 M;  1MPS M;  1JGZ M;  1JGX L;  1L9J M;  2I5N L;  2JIY M;  2WJN L;  4IN5 M;  1AIJ L;  2X5U M;  2UXM L;  4CAS C;  4CAS B;  2HIT M;  1YF6 L;  3PRC M;  2HH1 L;  2BNS A;  1JGY L;  3DTA M;  2UX5 L;  1RQK M;  1RZZ L;  2X5U L;  1KBY M;  2JBL M;  1RG5 M;  2X5V L;  4HBH L;  2BNS B;  3DU3 M;  4IN7 L;  4N7L M;  2UWT M;  1DXR M;  1RQK L;  2HJ6 M;  3DTR M;  1PSS M;  1FNP L;  2UXL M;  1RG5 L;  2UWW M;  3V3Z M;  2J8D M;  3DU3 L;  4H9L L;  4N7L L;  2UWT L;  1DV6 L;  1AIG L;  4N7K L;  1EYS M;  1QOV M;  2WJN M;  2UXJ L;  2UXM M;  5PRC L;  2UX3 M;  2HG3 L;  4IN6 L;  5LRI M;  3DSY L;  1QOV L;  1JGY M;  2UXK M;  2UX5 M;  1RZZ M;  3V3Y L;  5LSE M;  2UX3 L;  2HHK L;  2HG9 M;  1E6D L;  4HBH M;  2X5V M;  3D38 L;  4IN7 M;  5LRI L;  1JH0 L;  2UXK L;  3DUQ L;  1DS8 L;  2GNU L;  5LSE L;  2WJM L;  1PST L;  2HG9 L;  1FNP M;  1RZH L;  1K6L M;  1L9B L;  4H99 M;  4H9L M;  3I4D L;  7PRC M;  1DV6 M;  1AIG M;  4N7K M;  2UX4 L;  1E14 L;  3T6E L;  1DV3 L;  2UXJ M;  1JGW L;  1PRC L;  5PRC M;  1K6L L;  2UWS L;  4H99 L;  3WMM L;  2HG3 M;  4IN6 M;  7PRC L;  2RCR L;  3DSY M;  4LWY L;  3G7F L;  3V3Y M;  2HHK M;  1E6D M;  3D38 M;  1JH0 M;  2JJ0 L;  2UWU M;  3DUQ M;  1DS8 M;  2GNU M;  2WJM M;  1PST M;  4HBJ M;  1RZH M;  1L9B M;  1VRN L;  3I4D M;  1UMX L;  2UWU L;  2UX4 M;  1E14 M;  3T6E M;  1DV3 M;  3T6D L;  1JGW M;  1PCR M;  1PRC M;  2UWS M;  3WMM M;  1YST M;  4TQQ M;  1RGN L;  1K6N M;  2RCR M;  3DU2 L;  4LWY M;  3DTS L;  3G7F M;  2BOZ L;  1PCR L;  1S00 L;  1FNQ M;  1YST L;  2J8C L;  4TQQ L;  1K6N L;  3ZUW M;  2JJ0 M;  2PRC L;  2GMR L;  1RVJ L;  2UWV L;  1RY5 M;  3ZUM L;  1F6N L;  1FNQ L;  2WX5 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...