4AEZB

Crystal structure of mitotic checkpoint complex
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
Knots found
sequence length
189
structure length
180
Chain Sequence
KGSSKLVSEFFEYAVNSILFQRGIYPAEDFKVVRKYGLNMLVSVDEEVKTYIRKIVSQLHKWMFAKKIQKLILVITSKCSGEDLERWQFNVEMVDNKEDELRVQKEIQALIAQITATVTFLPQLEEQCTFNVLVYADKDSEVPTDWVDSDPRILRDAEQVQLRSFSTSMHKIDCQVAYRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Mitotic Checkpoint Complex
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Cell cycle
molecule keywords WD REPEAT-CONTAINING PROTEIN SLP1
total genus 58
structure length 180
sequence length 189
chains with identical sequence E, H
other databases KnotProt 2.0: S +31
ec nomenclature
pdb deposition date 2012-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02301 HORMA HORMA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.900.10 Alpha Beta 2-Layer Sandwich Cell Cycle, Spindle Assembly Checkpoint Protein; Chain A HORMA domain 4aezB00
4TZOA 5C50B 3VU7C 4YK8B 4GK0A 4TZNA 4TZLA 1KLQA 5LCWZ 3ABEC 4FJOC 4EXTC 4J2GA 4AEZB 4TZQA 2QYFA 1DUJA 4TRKA 1S2HA 3ABDA 4TZSA 3GMHA 4TZMA 1GO4A 4TZJA 2VFXA 4GK5A 2V64D 2V64A
chains in the Genus database with same CATH superfamily
4TZOA 5C50B 3VU7C 4YK8B 4GK0A 2QYFB 4TZNA 4TZLA 1KLQA 5LCWZ 3ABEC 4FJOC 4EXTC 4J2GA 4AEZB 4TZQA 2QYFA 1DUJA 4TRKA 1S2HA 3ABDA 4TZSA 3GMHA 4TZMA 1GO4A 4TZJA 2VFXA 4GK5A 2V64D 2V64A
chains in the Genus database with same CATH topology
4TZOA 5C50B 3VU7C 4YK8B 4GK0A 4TZNA 4TZLA 1KLQA 5LCWZ 3ABEC 4FJOC 4EXTC 4J2GA 4AEZB 4TZQA 2QYFA 1DUJA 4TRKA 1S2HA 3ABDA 4TZSA 3GMHA 4TZMA 1GO4A 4TZJA 2VFXA 4GK5A 2V64D 2V64A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TZO A;  5C50 B;  3VU7 C;  4YK8 B;  4GK0 A;  4TZN A;  4TZL A;  1KLQ A;  5LCW Z;  3ABE C;  4FJO C;  4EXT C;  4J2G A;  4AEZ B;  4TZQ A;  2QYF A;  1DUJ A;  4TRK A;  1S2H A;  3ABD A;  4TZS A;  3GMH A;  4TZM A;  1GO4 A;  4TZJ A;  2VFX A;  4GK5 A;  2V64 D;  2V64 A; 
#chains in the Genus database with same CATH topology
 4TZO A;  5C50 B;  3VU7 C;  4YK8 B;  4GK0 A;  2QYF B;  4TZN A;  4TZL A;  1KLQ A;  5LCW Z;  3ABE C;  4FJO C;  4EXT C;  4J2G A;  4AEZ B;  4TZQ A;  2QYF A;  1DUJ A;  4TRK A;  1S2H A;  3ABD A;  4TZS A;  3GMH A;  4TZM A;  1GO4 A;  4TZJ A;  2VFX A;  4GK5 A;  2V64 D;  2V64 A; 
#chains in the Genus database with same CATH homology
 4TZO A;  5C50 B;  3VU7 C;  4YK8 B;  4GK0 A;  4TZN A;  4TZL A;  1KLQ A;  5LCW Z;  3ABE C;  4FJO C;  4EXT C;  4J2G A;  4AEZ B;  4TZQ A;  2QYF A;  1DUJ A;  4TRK A;  1S2H A;  3ABD A;  4TZS A;  3GMH A;  4TZM A;  1GO4 A;  4TZJ A;  2VFX A;  4GK5 A;  2V64 D;  2V64 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...