4CASB

Serial femtosecond crystallography structure of a photosynthetic reaction center
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
273
structure length
273
Chain Sequence
ALLSFERKYRVRGGTLIGGDLFDFWVGPYFVGFFGVSAIFFIFLGVSLIGYAASQGPTWDPFAISINPPDLKYGLGAAPLLEGGFWQAITVCALGAFISWMLREVEISRKLGIGWHVPLAFCVPIFMFCVLQVFRPLLLGSWGHAFPYGILSHLDWVNNFGYQYLNWHYNPGHMSSVSFLFVNAMALGLHGGLILSVANPGDGDKVKTAEHENQYFRDVVGYSIGALSIHRLGLFLASNIFLTGAFGTIASGPFWTRGWPEWWGWWLDIPFWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords PHOTOSYNTHETIC REACTION CENTER CYTOCHROME C SUBUNIT
publication title Structure of a photosynthetic reaction centre determined by serial femtosecond crystallography.
pubmed doi rcsb
total genus 101
structure length 273
sequence length 273
ec nomenclature
pdb deposition date 2013-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00124 Photo_RC Photosynthetic reaction centre protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.85.10 Mainly Alpha Up-down Bundle Photosynthetic Reaction Center, subunit M; domain 1 Photosystem II protein D1-like 4casB01
1.20.85.10 Mainly Alpha Up-down Bundle Photosynthetic Reaction Center, subunit M; domain 1 Photosystem II protein D1-like 4casB02
1JGYL 4HBJL 1DS8L 2UWWM 2UWVM 1RZZM 2GNUL 1AIJM 1YF6M 2X5VL 2JBLM 2HJ6M 1JGZM 2I5NM 2UWSL 3DTRL 3ZUML 1S00L 3D38M 4IN7L 2J8DM 3DSYL 3DU3M 1DV6L 2WJMM 4IN6L 4HBHL 1UMXM 5PRCM 2UWWL 2UWVL 1L9BM 1RZZL 2HG9M 1JGXM 1JGWM 2UX4M 1AIJL 1RVJM 2JBLL 3WMMM 1KBYM 2I5NL 2UX3M 5LSEM 2BNSA 3D38L 3ZUWM 2JIYM 2J8DL 3DU3L 4LWYM 2WJML 2J8CM 1UMXL 6PRCL 1FNQM 1L9BL 1JGXL 2UX4L 2PRCM 1RVJL 1E6DM 1PSSM 2JJ0M 1L9JM 2BNPB 3ZUWL 2UWUM 1FNPM 2UXLM 2J8CL 1OGVM 1FNQL 1VRNM 1PRCM 4H99L 1PSTM 2PRCL 1E6DL 1DXRM 1E14M 4TQQM 2JJ0L 1L9JL 1YF6L 1PCRM 2HG3M 1M3XM 1JGZL 1RGNM 2HJ6L 6PRCM 2UWUL 1EYSM 1K6LM 3I4DM 4N7LM 2X5UM 1OGVL 2HITM 3T6DM 1PSTL 5PRCL 4IN5M 1DXRL 1E14L 4TQQL 2HG9L 2WJNM 1RG5M 2UXKM 1JGWL 2HG3L 1PCRL 1M3XL 1KBYL 1RGNL 1MPSM 2UX3L 3DU2M 5LSEL 3WMML 3DUQM 1EYSL 3I4DL 2BNPA 1K6NM 2JIYL 3DTAM 2X5UL 4N7KM 2BOZM 4LWYL 4H9LM 2HITL 3T6DL 1R2CM 4IN5L 2WJNL 1RG5L 2UXKL 3PRCM 2GNUM 1QOVM 1RY5M 2WX5M 1PSSL 2UWTM 1MPSL 3DTRM 5LRIM 4RCRM 1S00M 3DUQL 2GMRM 1K6NL 4CASB 3DTAL 7PRCM 4N7KL 1DV3M 1FNPL 2BOZL 2UXLL 4H9LL 2HHKM 4IN6M 4HBHM 1RZHM 2HH1M 1R2CL 1VRNL 1YSTM 1PRCL 1AIGM 3PRCL 1QOVL 1RY5L 2WX5L 2UWTL 3V3YM 5LRIL 1F6NM 1JH0M 4RCRL 3G7FM 2GMRL 7PRCL 2RCRM 1DV3L 1K6LL 3DTSM 2UX5M 4N7LL 2HHKL 1RQKM 2UXJM 1RZHL 2HH1L 3T6EM 1YSTL 1AIGL 3V3ZM 2UXMM 1JGYM 4HBJM 1DS8M 3V3YL 1F6NL 1JH0L 3G7FL 2BNSB 2X5VM 3DU2L 3ZUMM 2UWSM 4CASC 2RCRL 3DTSL 2UX5L 4IN7M 1RQKL 2UXJL 3DSYM 3T6EL 3V3ZL 1DV6M 2UXML 4H99M
chains in the Genus database with same CATH superfamily
1JGYL 4HBJL 1DS8L 2UWWM 2UWVM 1RZZM 2GNUL 1AIJM 1YF6M 2X5VL 2JBLM 2HJ6M 1JGZM 2I5NM 2UWSL 3DTRL 3ZUML 1S00L 3D38M 4IN7L 2J8DM 3DSYL 3DU3M 1DV6L 2WJMM 4IN6L 4HBHL 1UMXM 5PRCM 2UWWL 2UWVL 1L9BM 1RZZL 2HG9M 1JGXM 1JGWM 2UX4M 1AIJL 1RVJM 2JBLL 3WMMM 1KBYM 2I5NL 2UX3M 5LSEM 2BNSA 3D38L 3ZUWM 2JIYM 2J8DL 3DU3L 4LWYM 2WJML 2J8CM 1UMXL 6PRCL 1FNQM 1L9BL 1JGXL 2UX4L 2PRCM 1RVJL 1E6DM 1PSSM 2JJ0M 1L9JM 2BNPB 3ZUWL 2UWUM 3VKWA 1FNPM 2UXLM 2J8CL 1OGVM 1FNQL 1VRNM 1PRCM 4H99L 1PSTM 2PRCL 1E6DL 1DXRM 1E14M 4TQQM 2JJ0L 1L9JL 1YF6L 1PCRM 2HG3M 1M3XM 1JGZL 1RGNM 2HJ6L 6PRCM 2UWUL 1EYSM 1K6LM 3I4DM 4N7LM 2X5UM 1OGVL 2HITM 3T6DM 1PSTL 5PRCL 4IN5M 1DXRL 1E14L 4TQQL 2HG9L 2WJNM 1RG5M 2UXKM 1JGWL 2HG3L 1PCRL 1M3XL 1KBYL 1RGNL 1MPSM 2UX3L 3DU2M 5LSEL 3WMML 3DUQM 1EYSL 3I4DL 2BNPA 1K6NM 2JIYL 3DTAM 2X5UL 4N7KM 2BOZM 4LWYL 4H9LM 2HITL 3T6DL 1R2CM 4IN5L 2WJNL 1RG5L 2UXKL 3PRCM 2GNUM 1QOVM 1RY5M 2WX5M 1PSSL 2UWTM 1MPSL 3DTRM 5LRIM 4RCRM 1S00M 3DUQL 2GMRM 1K6NL 4CASB 3DTAL 7PRCM 4N7KL 1DV3M 1FNPL 2BOZL 2UXLL 4H9LL 2HHKM 4IN6M 4HBHM 1RZHM 2HH1M 1R2CL 1VRNL 1YSTM 1PRCL 1AIGM 3PRCL 3WRYC 1QOVL 1RY5L 2WX5L 2UWTL 3V3YM 5LRIL 1F6NM 1JH0M 4RCRL 3G7FM 2GMRL 7PRCL 2RCRM 1DV3L 1K6LL 3DTSM 2UX5M 4N7LL 2HHKL 1RQKM 2UXJM 1RZHL 2HH1L 3T6EM 1YSTL 1AIGL 3V3ZM 2UXMM 1JGYM 4HBJM 1DS8M 3V3YL 1F6NL 1JH0L 3G7FL 2BNSB 3WRXC 2X5VM 3DU2L 3ZUMM 2UWSM 4CASC 2RCRL 3DTSL 2UX5L 4IN7M 1RQKL 2UXJL 3DSYM 3T6EL 3V3ZL 1DV6M 2UXML 4H99M
chains in the Genus database with same CATH topology
1JGYL 4HBJL 1DS8L 2UWWM 2UWVM 1RZZM 2GNUL 1AIJM 1YF6M 2X5VL 2JBLM 2HJ6M 1JGZM 2I5NM 2UWSL 3DTRL 3ZUML 1S00L 3D38M 4IN7L 2J8DM 3DSYL 3DU3M 1DV6L 2WJMM 4IN6L 4HBHL 1UMXM 5PRCM 2UWWL 2UWVL 1L9BM 1RZZL 2HG9M 1JGXM 1JGWM 2UX4M 1AIJL 1RVJM 2JBLL 3WMMM 1KBYM 2I5NL 2UX3M 5LSEM 2BNSA 3D38L 3ZUWM 2JIYM 2J8DL 3DU3L 4LWYM 2WJML 2J8CM 1UMXL 6PRCL 1FNQM 1L9BL 1JGXL 2UX4L 2PRCM 1RVJL 1E6DM 1PSSM 2JJ0M 1L9JM 2BNPB 3ZUWL 2UWUM 1FNPM 2UXLM 2J8CL 1OGVM 1FNQL 1VRNM 1PRCM 4H99L 1PSTM 2PRCL 1E6DL 1DXRM 1E14M 4TQQM 2JJ0L 1L9JL 1YF6L 1PCRM 2HG3M 1M3XM 1JGZL 1RGNM 2HJ6L 6PRCM 2UWUL 1EYSM 1K6LM 3I4DM 4N7LM 2X5UM 1OGVL 2HITM 3T6DM 1PSTL 5PRCL 4IN5M 1DXRL 1E14L 4TQQL 2HG9L 2WJNM 1RG5M 2UXKM 1JGWL 2HG3L 1PCRL 1M3XL 1KBYL 1RGNL 1MPSM 2UX3L 3DU2M 5LSEL 3WMML 3DUQM 1EYSL 3I4DL 2BNPA 1K6NM 2JIYL 3DTAM 2X5UL 4N7KM 2BOZM 4LWYL 4H9LM 2HITL 3T6DL 1R2CM 4IN5L 2WJNL 1RG5L 2UXKL 3PRCM 2GNUM 1QOVM 1RY5M 2WX5M 1PSSL 2UWTM 1MPSL 3DTRM 5LRIM 4RCRM 1S00M 3DUQL 2GMRM 1K6NL 4CASB 3DTAL 7PRCM 4N7KL 1DV3M 1FNPL 2BOZL 2UXLL 4H9LL 2HHKM 4IN6M 4HBHM 1RZHM 2HH1M 1R2CL 1VRNL 1YSTM 1PRCL 1AIGM 3PRCL 1QOVL 1RY5L 2WX5L 2UWTL 3V3YM 5LRIL 1F6NM 1JH0M 4RCRL 3G7FM 2GMRL 7PRCL 2RCRM 1DV3L 1K6LL 3DTSM 2UX5M 4N7LL 2HHKL 1RQKM 2UXJM 1RZHL 2HH1L 3T6EM 1YSTL 1AIGL 3V3ZM 2UXMM 1JGYM 4HBJM 1DS8M 3V3YL 1F6NL 1JH0L 3G7FL 2BNSB 2X5VM 3DU2L 3ZUMM 2UWSM 4CASC 2RCRL 3DTSL 2UX5L 4IN7M 1RQKL 2UXJL 3DSYM 3T6EL 3V3ZL 1DV6M 2UXML 4H99M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JGY L;  4HBJ L;  1DS8 L;  2UWW M;  2UWV M;  1RZZ M;  2GNU L;  1AIJ M;  1YF6 M;  2X5V L;  2JBL M;  2HJ6 M;  1JGZ M;  2I5N M;  2UWS L;  3DTR L;  3ZUM L;  1S00 L;  3D38 M;  4IN7 L;  2J8D M;  3DSY L;  3DU3 M;  1DV6 L;  2WJM M;  4IN6 L;  4HBH L;  1UMX M;  5PRC M;  2UWW L;  2UWV L;  1L9B M;  1RZZ L;  2HG9 M;  1JGX M;  1JGW M;  2UX4 M;  1AIJ L;  1RVJ M;  2JBL L;  3WMM M;  1KBY M;  2I5N L;  2UX3 M;  5LSE M;  2BNS A;  3D38 L;  3ZUW M;  2JIY M;  2J8D L;  3DU3 L;  4LWY M;  2WJM L;  2J8C M;  1UMX L;  6PRC L;  1FNQ M;  1L9B L;  1JGX L;  2UX4 L;  2PRC M;  1RVJ L;  1E6D M;  1PSS M;  2JJ0 M;  1L9J M;  2BNP B;  3ZUW L;  2UWU M;  1FNP M;  2UXL M;  2J8C L;  1OGV M;  1FNQ L;  1VRN M;  1PRC M;  4H99 L;  1PST M;  2PRC L;  1E6D L;  1DXR M;  1E14 M;  4TQQ M;  2JJ0 L;  1L9J L;  1YF6 L;  1PCR M;  2HG3 M;  1M3X M;  1JGZ L;  1RGN M;  2HJ6 L;  6PRC M;  2UWU L;  1EYS M;  1K6L M;  3I4D M;  4N7L M;  2X5U M;  1OGV L;  2HIT M;  3T6D M;  1PST L;  5PRC L;  4IN5 M;  1DXR L;  1E14 L;  4TQQ L;  2HG9 L;  2WJN M;  1RG5 M;  2UXK M;  1JGW L;  2HG3 L;  1PCR L;  1M3X L;  1KBY L;  1RGN L;  1MPS M;  2UX3 L;  3DU2 M;  5LSE L;  3WMM L;  3DUQ M;  1EYS L;  3I4D L;  2BNP A;  1K6N M;  2JIY L;  3DTA M;  2X5U L;  4N7K M;  2BOZ M;  4LWY L;  4H9L M;  2HIT L;  3T6D L;  1R2C M;  4IN5 L;  2WJN L;  1RG5 L;  2UXK L;  3PRC M;  2GNU M;  1QOV M;  1RY5 M;  2WX5 M;  1PSS L;  2UWT M;  1MPS L;  3DTR M;  5LRI M;  4RCR M;  1S00 M;  3DUQ L;  2GMR M;  1K6N L;  4CAS B;  3DTA L;  7PRC M;  4N7K L;  1DV3 M;  1FNP L;  2BOZ L;  2UXL L;  4H9L L;  2HHK M;  4IN6 M;  4HBH M;  1RZH M;  2HH1 M;  1R2C L;  1VRN L;  1YST M;  1PRC L;  1AIG M;  3PRC L;  1QOV L;  1RY5 L;  2WX5 L;  2UWT L;  3V3Y M;  5LRI L;  1F6N M;  1JH0 M;  4RCR L;  3G7F M;  2GMR L;  7PRC L;  2RCR M;  1DV3 L;  1K6L L;  3DTS M;  2UX5 M;  4N7L L;  2HHK L;  1RQK M;  2UXJ M;  1RZH L;  2HH1 L;  3T6E M;  1YST L;  1AIG L;  3V3Z M;  2UXM M;  1JGY M;  4HBJ M;  1DS8 M;  3V3Y L;  1F6N L;  1JH0 L;  3G7F L;  2BNS B;  2X5V M;  3DU2 L;  3ZUM M;  2UWS M;  4CAS C;  2RCR L;  3DTS L;  2UX5 L;  4IN7 M;  1RQK L;  2UXJ L;  3DSY M;  3T6E L;  3V3Z L;  1DV6 M;  2UXM L;  4H99 M; 
#chains in the Genus database with same CATH topology
 1JGY L;  4HBJ L;  1DS8 L;  2UWW M;  2UWV M;  1RZZ M;  2GNU L;  1AIJ M;  1YF6 M;  2X5V L;  2JBL M;  2HJ6 M;  1JGZ M;  2I5N M;  2UWS L;  3DTR L;  3ZUM L;  1S00 L;  3D38 M;  4IN7 L;  2J8D M;  3DSY L;  3DU3 M;  1DV6 L;  2WJM M;  4IN6 L;  4HBH L;  1UMX M;  5PRC M;  2UWW L;  2UWV L;  1L9B M;  1RZZ L;  2HG9 M;  1JGX M;  1JGW M;  2UX4 M;  1AIJ L;  1RVJ M;  2JBL L;  3WMM M;  1KBY M;  2I5N L;  2UX3 M;  5LSE M;  2BNS A;  3D38 L;  3ZUW M;  2JIY M;  2J8D L;  3DU3 L;  4LWY M;  2WJM L;  2J8C M;  1UMX L;  6PRC L;  1FNQ M;  1L9B L;  1JGX L;  2UX4 L;  2PRC M;  1RVJ L;  1E6D M;  1PSS M;  2JJ0 M;  1L9J M;  2BNP B;  3ZUW L;  2UWU M;  3VKW A;  1FNP M;  2UXL M;  2J8C L;  1OGV M;  1FNQ L;  1VRN M;  1PRC M;  4H99 L;  1PST M;  2PRC L;  1E6D L;  1DXR M;  1E14 M;  4TQQ M;  2JJ0 L;  1L9J L;  1YF6 L;  1PCR M;  2HG3 M;  1M3X M;  1JGZ L;  1RGN M;  2HJ6 L;  6PRC M;  2UWU L;  1EYS M;  1K6L M;  3I4D M;  4N7L M;  2X5U M;  1OGV L;  2HIT M;  3T6D M;  1PST L;  5PRC L;  4IN5 M;  1DXR L;  1E14 L;  4TQQ L;  2HG9 L;  2WJN M;  1RG5 M;  2UXK M;  1JGW L;  2HG3 L;  1PCR L;  1M3X L;  1KBY L;  1RGN L;  1MPS M;  2UX3 L;  3DU2 M;  5LSE L;  3WMM L;  3DUQ M;  1EYS L;  3I4D L;  2BNP A;  1K6N M;  2JIY L;  3DTA M;  2X5U L;  4N7K M;  2BOZ M;  4LWY L;  4H9L M;  2HIT L;  3T6D L;  1R2C M;  4IN5 L;  2WJN L;  1RG5 L;  2UXK L;  3PRC M;  2GNU M;  1QOV M;  1RY5 M;  2WX5 M;  1PSS L;  2UWT M;  1MPS L;  3DTR M;  5LRI M;  4RCR M;  1S00 M;  3DUQ L;  2GMR M;  1K6N L;  4CAS B;  3DTA L;  7PRC M;  4N7K L;  1DV3 M;  1FNP L;  2BOZ L;  2UXL L;  4H9L L;  2HHK M;  4IN6 M;  4HBH M;  1RZH M;  2HH1 M;  1R2C L;  1VRN L;  1YST M;  1PRC L;  1AIG M;  3PRC L;  3WRY C;  1QOV L;  1RY5 L;  2WX5 L;  2UWT L;  3V3Y M;  5LRI L;  1F6N M;  1JH0 M;  4RCR L;  3G7F M;  2GMR L;  7PRC L;  2RCR M;  1DV3 L;  1K6L L;  3DTS M;  2UX5 M;  4N7L L;  2HHK L;  1RQK M;  2UXJ M;  1RZH L;  2HH1 L;  3T6E M;  1YST L;  1AIG L;  3V3Z M;  2UXM M;  1JGY M;  4HBJ M;  1DS8 M;  3V3Y L;  1F6N L;  1JH0 L;  3G7F L;  2BNS B;  3WRX C;  2X5V M;  3DU2 L;  3ZUM M;  2UWS M;  4CAS C;  2RCR L;  3DTS L;  2UX5 L;  4IN7 M;  1RQK L;  2UXJ L;  3DSY M;  3T6E L;  3V3Z L;  1DV6 M;  2UXM L;  4H99 M; 
#chains in the Genus database with same CATH homology
 1JGY L;  4HBJ L;  1DS8 L;  2UWW M;  2UWV M;  1RZZ M;  2GNU L;  1AIJ M;  1YF6 M;  2X5V L;  2JBL M;  2HJ6 M;  1JGZ M;  2I5N M;  2UWS L;  3DTR L;  3ZUM L;  1S00 L;  3D38 M;  4IN7 L;  2J8D M;  3DSY L;  3DU3 M;  1DV6 L;  2WJM M;  4IN6 L;  4HBH L;  1UMX M;  5PRC M;  2UWW L;  2UWV L;  1L9B M;  1RZZ L;  2HG9 M;  1JGX M;  1JGW M;  2UX4 M;  1AIJ L;  1RVJ M;  2JBL L;  3WMM M;  1KBY M;  2I5N L;  2UX3 M;  5LSE M;  2BNS A;  3D38 L;  3ZUW M;  2JIY M;  2J8D L;  3DU3 L;  4LWY M;  2WJM L;  2J8C M;  1UMX L;  6PRC L;  1FNQ M;  1L9B L;  1JGX L;  2UX4 L;  2PRC M;  1RVJ L;  1E6D M;  1PSS M;  2JJ0 M;  1L9J M;  2BNP B;  3ZUW L;  2UWU M;  1FNP M;  2UXL M;  2J8C L;  1OGV M;  1FNQ L;  1VRN M;  1PRC M;  4H99 L;  1PST M;  2PRC L;  1E6D L;  1DXR M;  1E14 M;  4TQQ M;  2JJ0 L;  1L9J L;  1YF6 L;  1PCR M;  2HG3 M;  1M3X M;  1JGZ L;  1RGN M;  2HJ6 L;  6PRC M;  2UWU L;  1EYS M;  1K6L M;  3I4D M;  4N7L M;  2X5U M;  1OGV L;  2HIT M;  3T6D M;  1PST L;  5PRC L;  4IN5 M;  1DXR L;  1E14 L;  4TQQ L;  2HG9 L;  2WJN M;  1RG5 M;  2UXK M;  1JGW L;  2HG3 L;  1PCR L;  1M3X L;  1KBY L;  1RGN L;  1MPS M;  2UX3 L;  3DU2 M;  5LSE L;  3WMM L;  3DUQ M;  1EYS L;  3I4D L;  2BNP A;  1K6N M;  2JIY L;  3DTA M;  2X5U L;  4N7K M;  2BOZ M;  4LWY L;  4H9L M;  2HIT L;  3T6D L;  1R2C M;  4IN5 L;  2WJN L;  1RG5 L;  2UXK L;  3PRC M;  2GNU M;  1QOV M;  1RY5 M;  2WX5 M;  1PSS L;  2UWT M;  1MPS L;  3DTR M;  5LRI M;  4RCR M;  1S00 M;  3DUQ L;  2GMR M;  1K6N L;  4CAS B;  3DTA L;  7PRC M;  4N7K L;  1DV3 M;  1FNP L;  2BOZ L;  2UXL L;  4H9L L;  2HHK M;  4IN6 M;  4HBH M;  1RZH M;  2HH1 M;  1R2C L;  1VRN L;  1YST M;  1PRC L;  1AIG M;  3PRC L;  1QOV L;  1RY5 L;  2WX5 L;  2UWT L;  3V3Y M;  5LRI L;  1F6N M;  1JH0 M;  4RCR L;  3G7F M;  2GMR L;  7PRC L;  2RCR M;  1DV3 L;  1K6L L;  3DTS M;  2UX5 M;  4N7L L;  2HHK L;  1RQK M;  2UXJ M;  1RZH L;  2HH1 L;  3T6E M;  1YST L;  1AIG L;  3V3Z M;  2UXM M;  1JGY M;  4HBJ M;  1DS8 M;  3V3Y L;  1F6N L;  1JH0 L;  3G7F L;  2BNS B;  2X5V M;  3DU2 L;  3ZUM M;  2UWS M;  4CAS C;  2RCR L;  3DTS L;  2UX5 L;  4IN7 M;  1RQK L;  2UXJ L;  3DSY M;  3T6E L;  3V3Z L;  1DV6 M;  2UXM L;  4H99 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...