The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
34
|
sequence length |
136
|
structure length |
136
|
Chain Sequence |
MHEWALADAIVRTVLDYAQREGASRVKAVRVVLGELQDVAEDIVKFAMEQLFAGTIAEGAEIEFVEEEAVFKCRNCNYEWKLKEVKDKFDERIKEDIHFIPEVVHAFLACPKCGSHDFEVVKGRGVYVAGIKIEKE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structural basis of a Ni acquisition cycle for [NiFe] hydrogenase by Ni-metallochaperone HypA and its enhancer
pubmed doi rcsb |
| molecule keywords |
Probable hydrogenase nickel incorporation protein HypA
|
| molecule tags |
Metal binding protein/hydrolase
|
| source organism |
Thermococcus kodakaraensis (strain atcc baa-918 / jcm 12380 / kod1)
|
| total genus |
34
|
| structure length |
136
|
| sequence length |
136
|
| chains with identical sequence |
H
|
| ec nomenclature | |
| pdb deposition date | 2015-05-27 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF01155 | HypA | Hydrogenase/urease nickel incorporation, metallochaperone, hypA |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | hypothetical protein PF0899 fold | hypothetical protein PF0899 fold |
#chains in the Genus database with same CATH superfamily 3A43 A; 5AUO A; 5AUN A; 5AUP A; 3A44 A; #chains in the Genus database with same CATH topology 3A43 A; 4DL0 E; 2E0Z A; 1OHG A; 2DM9 A; 3V6I A; 2FT1 A; 3A44 A; 1QU3 A; 2DMA A; 2KDX A; 5AUN A; 5AUP A; 4EFA E; 2PK8 A; 2LC0 A; 1YUE A; 2FSY A; 4DT0 A; 3DKT A; 3E8K A; 3K5B A; 5AUO A; 1WZ2 A; #chains in the Genus database with same CATH homology 2DMA A; 2KDX A; 4EFA E; 3A43 A; 3K5B A; 4DL0 E; 5AUN A; 2LC0 A; 1YUE A; 3V6I A; 5AUO A; 4DT0 A; 2DM9 A; 5AUP A; 3A44 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...