5PRCL

Photosynthetic reaction center from rhodopseudomonas viridis (atrazine complex)
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
273
structure length
273
Chain Sequence
ALLSFERKYRVRGGTLIGGDLFDFWVGPYFVGFFGVSAIFFIFLGVSLIGYAASQGPTWDPFAISINPPDLKYGLGAAPLLEGGFWQAITVCALGAFISWMLREVEISRKLGIGWHVPLAFCVPIFMFCVLQVFRPLLLGSWGHAFPYGILSHLDWVNNFGYQYLNWHYNPGHMSSVSFLFVNAMALGLHGGLILSVANPGDGDKVKTAEHENQYFRDVVGYSIGALSIHRLGLFLASNIFLTGAFGTIASGPFWTRGWPEWWGWWLDIPFWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthetic reaction center
molecule keywords PHOTOSYNTHETIC REACTION CENTER
publication title Refined crystal structures of reaction centres from Rhodopseudomonas viridis in complexes with the herbicide atrazine and two chiral atrazine derivatives also lead to a new model of the bound carotenoid.
pubmed doi rcsb
total genus 104
structure length 273
sequence length 273
ec nomenclature
pdb deposition date 1997-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00124 Photo_RC Photosynthetic reaction centre protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.85.10 Mainly Alpha Up-down Bundle Photosynthetic Reaction Center, subunit M; domain 1 Photosystem II protein D1-like 5prcL01
1.20.85.10 Mainly Alpha Up-down Bundle Photosynthetic Reaction Center, subunit M; domain 1 Photosystem II protein D1-like 5prcL02
3DUQM 2UXML 2UWUM 5PRCL 3D38L 1JGXM 1JGWM 4HBJL 2HG9M 2JIYM 4H99L 3V3ZM 1RGNL 4RCRL 2UWTM 2BNPB 2WX5M 1PCRM 1R2CM 1RY5L 1UMXM 2J8CM 5LSEM 2WJNM 1KBYL 1YF6L 2UWSM 3ZUWL 5LRIL 3DTSL 2HITL 4LWYL 4IN7M 2X5UM 2PRCL 3DTAM 1PSTM 3DU3M 2HJ6M 2HH1L 1E14L 1VRNM 4CASC 2UWTL 2JBLL 1RZHM 1PCRL 3T6DL 1RQKL 4IN6M 1RVJM 2X5VL 3DU2M 1AIJM 1S00L 4H9LL 2UX3M 1FNPM 3I4DM 1DS8L 3DSYL 4HBHM 4IN7L 1DXRL 1E6DM 1JGYM 1L9JL 2UX5M 4N7KM 1PSSL 4N7LL 2J8DM 2RCRL 2UWVM 2UXJL 2UXKL 2JJ0L 2GNUM 2HG3L 2HHKL 1DV3L 2WJML 1L9BM 1OGVM 2BOZL 1DV6L 1QOVM 2UWWL 1AIGL 3ZUML 1YSTM 3DUQL 3T6EM 1JGZM 2UWUL 1F6NM 1JGXL 1JGWL 2HG9L 2JIYL 3V3ZL 2BNSA 4CASB 2WX5L 1R2CL 2J8CL 1UMXL 5LSEL 2WJNL 1OGVL 2UWSL 1FNQM 1PRCM 1RZZM 3PRCM 1JH0M 2X5UL 3DTAL 4IN5M 1PSTL 3DU3L 1RG5M 3V3YM 2HJ6L 1VRNL 1K6LM 6PRCM 3G7FM 1RZHL 2UX4M 4IN6L 1M3XM 1RVJL 2UXLM 7PRCM 3DU2L 1AIJL 2I5NM 1MPSM 2UX3L 1FNPL 4TQQM 3I4DL 3WMMM 1EYSM 2UXMM 3DTRM 4HBHL 1E6DL 1JGYL 5PRCM 3D38M 4HBJM 2UX5L 4N7KL 1K6NM 2GMRM 1RGNM 2J8DL 2UWVL 4RCRM 7PRCL 1RY5M 1KBYM 2GNUL 3ZUWM 5LRIM 3DTSM 1L9BL 2BNPA 2HITM 1QOVL 4LWYM 2PRCM 3T6EL 1YSTL 1JGZL 1F6NL 1K6NL 2BNSB 2HH1M 1E14M 2GMRL 2JBLM 3T6DM 1RQKM 2X5VM 1S00M 4H9LM 1DS8M 1FNQL 1PRCL 1RZZL 3DSYM 3PRCL 1DXRM 1JH0L 1L9JM 4IN5L 1PSSM 1RG5L 4N7LM 3V3YL 2RCRM 2UXJM 1K6LL 2UXKM 4H99M 6PRCL 2JJ0M 3G7FL 2UX4L 2HHKM 1M3XL 1DV3M 2HG3M 2UXLL 2WJMM 2I5NL 1YF6M 1MPSL 2BOZM 4TQQL 3WMML 1DV6M 2UWWM 1EYSL 1AIGM 3DTRL 3ZUMM
chains in the Genus database with same CATH superfamily
3DUQM 2UXML 2UWUM 5PRCL 3D38L 1JGXM 1JGWM 4HBJL 3VKWA 2HG9M 2JIYM 4H99L 3V3ZM 1RGNL 4RCRL 2UWTM 2BNPB 2WX5M 1PCRM 1R2CM 1RY5L 1UMXM 2J8CM 5LSEM 2WJNM 1KBYL 1YF6L 2UWSM 3ZUWL 5LRIL 3DTSL 2HITL 4LWYL 4IN7M 2X5UM 2PRCL 3DTAM 1PSTM 3DU3M 2HJ6M 2HH1L 1E14L 1VRNM 4CASC 2UWTL 2JBLL 1RZHM 1PCRL 3T6DL 1RQKL 4IN6M 1RVJM 2X5VL 3DU2M 1AIJM 1S00L 4H9LL 2UX3M 1FNPM 3I4DM 1DS8L 3DSYL 4HBHM 4IN7L 1DXRL 1E6DM 1JGYM 1L9JL 2UX5M 4N7KM 1PSSL 4N7LL 2J8DM 2RCRL 2UWVM 2UXJL 2UXKL 2JJ0L 2GNUM 2HG3L 2HHKL 1DV3L 2WJML 1L9BM 1OGVM 2BOZL 1DV6L 1QOVM 2UWWL 1AIGL 3ZUML 1YSTM 3DUQL 3T6EM 1JGZM 2UWUL 1F6NM 1JGXL 1JGWL 2HG9L 2JIYL 3V3ZL 2BNSA 4CASB 2WX5L 1R2CL 2J8CL 1UMXL 5LSEL 2WJNL 1OGVL 2UWSL 1FNQM 1PRCM 1RZZM 3PRCM 3WRYC 1JH0M 2X5UL 3DTAL 4IN5M 1PSTL 3DU3L 1RG5M 3V3YM 2HJ6L 1VRNL 1K6LM 6PRCM 3G7FM 1RZHL 2UX4M 4IN6L 1M3XM 1RVJL 2UXLM 7PRCM 3DU2L 1AIJL 2I5NM 1MPSM 2UX3L 1FNPL 4TQQM 3I4DL 3WMMM 1EYSM 2UXMM 3DTRM 4HBHL 1E6DL 1JGYL 5PRCM 3D38M 4HBJM 2UX5L 4N7KL 1K6NM 2GMRM 1RGNM 2J8DL 2UWVL 4RCRM 7PRCL 1RY5M 1KBYM 2GNUL 3ZUWM 5LRIM 3DTSM 1L9BL 2BNPA 2HITM 1QOVL 4LWYM 2PRCM 3T6EL 1YSTL 1JGZL 1F6NL 1K6NL 2BNSB 2HH1M 1E14M 2GMRL 2JBLM 3T6DM 1RQKM 2X5VM 1S00M 4H9LM 1DS8M 1FNQL 1PRCL 1RZZL 3DSYM 3PRCL 3WRXC 1DXRM 1JH0L 1L9JM 4IN5L 1PSSM 1RG5L 4N7LM 3V3YL 2RCRM 2UXJM 1K6LL 2UXKM 4H99M 6PRCL 2JJ0M 3G7FL 2UX4L 2HHKM 1M3XL 1DV3M 2HG3M 2UXLL 2WJMM 2I5NL 1YF6M 1MPSL 2BOZM 4TQQL 3WMML 1DV6M 2UWWM 1EYSL 1AIGM 3DTRL 3ZUMM
chains in the Genus database with same CATH topology
3DUQM 2UXML 2UWUM 5PRCL 3D38L 1JGXM 1JGWM 4HBJL 2HG9M 2JIYM 4H99L 3V3ZM 1RGNL 4RCRL 2UWTM 2BNPB 2WX5M 1PCRM 1R2CM 1RY5L 1UMXM 2J8CM 5LSEM 2WJNM 1KBYL 1YF6L 2UWSM 3ZUWL 5LRIL 3DTSL 2HITL 4LWYL 4IN7M 2X5UM 2PRCL 3DTAM 1PSTM 3DU3M 2HJ6M 2HH1L 1E14L 1VRNM 4CASC 2UWTL 2JBLL 1RZHM 1PCRL 3T6DL 1RQKL 4IN6M 1RVJM 2X5VL 3DU2M 1AIJM 1S00L 4H9LL 2UX3M 1FNPM 3I4DM 1DS8L 3DSYL 4HBHM 4IN7L 1DXRL 1E6DM 1JGYM 1L9JL 2UX5M 4N7KM 1PSSL 4N7LL 2J8DM 2RCRL 2UWVM 2UXJL 2UXKL 2JJ0L 2GNUM 2HG3L 2HHKL 1DV3L 2WJML 1L9BM 1OGVM 2BOZL 1DV6L 1QOVM 2UWWL 1AIGL 3ZUML 1YSTM 3DUQL 3T6EM 1JGZM 2UWUL 1F6NM 1JGXL 1JGWL 2HG9L 2JIYL 3V3ZL 2BNSA 4CASB 2WX5L 1R2CL 2J8CL 1UMXL 5LSEL 2WJNL 1OGVL 2UWSL 1FNQM 1PRCM 1RZZM 3PRCM 1JH0M 2X5UL 3DTAL 4IN5M 1PSTL 3DU3L 1RG5M 3V3YM 2HJ6L 1VRNL 1K6LM 6PRCM 3G7FM 1RZHL 2UX4M 4IN6L 1M3XM 1RVJL 2UXLM 7PRCM 3DU2L 1AIJL 2I5NM 1MPSM 2UX3L 1FNPL 4TQQM 3I4DL 3WMMM 1EYSM 2UXMM 3DTRM 4HBHL 1E6DL 1JGYL 5PRCM 3D38M 4HBJM 2UX5L 4N7KL 1K6NM 2GMRM 1RGNM 2J8DL 2UWVL 4RCRM 7PRCL 1RY5M 1KBYM 2GNUL 3ZUWM 5LRIM 3DTSM 1L9BL 2BNPA 2HITM 1QOVL 4LWYM 2PRCM 3T6EL 1YSTL 1JGZL 1F6NL 1K6NL 2BNSB 2HH1M 1E14M 2GMRL 2JBLM 3T6DM 1RQKM 2X5VM 1S00M 4H9LM 1DS8M 1FNQL 1PRCL 1RZZL 3DSYM 3PRCL 1DXRM 1JH0L 1L9JM 4IN5L 1PSSM 1RG5L 4N7LM 3V3YL 2RCRM 2UXJM 1K6LL 2UXKM 4H99M 6PRCL 2JJ0M 3G7FL 2UX4L 2HHKM 1M3XL 1DV3M 2HG3M 2UXLL 2WJMM 2I5NL 1YF6M 1MPSL 2BOZM 4TQQL 3WMML 1DV6M 2UWWM 1EYSL 1AIGM 3DTRL 3ZUMM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DUQ M;  2UXM L;  2UWU M;  5PRC L;  3D38 L;  1JGX M;  1JGW M;  4HBJ L;  2HG9 M;  2JIY M;  4H99 L;  3V3Z M;  1RGN L;  4RCR L;  2UWT M;  2BNP B;  2WX5 M;  1PCR M;  1R2C M;  1RY5 L;  1UMX M;  2J8C M;  5LSE M;  2WJN M;  1KBY L;  1YF6 L;  2UWS M;  3ZUW L;  5LRI L;  3DTS L;  2HIT L;  4LWY L;  4IN7 M;  2X5U M;  2PRC L;  3DTA M;  1PST M;  3DU3 M;  2HJ6 M;  2HH1 L;  1E14 L;  1VRN M;  4CAS C;  2UWT L;  2JBL L;  1RZH M;  1PCR L;  3T6D L;  1RQK L;  4IN6 M;  1RVJ M;  2X5V L;  3DU2 M;  1AIJ M;  1S00 L;  4H9L L;  2UX3 M;  1FNP M;  3I4D M;  1DS8 L;  3DSY L;  4HBH M;  4IN7 L;  1DXR L;  1E6D M;  1JGY M;  1L9J L;  2UX5 M;  4N7K M;  1PSS L;  4N7L L;  2J8D M;  2RCR L;  2UWV M;  2UXJ L;  2UXK L;  2JJ0 L;  2GNU M;  2HG3 L;  2HHK L;  1DV3 L;  2WJM L;  1L9B M;  1OGV M;  2BOZ L;  1DV6 L;  1QOV M;  2UWW L;  1AIG L;  3ZUM L;  1YST M;  3DUQ L;  3T6E M;  1JGZ M;  2UWU L;  1F6N M;  1JGX L;  1JGW L;  2HG9 L;  2JIY L;  3V3Z L;  2BNS A;  4CAS B;  2WX5 L;  1R2C L;  2J8C L;  1UMX L;  5LSE L;  2WJN L;  1OGV L;  2UWS L;  1FNQ M;  1PRC M;  1RZZ M;  3PRC M;  1JH0 M;  2X5U L;  3DTA L;  4IN5 M;  1PST L;  3DU3 L;  1RG5 M;  3V3Y M;  2HJ6 L;  1VRN L;  1K6L M;  6PRC M;  3G7F M;  1RZH L;  2UX4 M;  4IN6 L;  1M3X M;  1RVJ L;  2UXL M;  7PRC M;  3DU2 L;  1AIJ L;  2I5N M;  1MPS M;  2UX3 L;  1FNP L;  4TQQ M;  3I4D L;  3WMM M;  1EYS M;  2UXM M;  3DTR M;  4HBH L;  1E6D L;  1JGY L;  5PRC M;  3D38 M;  4HBJ M;  2UX5 L;  4N7K L;  1K6N M;  2GMR M;  1RGN M;  2J8D L;  2UWV L;  4RCR M;  7PRC L;  1RY5 M;  1KBY M;  2GNU L;  3ZUW M;  5LRI M;  3DTS M;  1L9B L;  2BNP A;  2HIT M;  1QOV L;  4LWY M;  2PRC M;  3T6E L;  1YST L;  1JGZ L;  1F6N L;  1K6N L;  2BNS B;  2HH1 M;  1E14 M;  2GMR L;  2JBL M;  3T6D M;  1RQK M;  2X5V M;  1S00 M;  4H9L M;  1DS8 M;  1FNQ L;  1PRC L;  1RZZ L;  3DSY M;  3PRC L;  1DXR M;  1JH0 L;  1L9J M;  4IN5 L;  1PSS M;  1RG5 L;  4N7L M;  3V3Y L;  2RCR M;  2UXJ M;  1K6L L;  2UXK M;  4H99 M;  6PRC L;  2JJ0 M;  3G7F L;  2UX4 L;  2HHK M;  1M3X L;  1DV3 M;  2HG3 M;  2UXL L;  2WJM M;  2I5N L;  1YF6 M;  1MPS L;  2BOZ M;  4TQQ L;  3WMM L;  1DV6 M;  2UWW M;  1EYS L;  1AIG M;  3DTR L;  3ZUM M; 
#chains in the Genus database with same CATH topology
 3DUQ M;  2UXM L;  2UWU M;  5PRC L;  3D38 L;  1JGX M;  1JGW M;  4HBJ L;  3VKW A;  2HG9 M;  2JIY M;  4H99 L;  3V3Z M;  1RGN L;  4RCR L;  2UWT M;  2BNP B;  2WX5 M;  1PCR M;  1R2C M;  1RY5 L;  1UMX M;  2J8C M;  5LSE M;  2WJN M;  1KBY L;  1YF6 L;  2UWS M;  3ZUW L;  5LRI L;  3DTS L;  2HIT L;  4LWY L;  4IN7 M;  2X5U M;  2PRC L;  3DTA M;  1PST M;  3DU3 M;  2HJ6 M;  2HH1 L;  1E14 L;  1VRN M;  4CAS C;  2UWT L;  2JBL L;  1RZH M;  1PCR L;  3T6D L;  1RQK L;  4IN6 M;  1RVJ M;  2X5V L;  3DU2 M;  1AIJ M;  1S00 L;  4H9L L;  2UX3 M;  1FNP M;  3I4D M;  1DS8 L;  3DSY L;  4HBH M;  4IN7 L;  1DXR L;  1E6D M;  1JGY M;  1L9J L;  2UX5 M;  4N7K M;  1PSS L;  4N7L L;  2J8D M;  2RCR L;  2UWV M;  2UXJ L;  2UXK L;  2JJ0 L;  2GNU M;  2HG3 L;  2HHK L;  1DV3 L;  2WJM L;  1L9B M;  1OGV M;  2BOZ L;  1DV6 L;  1QOV M;  2UWW L;  1AIG L;  3ZUM L;  1YST M;  3DUQ L;  3T6E M;  1JGZ M;  2UWU L;  1F6N M;  1JGX L;  1JGW L;  2HG9 L;  2JIY L;  3V3Z L;  2BNS A;  4CAS B;  2WX5 L;  1R2C L;  2J8C L;  1UMX L;  5LSE L;  2WJN L;  1OGV L;  2UWS L;  1FNQ M;  1PRC M;  1RZZ M;  3PRC M;  3WRY C;  1JH0 M;  2X5U L;  3DTA L;  4IN5 M;  1PST L;  3DU3 L;  1RG5 M;  3V3Y M;  2HJ6 L;  1VRN L;  1K6L M;  6PRC M;  3G7F M;  1RZH L;  2UX4 M;  4IN6 L;  1M3X M;  1RVJ L;  2UXL M;  7PRC M;  3DU2 L;  1AIJ L;  2I5N M;  1MPS M;  2UX3 L;  1FNP L;  4TQQ M;  3I4D L;  3WMM M;  1EYS M;  2UXM M;  3DTR M;  4HBH L;  1E6D L;  1JGY L;  5PRC M;  3D38 M;  4HBJ M;  2UX5 L;  4N7K L;  1K6N M;  2GMR M;  1RGN M;  2J8D L;  2UWV L;  4RCR M;  7PRC L;  1RY5 M;  1KBY M;  2GNU L;  3ZUW M;  5LRI M;  3DTS M;  1L9B L;  2BNP A;  2HIT M;  1QOV L;  4LWY M;  2PRC M;  3T6E L;  1YST L;  1JGZ L;  1F6N L;  1K6N L;  2BNS B;  2HH1 M;  1E14 M;  2GMR L;  2JBL M;  3T6D M;  1RQK M;  2X5V M;  1S00 M;  4H9L M;  1DS8 M;  1FNQ L;  1PRC L;  1RZZ L;  3DSY M;  3PRC L;  3WRX C;  1DXR M;  1JH0 L;  1L9J M;  4IN5 L;  1PSS M;  1RG5 L;  4N7L M;  3V3Y L;  2RCR M;  2UXJ M;  1K6L L;  2UXK M;  4H99 M;  6PRC L;  2JJ0 M;  3G7F L;  2UX4 L;  2HHK M;  1M3X L;  1DV3 M;  2HG3 M;  2UXL L;  2WJM M;  2I5N L;  1YF6 M;  1MPS L;  2BOZ M;  4TQQ L;  3WMM L;  1DV6 M;  2UWW M;  1EYS L;  1AIG M;  3DTR L;  3ZUM M; 
#chains in the Genus database with same CATH homology
 3DUQ M;  2UXM L;  2UWU M;  5PRC L;  3D38 L;  1JGX M;  1JGW M;  4HBJ L;  2HG9 M;  2JIY M;  4H99 L;  3V3Z M;  1RGN L;  4RCR L;  2UWT M;  2BNP B;  2WX5 M;  1PCR M;  1R2C M;  1RY5 L;  1UMX M;  2J8C M;  5LSE M;  2WJN M;  1KBY L;  1YF6 L;  2UWS M;  3ZUW L;  5LRI L;  3DTS L;  2HIT L;  4LWY L;  4IN7 M;  2X5U M;  2PRC L;  3DTA M;  1PST M;  3DU3 M;  2HJ6 M;  2HH1 L;  1E14 L;  1VRN M;  4CAS C;  2UWT L;  2JBL L;  1RZH M;  1PCR L;  3T6D L;  1RQK L;  4IN6 M;  1RVJ M;  2X5V L;  3DU2 M;  1AIJ M;  1S00 L;  4H9L L;  2UX3 M;  1FNP M;  3I4D M;  1DS8 L;  3DSY L;  4HBH M;  4IN7 L;  1DXR L;  1E6D M;  1JGY M;  1L9J L;  2UX5 M;  4N7K M;  1PSS L;  4N7L L;  2J8D M;  2RCR L;  2UWV M;  2UXJ L;  2UXK L;  2JJ0 L;  2GNU M;  2HG3 L;  2HHK L;  1DV3 L;  2WJM L;  1L9B M;  1OGV M;  2BOZ L;  1DV6 L;  1QOV M;  2UWW L;  1AIG L;  3ZUM L;  1YST M;  3DUQ L;  3T6E M;  1JGZ M;  2UWU L;  1F6N M;  1JGX L;  1JGW L;  2HG9 L;  2JIY L;  3V3Z L;  2BNS A;  4CAS B;  2WX5 L;  1R2C L;  2J8C L;  1UMX L;  5LSE L;  2WJN L;  1OGV L;  2UWS L;  1FNQ M;  1PRC M;  1RZZ M;  3PRC M;  1JH0 M;  2X5U L;  3DTA L;  4IN5 M;  1PST L;  3DU3 L;  1RG5 M;  3V3Y M;  2HJ6 L;  1VRN L;  1K6L M;  6PRC M;  3G7F M;  1RZH L;  2UX4 M;  4IN6 L;  1M3X M;  1RVJ L;  2UXL M;  7PRC M;  3DU2 L;  1AIJ L;  2I5N M;  1MPS M;  2UX3 L;  1FNP L;  4TQQ M;  3I4D L;  3WMM M;  1EYS M;  2UXM M;  3DTR M;  4HBH L;  1E6D L;  1JGY L;  5PRC M;  3D38 M;  4HBJ M;  2UX5 L;  4N7K L;  1K6N M;  2GMR M;  1RGN M;  2J8D L;  2UWV L;  4RCR M;  7PRC L;  1RY5 M;  1KBY M;  2GNU L;  3ZUW M;  5LRI M;  3DTS M;  1L9B L;  2BNP A;  2HIT M;  1QOV L;  4LWY M;  2PRC M;  3T6E L;  1YST L;  1JGZ L;  1F6N L;  1K6N L;  2BNS B;  2HH1 M;  1E14 M;  2GMR L;  2JBL M;  3T6D M;  1RQK M;  2X5V M;  1S00 M;  4H9L M;  1DS8 M;  1FNQ L;  1PRC L;  1RZZ L;  3DSY M;  3PRC L;  1DXR M;  1JH0 L;  1L9J M;  4IN5 L;  1PSS M;  1RG5 L;  4N7L M;  3V3Y L;  2RCR M;  2UXJ M;  1K6L L;  2UXK M;  4H99 M;  6PRC L;  2JJ0 M;  3G7F L;  2UX4 L;  2HHK M;  1M3X L;  1DV3 M;  2HG3 M;  2UXL L;  2WJM M;  2I5N L;  1YF6 M;  1MPS L;  2BOZ M;  4TQQ L;  3WMM L;  1DV6 M;  2UWW M;  1EYS L;  1AIG M;  3DTR L;  3ZUM M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...