6PRCL

Photosynthetic reaction center from rhodopseudomonas viridis (dg-420314 (triazine) complex)
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
273
structure length
273
Chain Sequence
ALLSFERKYRVRGGTLIGGDLFDFWVGPYFVGFFGVSAIFFIFLGVSLIGYAASQGPTWDPFAISINPPDLKYGLGAAPLLEGGFWQAITVCALGAFISWMLREVEISRKLGIGWHVPLAFCVPIFMFCVLQVFRPLLLGSWGHAFPYGILSHLDWVNNFGYQYLNWHYNPGHMSSVSFLFVNAMALGLHGGLILSVANPGDGDKVKTAEHENQYFRDVVGYSIGALSIHRLGLFLASNIFLTGAFGTIASGPFWTRGWPEWWGWWLDIPFWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthetic reaction center
molecule keywords PHOTOSYNTHETIC REACTION CENTER
publication title Refined crystal structures of reaction centres from Rhodopseudomonas viridis in complexes with the herbicide atrazine and two chiral atrazine derivatives also lead to a new model of the bound carotenoid.
pubmed doi rcsb
total genus 104
structure length 273
sequence length 273
ec nomenclature
pdb deposition date 1997-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00124 Photo_RC Photosynthetic reaction centre protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.85.10 Mainly Alpha Up-down Bundle Photosynthetic Reaction Center, subunit M; domain 1 Photosystem II protein D1-like 6prcL01
1.20.85.10 Mainly Alpha Up-down Bundle Photosynthetic Reaction Center, subunit M; domain 1 Photosystem II protein D1-like 6prcL02
7PRCL 1DS8M 1JH0L 3WMMM 2UX4M 4HBJL 1UMXL 1KBYM 1YSTM 2J8DL 1MPSM 2UXLM 2HITL 4RCRM 1JGYL 1RQKL 1AIGL 4H99L 2UXKL 2JBLM 3G7FL 1DV3M 1L9BM 2BOZM 2HG3M 4TQQL 1JGWM 1RY5L 2X5VL 2GMRM 2X5UM 3DTSL 1JGXL 2WJNL 1E14M 1PSSL 2HG9M 2HH1L 1PSTL 1RZZL 1PRCL 2HHKL 1R2CM 1L9JL 1RGNM 1F6NM 3DTRM 1RVJL 2I5NL 2UX5M 6PRCM 2UXMM 4IN7M 2BNSA 1DV6L 3T6DL 1M3XM 1QOVL 1RG5M 5LSEM 5PRCM 1OGVL 3I4DM 3PRCM 4N7KM 4LWYM 1RZHL 4IN6L 1K6NM 3ZUWM 2UXJL 1YF6M 3WMML 1AIJM 1DXRM 2UWVL 1PCRL 1FNPL 4H9LL 2JIYM 1KBYL 1YSTL 3DU3L 2PRCM 2WX5L 3D38M 4HBHM 2UWSM 1JGZM 2BNPA 2HG3L 1JGWL 1FNQM 1K6LL 2GMRL 2WJMM 2UX3M 3V3YM 2J8CM 3ZUMM 4N7LM 1E14L 2HG9L 2UWUL 1JH0M 2GNUM 2UWWM 3DSYL 2UWTM 1UMXM 5LRIM 3T6EM 2JJ0M 3DTRL 2HITM 2UX5L 6PRCL 1JGYM 1AIGM 3DTAL 3DUQL 4IN5M 1M3XL 4TQQM 5PRCL 3I4DL 2X5VM 1DS8L 4LWYL 3DTSM 1K6NL 2UX4L 1S00M 3DU2M 1MPSL 1PSSM 1DXRL 2UXLL 4RCRL 3V3ZM 5LRIL 2HJ6M 1PSTM 1PRCM 1EYSM 2JBLL 1DV3L 1L9BL 1L9JM 2BOZL 4HBHL 1RVJM 1VRNM 2UWSL 2X5UL 2RCRM 1E6DM 1DV6M 2WJML 2UX3L 7PRCM 1OGVM 2BNSB 4IN6M 2UXJM 4HBJM 2GNUL 4CASC 1R2CL 2J8DM 1RGNL 2UWWL 1F6NL 2UWVM 1PCRM 1FNPM 2UWTL 4H9LM 1RQKM 2UXML 3DU3M 4H99M 4IN7L 2JJ0L 2UXKM 3T6EL 2WX5M 3G7FM 5LSEL 1RG5L 3PRCL 1RY5M 4IN5L 4N7KL 3ZUWL 1K6LM 1JGXM 1YF6L 2WJNM 1AIJL 1S00L 2BNPB 2HH1M 2JIYL 3DU2L 1RZZM 2UWUM 2PRCL 4CASB 3D38L 3V3ZL 2HHKM 2HJ6L 3DSYM 1EYSL 2I5NM 1JGZL 1VRNL 1FNQL 3T6DM 1QOVM 2RCRL 3DTAM 1E6DL 3DUQM 3V3YL 2J8CL 1RZHM 3ZUML 4N7LL
chains in the Genus database with same CATH superfamily
7PRCL 1DS8M 1JH0L 3WMMM 2UX4M 4HBJL 1UMXL 1KBYM 1YSTM 2J8DL 1MPSM 2UXLM 2HITL 4RCRM 1JGYL 1RQKL 1AIGL 4H99L 2UXKL 2JBLM 3G7FL 1DV3M 1L9BM 2BOZM 2HG3M 4TQQL 1JGWM 1RY5L 2X5VL 2GMRM 2X5UM 3DTSL 1JGXL 2WJNL 1E14M 1PSSL 2HG9M 2HH1L 1PSTL 1RZZL 1PRCL 2HHKL 1R2CM 1L9JL 1RGNM 1F6NM 3DTRM 1RVJL 2I5NL 2UX5M 6PRCM 2UXMM 4IN7M 2BNSA 1DV6L 3T6DL 1M3XM 1QOVL 1RG5M 5LSEM 5PRCM 1OGVL 3I4DM 3PRCM 4N7KM 4LWYM 1RZHL 4IN6L 1K6NM 3ZUWM 2UXJL 3WRYC 1YF6M 3WMML 1AIJM 1DXRM 2UWVL 1PCRL 1FNPL 4H9LL 2JIYM 1KBYL 1YSTL 3DU3L 2PRCM 2WX5L 3D38M 4HBHM 2UWSM 1JGZM 2BNPA 2HG3L 1JGWL 1FNQM 1K6LL 2GMRL 2WJMM 2UX3M 3V3YM 2J8CM 3ZUMM 4N7LM 1E14L 2HG9L 2UWUL 1JH0M 2GNUM 2UWWM 3DSYL 3VKWA 2UWTM 1UMXM 5LRIM 3T6EM 2JJ0M 3DTRL 2HITM 2UX5L 6PRCL 1JGYM 1AIGM 3DTAL 3DUQL 4IN5M 1M3XL 4TQQM 5PRCL 3I4DL 2X5VM 1DS8L 4LWYL 3DTSM 1K6NL 2UX4L 1S00M 3DU2M 1MPSL 1PSSM 1DXRL 2UXLL 4RCRL 3V3ZM 5LRIL 2HJ6M 1PSTM 1PRCM 1EYSM 2JBLL 1DV3L 1L9BL 1L9JM 2BOZL 4HBHL 1RVJM 1VRNM 2UWSL 2X5UL 2RCRM 1E6DM 1DV6M 2WJML 2UX3L 7PRCM 1OGVM 2BNSB 4IN6M 2UXJM 4HBJM 2GNUL 4CASC 1R2CL 2J8DM 1RGNL 2UWWL 1F6NL 2UWVM 1PCRM 1FNPM 2UWTL 4H9LM 1RQKM 2UXML 3DU3M 4H99M 4IN7L 2JJ0L 2UXKM 3T6EL 2WX5M 3G7FM 5LSEL 1RG5L 3PRCL 1RY5M 4IN5L 4N7KL 3ZUWL 1K6LM 1JGXM 1YF6L 2WJNM 1AIJL 1S00L 2BNPB 2HH1M 2JIYL 3DU2L 1RZZM 2UWUM 2PRCL 4CASB 3D38L 3V3ZL 2HHKM 2HJ6L 3DSYM 3WRXC 1EYSL 2I5NM 1JGZL 1VRNL 1FNQL 3T6DM 1QOVM 2RCRL 3DTAM 1E6DL 3DUQM 3V3YL 2J8CL 1RZHM 3ZUML 4N7LL
chains in the Genus database with same CATH topology
7PRCL 1DS8M 1JH0L 3WMMM 2UX4M 4HBJL 1UMXL 1KBYM 1YSTM 2J8DL 1MPSM 2UXLM 2HITL 4RCRM 1JGYL 1RQKL 1AIGL 4H99L 2UXKL 2JBLM 3G7FL 1DV3M 1L9BM 2BOZM 2HG3M 4TQQL 1JGWM 1RY5L 2X5VL 2GMRM 2X5UM 3DTSL 1JGXL 2WJNL 1E14M 1PSSL 2HG9M 2HH1L 1PSTL 1RZZL 1PRCL 2HHKL 1R2CM 1L9JL 1RGNM 1F6NM 3DTRM 1RVJL 2I5NL 2UX5M 6PRCM 2UXMM 4IN7M 2BNSA 1DV6L 3T6DL 1M3XM 1QOVL 1RG5M 5LSEM 5PRCM 1OGVL 3I4DM 3PRCM 4N7KM 4LWYM 1RZHL 4IN6L 1K6NM 3ZUWM 2UXJL 1YF6M 3WMML 1AIJM 1DXRM 2UWVL 1PCRL 1FNPL 4H9LL 2JIYM 1KBYL 1YSTL 3DU3L 2PRCM 2WX5L 3D38M 4HBHM 2UWSM 1JGZM 2BNPA 2HG3L 1JGWL 1FNQM 1K6LL 2GMRL 2WJMM 2UX3M 3V3YM 2J8CM 3ZUMM 4N7LM 1E14L 2HG9L 2UWUL 1JH0M 2GNUM 2UWWM 3DSYL 2UWTM 1UMXM 5LRIM 3T6EM 2JJ0M 3DTRL 2HITM 2UX5L 6PRCL 1JGYM 1AIGM 3DTAL 3DUQL 4IN5M 1M3XL 4TQQM 5PRCL 3I4DL 2X5VM 1DS8L 4LWYL 3DTSM 1K6NL 2UX4L 1S00M 3DU2M 1MPSL 1PSSM 1DXRL 2UXLL 4RCRL 3V3ZM 5LRIL 2HJ6M 1PSTM 1PRCM 1EYSM 2JBLL 1DV3L 1L9BL 1L9JM 2BOZL 4HBHL 1RVJM 1VRNM 2UWSL 2X5UL 2RCRM 1E6DM 1DV6M 2WJML 2UX3L 7PRCM 1OGVM 2BNSB 4IN6M 2UXJM 4HBJM 2GNUL 4CASC 1R2CL 2J8DM 1RGNL 2UWWL 1F6NL 2UWVM 1PCRM 1FNPM 2UWTL 4H9LM 1RQKM 2UXML 3DU3M 4H99M 4IN7L 2JJ0L 2UXKM 3T6EL 2WX5M 3G7FM 5LSEL 1RG5L 3PRCL 1RY5M 4IN5L 4N7KL 3ZUWL 1K6LM 1JGXM 1YF6L 2WJNM 1AIJL 1S00L 2BNPB 2HH1M 2JIYL 3DU2L 1RZZM 2UWUM 2PRCL 4CASB 3D38L 3V3ZL 2HHKM 2HJ6L 3DSYM 1EYSL 2I5NM 1JGZL 1VRNL 1FNQL 3T6DM 1QOVM 2RCRL 3DTAM 1E6DL 3DUQM 3V3YL 2J8CL 1RZHM 3ZUML 4N7LL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 7PRC L;  1DS8 M;  1JH0 L;  3WMM M;  2UX4 M;  4HBJ L;  1UMX L;  1KBY M;  1YST M;  2J8D L;  1MPS M;  2UXL M;  2HIT L;  4RCR M;  1JGY L;  1RQK L;  1AIG L;  4H99 L;  2UXK L;  2JBL M;  3G7F L;  1DV3 M;  1L9B M;  2BOZ M;  2HG3 M;  4TQQ L;  1JGW M;  1RY5 L;  2X5V L;  2GMR M;  2X5U M;  3DTS L;  1JGX L;  2WJN L;  1E14 M;  1PSS L;  2HG9 M;  2HH1 L;  1PST L;  1RZZ L;  1PRC L;  2HHK L;  1R2C M;  1L9J L;  1RGN M;  1F6N M;  3DTR M;  1RVJ L;  2I5N L;  2UX5 M;  6PRC M;  2UXM M;  4IN7 M;  2BNS A;  1DV6 L;  3T6D L;  1M3X M;  1QOV L;  1RG5 M;  5LSE M;  5PRC M;  1OGV L;  3I4D M;  3PRC M;  4N7K M;  4LWY M;  1RZH L;  4IN6 L;  1K6N M;  3ZUW M;  2UXJ L;  1YF6 M;  3WMM L;  1AIJ M;  1DXR M;  2UWV L;  1PCR L;  1FNP L;  4H9L L;  2JIY M;  1KBY L;  1YST L;  3DU3 L;  2PRC M;  2WX5 L;  3D38 M;  4HBH M;  2UWS M;  1JGZ M;  2BNP A;  2HG3 L;  1JGW L;  1FNQ M;  1K6L L;  2GMR L;  2WJM M;  2UX3 M;  3V3Y M;  2J8C M;  3ZUM M;  4N7L M;  1E14 L;  2HG9 L;  2UWU L;  1JH0 M;  2GNU M;  2UWW M;  3DSY L;  2UWT M;  1UMX M;  5LRI M;  3T6E M;  2JJ0 M;  3DTR L;  2HIT M;  2UX5 L;  6PRC L;  1JGY M;  1AIG M;  3DTA L;  3DUQ L;  4IN5 M;  1M3X L;  4TQQ M;  5PRC L;  3I4D L;  2X5V M;  1DS8 L;  4LWY L;  3DTS M;  1K6N L;  2UX4 L;  1S00 M;  3DU2 M;  1MPS L;  1PSS M;  1DXR L;  2UXL L;  4RCR L;  3V3Z M;  5LRI L;  2HJ6 M;  1PST M;  1PRC M;  1EYS M;  2JBL L;  1DV3 L;  1L9B L;  1L9J M;  2BOZ L;  4HBH L;  1RVJ M;  1VRN M;  2UWS L;  2X5U L;  2RCR M;  1E6D M;  1DV6 M;  2WJM L;  2UX3 L;  7PRC M;  1OGV M;  2BNS B;  4IN6 M;  2UXJ M;  4HBJ M;  2GNU L;  4CAS C;  1R2C L;  2J8D M;  1RGN L;  2UWW L;  1F6N L;  2UWV M;  1PCR M;  1FNP M;  2UWT L;  4H9L M;  1RQK M;  2UXM L;  3DU3 M;  4H99 M;  4IN7 L;  2JJ0 L;  2UXK M;  3T6E L;  2WX5 M;  3G7F M;  5LSE L;  1RG5 L;  3PRC L;  1RY5 M;  4IN5 L;  4N7K L;  3ZUW L;  1K6L M;  1JGX M;  1YF6 L;  2WJN M;  1AIJ L;  1S00 L;  2BNP B;  2HH1 M;  2JIY L;  3DU2 L;  1RZZ M;  2UWU M;  2PRC L;  4CAS B;  3D38 L;  3V3Z L;  2HHK M;  2HJ6 L;  3DSY M;  1EYS L;  2I5N M;  1JGZ L;  1VRN L;  1FNQ L;  3T6D M;  1QOV M;  2RCR L;  3DTA M;  1E6D L;  3DUQ M;  3V3Y L;  2J8C L;  1RZH M;  3ZUM L;  4N7L L; 
#chains in the Genus database with same CATH topology
 7PRC L;  1DS8 M;  1JH0 L;  3WMM M;  2UX4 M;  4HBJ L;  1UMX L;  1KBY M;  1YST M;  2J8D L;  1MPS M;  2UXL M;  2HIT L;  4RCR M;  1JGY L;  1RQK L;  1AIG L;  4H99 L;  2UXK L;  2JBL M;  3G7F L;  1DV3 M;  1L9B M;  2BOZ M;  2HG3 M;  4TQQ L;  1JGW M;  1RY5 L;  2X5V L;  2GMR M;  2X5U M;  3DTS L;  1JGX L;  2WJN L;  1E14 M;  1PSS L;  2HG9 M;  2HH1 L;  1PST L;  1RZZ L;  1PRC L;  2HHK L;  1R2C M;  1L9J L;  1RGN M;  1F6N M;  3DTR M;  1RVJ L;  2I5N L;  2UX5 M;  6PRC M;  2UXM M;  4IN7 M;  2BNS A;  1DV6 L;  3T6D L;  1M3X M;  1QOV L;  1RG5 M;  5LSE M;  5PRC M;  1OGV L;  3I4D M;  3PRC M;  4N7K M;  4LWY M;  1RZH L;  4IN6 L;  1K6N M;  3ZUW M;  2UXJ L;  3WRY C;  1YF6 M;  3WMM L;  1AIJ M;  1DXR M;  2UWV L;  1PCR L;  1FNP L;  4H9L L;  2JIY M;  1KBY L;  1YST L;  3DU3 L;  2PRC M;  2WX5 L;  3D38 M;  4HBH M;  2UWS M;  1JGZ M;  2BNP A;  2HG3 L;  1JGW L;  1FNQ M;  1K6L L;  2GMR L;  2WJM M;  2UX3 M;  3V3Y M;  2J8C M;  3ZUM M;  4N7L M;  1E14 L;  2HG9 L;  2UWU L;  1JH0 M;  2GNU M;  2UWW M;  3DSY L;  3VKW A;  2UWT M;  1UMX M;  5LRI M;  3T6E M;  2JJ0 M;  3DTR L;  2HIT M;  2UX5 L;  6PRC L;  1JGY M;  1AIG M;  3DTA L;  3DUQ L;  4IN5 M;  1M3X L;  4TQQ M;  5PRC L;  3I4D L;  2X5V M;  1DS8 L;  4LWY L;  3DTS M;  1K6N L;  2UX4 L;  1S00 M;  3DU2 M;  1MPS L;  1PSS M;  1DXR L;  2UXL L;  4RCR L;  3V3Z M;  5LRI L;  2HJ6 M;  1PST M;  1PRC M;  1EYS M;  2JBL L;  1DV3 L;  1L9B L;  1L9J M;  2BOZ L;  4HBH L;  1RVJ M;  1VRN M;  2UWS L;  2X5U L;  2RCR M;  1E6D M;  1DV6 M;  2WJM L;  2UX3 L;  7PRC M;  1OGV M;  2BNS B;  4IN6 M;  2UXJ M;  4HBJ M;  2GNU L;  4CAS C;  1R2C L;  2J8D M;  1RGN L;  2UWW L;  1F6N L;  2UWV M;  1PCR M;  1FNP M;  2UWT L;  4H9L M;  1RQK M;  2UXM L;  3DU3 M;  4H99 M;  4IN7 L;  2JJ0 L;  2UXK M;  3T6E L;  2WX5 M;  3G7F M;  5LSE L;  1RG5 L;  3PRC L;  1RY5 M;  4IN5 L;  4N7K L;  3ZUW L;  1K6L M;  1JGX M;  1YF6 L;  2WJN M;  1AIJ L;  1S00 L;  2BNP B;  2HH1 M;  2JIY L;  3DU2 L;  1RZZ M;  2UWU M;  2PRC L;  4CAS B;  3D38 L;  3V3Z L;  2HHK M;  2HJ6 L;  3DSY M;  3WRX C;  1EYS L;  2I5N M;  1JGZ L;  1VRN L;  1FNQ L;  3T6D M;  1QOV M;  2RCR L;  3DTA M;  1E6D L;  3DUQ M;  3V3Y L;  2J8C L;  1RZH M;  3ZUM L;  4N7L L; 
#chains in the Genus database with same CATH homology
 7PRC L;  1DS8 M;  1JH0 L;  3WMM M;  2UX4 M;  4HBJ L;  1UMX L;  1KBY M;  1YST M;  2J8D L;  1MPS M;  2UXL M;  2HIT L;  4RCR M;  1JGY L;  1RQK L;  1AIG L;  4H99 L;  2UXK L;  2JBL M;  3G7F L;  1DV3 M;  1L9B M;  2BOZ M;  2HG3 M;  4TQQ L;  1JGW M;  1RY5 L;  2X5V L;  2GMR M;  2X5U M;  3DTS L;  1JGX L;  2WJN L;  1E14 M;  1PSS L;  2HG9 M;  2HH1 L;  1PST L;  1RZZ L;  1PRC L;  2HHK L;  1R2C M;  1L9J L;  1RGN M;  1F6N M;  3DTR M;  1RVJ L;  2I5N L;  2UX5 M;  6PRC M;  2UXM M;  4IN7 M;  2BNS A;  1DV6 L;  3T6D L;  1M3X M;  1QOV L;  1RG5 M;  5LSE M;  5PRC M;  1OGV L;  3I4D M;  3PRC M;  4N7K M;  4LWY M;  1RZH L;  4IN6 L;  1K6N M;  3ZUW M;  2UXJ L;  1YF6 M;  3WMM L;  1AIJ M;  1DXR M;  2UWV L;  1PCR L;  1FNP L;  4H9L L;  2JIY M;  1KBY L;  1YST L;  3DU3 L;  2PRC M;  2WX5 L;  3D38 M;  4HBH M;  2UWS M;  1JGZ M;  2BNP A;  2HG3 L;  1JGW L;  1FNQ M;  1K6L L;  2GMR L;  2WJM M;  2UX3 M;  3V3Y M;  2J8C M;  3ZUM M;  4N7L M;  1E14 L;  2HG9 L;  2UWU L;  1JH0 M;  2GNU M;  2UWW M;  3DSY L;  2UWT M;  1UMX M;  5LRI M;  3T6E M;  2JJ0 M;  3DTR L;  2HIT M;  2UX5 L;  6PRC L;  1JGY M;  1AIG M;  3DTA L;  3DUQ L;  4IN5 M;  1M3X L;  4TQQ M;  5PRC L;  3I4D L;  2X5V M;  1DS8 L;  4LWY L;  3DTS M;  1K6N L;  2UX4 L;  1S00 M;  3DU2 M;  1MPS L;  1PSS M;  1DXR L;  2UXL L;  4RCR L;  3V3Z M;  5LRI L;  2HJ6 M;  1PST M;  1PRC M;  1EYS M;  2JBL L;  1DV3 L;  1L9B L;  1L9J M;  2BOZ L;  4HBH L;  1RVJ M;  1VRN M;  2UWS L;  2X5U L;  2RCR M;  1E6D M;  1DV6 M;  2WJM L;  2UX3 L;  7PRC M;  1OGV M;  2BNS B;  4IN6 M;  2UXJ M;  4HBJ M;  2GNU L;  4CAS C;  1R2C L;  2J8D M;  1RGN L;  2UWW L;  1F6N L;  2UWV M;  1PCR M;  1FNP M;  2UWT L;  4H9L M;  1RQK M;  2UXM L;  3DU3 M;  4H99 M;  4IN7 L;  2JJ0 L;  2UXK M;  3T6E L;  2WX5 M;  3G7F M;  5LSE L;  1RG5 L;  3PRC L;  1RY5 M;  4IN5 L;  4N7K L;  3ZUW L;  1K6L M;  1JGX M;  1YF6 L;  2WJN M;  1AIJ L;  1S00 L;  2BNP B;  2HH1 M;  2JIY L;  3DU2 L;  1RZZ M;  2UWU M;  2PRC L;  4CAS B;  3D38 L;  3V3Z L;  2HHK M;  2HJ6 L;  3DSY M;  1EYS L;  2I5N M;  1JGZ L;  1VRN L;  1FNQ L;  3T6D M;  1QOV M;  2RCR L;  3DTA M;  1E6D L;  3DUQ M;  3V3Y L;  2J8C L;  1RZH M;  3ZUM L;  4N7L L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...