7PRCL

Photosynthetic reaction center from rhodopseudomonas viridis (dg-420315 (triazine) complex)
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
273
structure length
273
Chain Sequence
ALLSFERKYRVRGGTLIGGDLFDFWVGPYFVGFFGVSAIFFIFLGVSLIGYAASQGPTWDPFAISINPPDLKYGLGAAPLLEGGFWQAITVCALGAFISWMLREVEISRKLGIGWHVPLAFCVPIFMFCVLQVFRPLLLGSWGHAFPYGILSHLDWVNNFGYQYLNWHYNPGHMSSVSFLFVNAMALGLHGGLILSVANPGDGDKVKTAEHENQYFRDVVGYSIGALSIHRLGLFLASNIFLTGAFGTIASGPFWTRGWPEWWGWWLDIPFWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthetic reaction center
molecule keywords PHOTOSYNTHETIC REACTION CENTER
publication title Refined crystal structures of reaction centres from Rhodopseudomonas viridis in complexes with the herbicide atrazine and two chiral atrazine derivatives also lead to a new model of the bound carotenoid.
pubmed doi rcsb
total genus 102
structure length 273
sequence length 273
ec nomenclature
pdb deposition date 1997-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00124 Photo_RC Photosynthetic reaction centre protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.85.10 Mainly Alpha Up-down Bundle Photosynthetic Reaction Center, subunit M; domain 1 Photosystem II protein D1-like 7prcL01
1.20.85.10 Mainly Alpha Up-down Bundle Photosynthetic Reaction Center, subunit M; domain 1 Photosystem II protein D1-like 7prcL02
2BNPB 3DU3L 3PRCM 1YSTL 1K6NM 1E14L 2I5NM 3DU3M 2X5UL 3WMML 1PRCL 2GNUM 2HG9M 4IN7M 3DTAM 2GMRL 2UXKL 3G7FL 2UWVL 3ZUWL 3ZUMM 3G7FM 1JGXL 3D38M 1PSTL 1UMXM 3T6DL 1JGXM 1JH0L 1L9JL 1OGVM 1DV6M 4TQQL 3T6DM 2PRCL 1QOVL 1DXRL 1L9BM 2BOZL 3V3YL 2BNSA 5LSEL 1RY5L 6PRCM 1AIGM 1JGZM 2PRCM 1DXRM 2BOZM 2HJ6M 2WJML 1RY5M 3PRCL 5PRCM 4CASC 1K6NL 2UXML 2I5NL 2WJMM 3DUQM 1K6LL 1RZHM 2GNUL 2HG9L 2UXMM 4IN7L 3DTAL 1YF6M 1MPSL 1K6LM 2J8CM 2JIYL 2UX5M 5LRIM 1RG5L 3ZUML 1MPSM 4HBHL 2JIYM 4LWYM 4N7LL 3DTRM 3D38L 1RG5M 1RVJL 4HBHM 4IN6M 1UMXL 1R2CL 2UWUM 4N7LM 1PSSL 1RVJM 1OGVL 1DV3L 1R2CM 2UXJL 1DV6L 1PSSM 1RGNL 1L9BL 1DV3M 2UX4L 1FNPM 2UXJM 2JBLM 1RGNM 6PRCL 1AIGL 1JGZL 1FNQL 2UX4M 4RCRL 2HJ6L 3T6EM 2WX5L 3DSYL 5PRCL 1FNQM 4RCRM 3DUQL 2WX5M 3DSYM 2X5VM 2BNSB 3DU2M 1RZZL 1E6DM 1RZHL 4H99L 2UWTL 1YF6L 1VRNM 1RZZM 2J8CL 4H99M 2UX5L 2WJNM 7PRCL 5LRIL 4HBJL 2UWTM 4LWYL 7PRCM 3DTRL 4HBJM 4IN6L 2UX3M 1AIJL 2UWUL 2UWSL 4IN5M 2J8DM 1AIJM 3I4DM 2UWSM 4H9LM 1F6NL 2HH1M 1FNPL 2JBLL 2BNPA 1F6NM 2HHKL 1S00L 3T6EL 2UWWM 1M3XM 1EYSL 3V3ZL 4CASB 1PCRL 1S00M 2HHKM 2X5VL 2RCRM 1EYSM 2X5UM 3V3ZM 3DU2L 1E6DL 1JGWL 1PCRM 3DTSL 1VRNL 1YSTM 1JGYL 1JGWM 2WJNL 1E14M 3DTSM 1KBYL 1RQKL 4N7KL 3WMMM 1JGYM 1PRCM 2HG3L 2GMRM 1KBYM 2UX3L 1RQKM 4N7KM 2HG3M 2UXKM 2UWVM 4IN5L 1DS8L 3ZUWM 2J8DL 3I4DL 1DS8M 1PSTM 2HH1L 4H9LL 1JH0M 1L9JM 2UXLL 2HITL 2UWWL 2JJ0L 1M3XL 4TQQM 1QOVM 2UXLM 3V3YM 2HITM 5LSEM 2JJ0M 2RCRL
chains in the Genus database with same CATH superfamily
2BNPB 3DU3L 3PRCM 1YSTL 1K6NM 1E14L 2I5NM 3DU3M 2X5UL 3WMML 1PRCL 2GNUM 2HG9M 4IN7M 3DTAM 2GMRL 2UXKL 3G7FL 2UWVL 3ZUWL 3ZUMM 3G7FM 1JGXL 3D38M 1PSTL 1UMXM 3T6DL 1JGXM 1JH0L 1L9JL 1OGVM 1DV6M 4TQQL 3T6DM 2PRCL 1QOVL 1DXRL 1L9BM 2BOZL 3V3YL 2BNSA 5LSEL 1RY5L 6PRCM 1AIGM 1JGZM 2PRCM 1DXRM 2BOZM 2HJ6M 2WJML 1RY5M 3PRCL 5PRCM 4CASC 1K6NL 2UXML 2I5NL 2WJMM 3DUQM 1K6LL 1RZHM 2GNUL 2HG9L 2UXMM 4IN7L 3DTAL 1YF6M 1MPSL 1K6LM 2J8CM 2JIYL 2UX5M 5LRIM 1RG5L 3ZUML 1MPSM 4HBHL 2JIYM 4LWYM 4N7LL 3DTRM 3D38L 1RG5M 1RVJL 4HBHM 4IN6M 1UMXL 1R2CL 2UWUM 4N7LM 1PSSL 1RVJM 1OGVL 1DV3L 1R2CM 2UXJL 1DV6L 1PSSM 1RGNL 1L9BL 1DV3M 2UX4L 1FNPM 2UXJM 2JBLM 1RGNM 6PRCL 1AIGL 1JGZL 1FNQL 2UX4M 4RCRL 2HJ6L 3T6EM 2WX5L 3DSYL 5PRCL 1FNQM 4RCRM 3DUQL 2WX5M 3DSYM 2X5VM 3WRYC 2BNSB 3DU2M 1RZZL 1E6DM 1RZHL 4H99L 2UWTL 1YF6L 1VRNM 1RZZM 2J8CL 4H99M 2UX5L 2WJNM 7PRCL 5LRIL 4HBJL 2UWTM 4LWYL 7PRCM 3WRXC 3DTRL 4HBJM 4IN6L 2UX3M 1AIJL 2UWUL 2UWSL 4IN5M 2J8DM 1AIJM 3I4DM 2UWSM 4H9LM 1F6NL 2HH1M 1FNPL 2JBLL 2BNPA 1F6NM 2HHKL 1S00L 3T6EL 2UWWM 1M3XM 1EYSL 3V3ZL 4CASB 1PCRL 1S00M 2HHKM 2X5VL 2RCRM 1EYSM 2X5UM 3V3ZM 3DU2L 1E6DL 1JGWL 1PCRM 3VKWA 3DTSL 1VRNL 1YSTM 1JGYL 1JGWM 2WJNL 1E14M 3DTSM 1KBYL 1RQKL 4N7KL 3WMMM 1JGYM 1PRCM 2HG3L 2GMRM 1KBYM 2UX3L 1RQKM 4N7KM 2HG3M 2UXKM 2UWVM 4IN5L 1DS8L 3ZUWM 2J8DL 3I4DL 1DS8M 1PSTM 2HH1L 4H9LL 1JH0M 1L9JM 2UXLL 2HITL 2UWWL 2JJ0L 1M3XL 4TQQM 1QOVM 2UXLM 3V3YM 2HITM 5LSEM 2JJ0M 2RCRL
chains in the Genus database with same CATH topology
2BNPB 3DU3L 3PRCM 1YSTL 1K6NM 1E14L 2I5NM 3DU3M 2X5UL 3WMML 1PRCL 2GNUM 2HG9M 4IN7M 3DTAM 2GMRL 2UXKL 3G7FL 2UWVL 3ZUWL 3ZUMM 3G7FM 1JGXL 3D38M 1PSTL 1UMXM 3T6DL 1JGXM 1JH0L 1L9JL 1OGVM 1DV6M 4TQQL 3T6DM 2PRCL 1QOVL 1DXRL 1L9BM 2BOZL 3V3YL 2BNSA 5LSEL 1RY5L 6PRCM 1AIGM 1JGZM 2PRCM 1DXRM 2BOZM 2HJ6M 2WJML 1RY5M 3PRCL 5PRCM 4CASC 1K6NL 2UXML 2I5NL 2WJMM 3DUQM 1K6LL 1RZHM 2GNUL 2HG9L 2UXMM 4IN7L 3DTAL 1YF6M 1MPSL 1K6LM 2J8CM 2JIYL 2UX5M 5LRIM 1RG5L 3ZUML 1MPSM 4HBHL 2JIYM 4LWYM 4N7LL 3DTRM 3D38L 1RG5M 1RVJL 4HBHM 4IN6M 1UMXL 1R2CL 2UWUM 4N7LM 1PSSL 1RVJM 1OGVL 1DV3L 1R2CM 2UXJL 1DV6L 1PSSM 1RGNL 1L9BL 1DV3M 2UX4L 1FNPM 2UXJM 2JBLM 1RGNM 6PRCL 1AIGL 1JGZL 1FNQL 2UX4M 4RCRL 2HJ6L 3T6EM 2WX5L 3DSYL 5PRCL 1FNQM 4RCRM 3DUQL 2WX5M 3DSYM 2X5VM 2BNSB 3DU2M 1RZZL 1E6DM 1RZHL 4H99L 2UWTL 1YF6L 1VRNM 1RZZM 2J8CL 4H99M 2UX5L 2WJNM 7PRCL 5LRIL 4HBJL 2UWTM 4LWYL 7PRCM 3DTRL 4HBJM 4IN6L 2UX3M 1AIJL 2UWUL 2UWSL 4IN5M 2J8DM 1AIJM 3I4DM 2UWSM 4H9LM 1F6NL 2HH1M 1FNPL 2JBLL 2BNPA 1F6NM 2HHKL 1S00L 3T6EL 2UWWM 1M3XM 1EYSL 3V3ZL 4CASB 1PCRL 1S00M 2HHKM 2X5VL 2RCRM 1EYSM 2X5UM 3V3ZM 3DU2L 1E6DL 1JGWL 1PCRM 3DTSL 1VRNL 1YSTM 1JGYL 1JGWM 2WJNL 1E14M 3DTSM 1KBYL 1RQKL 4N7KL 3WMMM 1JGYM 1PRCM 2HG3L 2GMRM 1KBYM 2UX3L 1RQKM 4N7KM 2HG3M 2UXKM 2UWVM 4IN5L 1DS8L 3ZUWM 2J8DL 3I4DL 1DS8M 1PSTM 2HH1L 4H9LL 1JH0M 1L9JM 2UXLL 2HITL 2UWWL 2JJ0L 1M3XL 4TQQM 1QOVM 2UXLM 3V3YM 2HITM 5LSEM 2JJ0M 2RCRL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BNP B;  3DU3 L;  3PRC M;  1YST L;  1K6N M;  1E14 L;  2I5N M;  3DU3 M;  2X5U L;  3WMM L;  1PRC L;  2GNU M;  2HG9 M;  4IN7 M;  3DTA M;  2GMR L;  2UXK L;  3G7F L;  2UWV L;  3ZUW L;  3ZUM M;  3G7F M;  1JGX L;  3D38 M;  1PST L;  1UMX M;  3T6D L;  1JGX M;  1JH0 L;  1L9J L;  1OGV M;  1DV6 M;  4TQQ L;  3T6D M;  2PRC L;  1QOV L;  1DXR L;  1L9B M;  2BOZ L;  3V3Y L;  2BNS A;  5LSE L;  1RY5 L;  6PRC M;  1AIG M;  1JGZ M;  2PRC M;  1DXR M;  2BOZ M;  2HJ6 M;  2WJM L;  1RY5 M;  3PRC L;  5PRC M;  4CAS C;  1K6N L;  2UXM L;  2I5N L;  2WJM M;  3DUQ M;  1K6L L;  1RZH M;  2GNU L;  2HG9 L;  2UXM M;  4IN7 L;  3DTA L;  1YF6 M;  1MPS L;  1K6L M;  2J8C M;  2JIY L;  2UX5 M;  5LRI M;  1RG5 L;  3ZUM L;  1MPS M;  4HBH L;  2JIY M;  4LWY M;  4N7L L;  3DTR M;  3D38 L;  1RG5 M;  1RVJ L;  4HBH M;  4IN6 M;  1UMX L;  1R2C L;  2UWU M;  4N7L M;  1PSS L;  1RVJ M;  1OGV L;  1DV3 L;  1R2C M;  2UXJ L;  1DV6 L;  1PSS M;  1RGN L;  1L9B L;  1DV3 M;  2UX4 L;  1FNP M;  2UXJ M;  2JBL M;  1RGN M;  6PRC L;  1AIG L;  1JGZ L;  1FNQ L;  2UX4 M;  4RCR L;  2HJ6 L;  3T6E M;  2WX5 L;  3DSY L;  5PRC L;  1FNQ M;  4RCR M;  3DUQ L;  2WX5 M;  3DSY M;  2X5V M;  2BNS B;  3DU2 M;  1RZZ L;  1E6D M;  1RZH L;  4H99 L;  2UWT L;  1YF6 L;  1VRN M;  1RZZ M;  2J8C L;  4H99 M;  2UX5 L;  2WJN M;  7PRC L;  5LRI L;  4HBJ L;  2UWT M;  4LWY L;  7PRC M;  3DTR L;  4HBJ M;  4IN6 L;  2UX3 M;  1AIJ L;  2UWU L;  2UWS L;  4IN5 M;  2J8D M;  1AIJ M;  3I4D M;  2UWS M;  4H9L M;  1F6N L;  2HH1 M;  1FNP L;  2JBL L;  2BNP A;  1F6N M;  2HHK L;  1S00 L;  3T6E L;  2UWW M;  1M3X M;  1EYS L;  3V3Z L;  4CAS B;  1PCR L;  1S00 M;  2HHK M;  2X5V L;  2RCR M;  1EYS M;  2X5U M;  3V3Z M;  3DU2 L;  1E6D L;  1JGW L;  1PCR M;  3DTS L;  1VRN L;  1YST M;  1JGY L;  1JGW M;  2WJN L;  1E14 M;  3DTS M;  1KBY L;  1RQK L;  4N7K L;  3WMM M;  1JGY M;  1PRC M;  2HG3 L;  2GMR M;  1KBY M;  2UX3 L;  1RQK M;  4N7K M;  2HG3 M;  2UXK M;  2UWV M;  4IN5 L;  1DS8 L;  3ZUW M;  2J8D L;  3I4D L;  1DS8 M;  1PST M;  2HH1 L;  4H9L L;  1JH0 M;  1L9J M;  2UXL L;  2HIT L;  2UWW L;  2JJ0 L;  1M3X L;  4TQQ M;  1QOV M;  2UXL M;  3V3Y M;  2HIT M;  5LSE M;  2JJ0 M;  2RCR L; 
#chains in the Genus database with same CATH topology
 2BNP B;  3DU3 L;  3PRC M;  1YST L;  1K6N M;  1E14 L;  2I5N M;  3DU3 M;  2X5U L;  3WMM L;  1PRC L;  2GNU M;  2HG9 M;  4IN7 M;  3DTA M;  2GMR L;  2UXK L;  3G7F L;  2UWV L;  3ZUW L;  3ZUM M;  3G7F M;  1JGX L;  3D38 M;  1PST L;  1UMX M;  3T6D L;  1JGX M;  1JH0 L;  1L9J L;  1OGV M;  1DV6 M;  4TQQ L;  3T6D M;  2PRC L;  1QOV L;  1DXR L;  1L9B M;  2BOZ L;  3V3Y L;  2BNS A;  5LSE L;  1RY5 L;  6PRC M;  1AIG M;  1JGZ M;  2PRC M;  1DXR M;  2BOZ M;  2HJ6 M;  2WJM L;  1RY5 M;  3PRC L;  5PRC M;  4CAS C;  1K6N L;  2UXM L;  2I5N L;  2WJM M;  3DUQ M;  1K6L L;  1RZH M;  2GNU L;  2HG9 L;  2UXM M;  4IN7 L;  3DTA L;  1YF6 M;  1MPS L;  1K6L M;  2J8C M;  2JIY L;  2UX5 M;  5LRI M;  1RG5 L;  3ZUM L;  1MPS M;  4HBH L;  2JIY M;  4LWY M;  4N7L L;  3DTR M;  3D38 L;  1RG5 M;  1RVJ L;  4HBH M;  4IN6 M;  1UMX L;  1R2C L;  2UWU M;  4N7L M;  1PSS L;  1RVJ M;  1OGV L;  1DV3 L;  1R2C M;  2UXJ L;  1DV6 L;  1PSS M;  1RGN L;  1L9B L;  1DV3 M;  2UX4 L;  1FNP M;  2UXJ M;  2JBL M;  1RGN M;  6PRC L;  1AIG L;  1JGZ L;  1FNQ L;  2UX4 M;  4RCR L;  2HJ6 L;  3T6E M;  2WX5 L;  3DSY L;  5PRC L;  1FNQ M;  4RCR M;  3DUQ L;  2WX5 M;  3DSY M;  2X5V M;  3WRY C;  2BNS B;  3DU2 M;  1RZZ L;  1E6D M;  1RZH L;  4H99 L;  2UWT L;  1YF6 L;  1VRN M;  1RZZ M;  2J8C L;  4H99 M;  2UX5 L;  2WJN M;  7PRC L;  5LRI L;  4HBJ L;  2UWT M;  4LWY L;  7PRC M;  3WRX C;  3DTR L;  4HBJ M;  4IN6 L;  2UX3 M;  1AIJ L;  2UWU L;  2UWS L;  4IN5 M;  2J8D M;  1AIJ M;  3I4D M;  2UWS M;  4H9L M;  1F6N L;  2HH1 M;  1FNP L;  2JBL L;  2BNP A;  1F6N M;  2HHK L;  1S00 L;  3T6E L;  2UWW M;  1M3X M;  1EYS L;  3V3Z L;  4CAS B;  1PCR L;  1S00 M;  2HHK M;  2X5V L;  2RCR M;  1EYS M;  2X5U M;  3V3Z M;  3DU2 L;  1E6D L;  1JGW L;  1PCR M;  3VKW A;  3DTS L;  1VRN L;  1YST M;  1JGY L;  1JGW M;  2WJN L;  1E14 M;  3DTS M;  1KBY L;  1RQK L;  4N7K L;  3WMM M;  1JGY M;  1PRC M;  2HG3 L;  2GMR M;  1KBY M;  2UX3 L;  1RQK M;  4N7K M;  2HG3 M;  2UXK M;  2UWV M;  4IN5 L;  1DS8 L;  3ZUW M;  2J8D L;  3I4D L;  1DS8 M;  1PST M;  2HH1 L;  4H9L L;  1JH0 M;  1L9J M;  2UXL L;  2HIT L;  2UWW L;  2JJ0 L;  1M3X L;  4TQQ M;  1QOV M;  2UXL M;  3V3Y M;  2HIT M;  5LSE M;  2JJ0 M;  2RCR L; 
#chains in the Genus database with same CATH homology
 2BNP B;  3DU3 L;  3PRC M;  1YST L;  1K6N M;  1E14 L;  2I5N M;  3DU3 M;  2X5U L;  3WMM L;  1PRC L;  2GNU M;  2HG9 M;  4IN7 M;  3DTA M;  2GMR L;  2UXK L;  3G7F L;  2UWV L;  3ZUW L;  3ZUM M;  3G7F M;  1JGX L;  3D38 M;  1PST L;  1UMX M;  3T6D L;  1JGX M;  1JH0 L;  1L9J L;  1OGV M;  1DV6 M;  4TQQ L;  3T6D M;  2PRC L;  1QOV L;  1DXR L;  1L9B M;  2BOZ L;  3V3Y L;  2BNS A;  5LSE L;  1RY5 L;  6PRC M;  1AIG M;  1JGZ M;  2PRC M;  1DXR M;  2BOZ M;  2HJ6 M;  2WJM L;  1RY5 M;  3PRC L;  5PRC M;  4CAS C;  1K6N L;  2UXM L;  2I5N L;  2WJM M;  3DUQ M;  1K6L L;  1RZH M;  2GNU L;  2HG9 L;  2UXM M;  4IN7 L;  3DTA L;  1YF6 M;  1MPS L;  1K6L M;  2J8C M;  2JIY L;  2UX5 M;  5LRI M;  1RG5 L;  3ZUM L;  1MPS M;  4HBH L;  2JIY M;  4LWY M;  4N7L L;  3DTR M;  3D38 L;  1RG5 M;  1RVJ L;  4HBH M;  4IN6 M;  1UMX L;  1R2C L;  2UWU M;  4N7L M;  1PSS L;  1RVJ M;  1OGV L;  1DV3 L;  1R2C M;  2UXJ L;  1DV6 L;  1PSS M;  1RGN L;  1L9B L;  1DV3 M;  2UX4 L;  1FNP M;  2UXJ M;  2JBL M;  1RGN M;  6PRC L;  1AIG L;  1JGZ L;  1FNQ L;  2UX4 M;  4RCR L;  2HJ6 L;  3T6E M;  2WX5 L;  3DSY L;  5PRC L;  1FNQ M;  4RCR M;  3DUQ L;  2WX5 M;  3DSY M;  2X5V M;  2BNS B;  3DU2 M;  1RZZ L;  1E6D M;  1RZH L;  4H99 L;  2UWT L;  1YF6 L;  1VRN M;  1RZZ M;  2J8C L;  4H99 M;  2UX5 L;  2WJN M;  7PRC L;  5LRI L;  4HBJ L;  2UWT M;  4LWY L;  7PRC M;  3DTR L;  4HBJ M;  4IN6 L;  2UX3 M;  1AIJ L;  2UWU L;  2UWS L;  4IN5 M;  2J8D M;  1AIJ M;  3I4D M;  2UWS M;  4H9L M;  1F6N L;  2HH1 M;  1FNP L;  2JBL L;  2BNP A;  1F6N M;  2HHK L;  1S00 L;  3T6E L;  2UWW M;  1M3X M;  1EYS L;  3V3Z L;  4CAS B;  1PCR L;  1S00 M;  2HHK M;  2X5V L;  2RCR M;  1EYS M;  2X5U M;  3V3Z M;  3DU2 L;  1E6D L;  1JGW L;  1PCR M;  3DTS L;  1VRN L;  1YST M;  1JGY L;  1JGW M;  2WJN L;  1E14 M;  3DTS M;  1KBY L;  1RQK L;  4N7K L;  3WMM M;  1JGY M;  1PRC M;  2HG3 L;  2GMR M;  1KBY M;  2UX3 L;  1RQK M;  4N7K M;  2HG3 M;  2UXK M;  2UWV M;  4IN5 L;  1DS8 L;  3ZUW M;  2J8D L;  3I4D L;  1DS8 M;  1PST M;  2HH1 L;  4H9L L;  1JH0 M;  1L9J M;  2UXL L;  2HIT L;  2UWW L;  2JJ0 L;  1M3X L;  4TQQ M;  1QOV M;  2UXL M;  3V3Y M;  2HIT M;  5LSE M;  2JJ0 M;  2RCR L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...